Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008503.486ON22522510991e-154
Skud_7.4373.486ON2302143693e-43
CAGL0I10604g3.486ON2112013562e-41
NDAI0G009803.486ON2342163547e-41
Suva_7.4143.486ON2302113486e-40
Smik_6.2223.486ON2302163415e-39
YGR126W3.486ON2302143372e-38
NCAS0E008503.486ON2302113312e-37
KAFR0C019203.486ON2232183112e-34
TDEL0D055403.486ON2162113083e-34
SAKL0F02904g3.486ON2222022841e-30
KLTH0F14696g3.486ON2191632752e-29
Kwal_55.212153.486ON1421422441e-25
TPHA0D032503.486ON2191522465e-25
KLLA0E04709g3.486ON1661611972e-18
Kpol_1017.103.486ON2341761653e-13
AFR322C3.503ON592781225e-07
TBLA0D029003.503ON6911501191e-06
CAGL0I10384g3.503ON630891182e-06
TPHA0D033103.503ON613611172e-06
KAFR0C020303.503ON624561153e-06
Kwal_47.189193.503ON640651137e-06
KNAG0B007303.503ON622571128e-06
Suva_16.4843.503ON622801129e-06
Skud_16.4503.503ON622801111e-05
KLLA0E03829g3.503ON609571111e-05
SAKL0F02442g3.503ON610551101e-05
YGR138C (TPO2)3.503ON614441102e-05
Suva_7.4253.503ON613441092e-05
Smik_6.2333.503ON614441092e-05
Skud_7.4483.503ON611441092e-05
TDEL0D057103.503ON616581083e-05
Kpol_1017.33.503ON621571083e-05
Smik_16.4083.503ON622801065e-05
NDAI0I027703.503ON626451065e-05
YPR156C (TPO3)3.503ON622801066e-05
KLTH0G02266g3.503ON644831056e-05
ZYRO0G19646g3.503ON594681031e-04
NCAS0E007503.503ON620491003e-04
NCAS0F036203.503ON634631003e-04
Kwal_33.13706singletonOFF12063635.6
YLR336C (SGD1)4.165ON89973665.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00850
         (225 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   427   e-154
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   146   3e-43
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   141   2e-41
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   140   7e-41
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   138   6e-40
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   135   5e-39
YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   134   2e-38
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   132   2e-37
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   124   2e-34
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   123   3e-34
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   114   1e-30
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   110   2e-29
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...    99   1e-25
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    99   5e-25
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    80   2e-18
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    68   3e-13
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    52   5e-07
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    50   1e-06
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    50   2e-06
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    50   2e-06
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    49   3e-06
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    48   7e-06
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    48   8e-06
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    48   9e-06
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    47   1e-05
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    47   1e-05
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    47   1e-05
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    47   2e-05
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    47   2e-05
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    47   2e-05
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    47   2e-05
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    46   3e-05
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    46   3e-05
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    45   5e-05
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     45   5e-05
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    45   6e-05
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    45   6e-05
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    44   1e-04
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               43   3e-04
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    43   3e-04
Kwal_33.13706 s33 complement(359208..359570) [363 bp, 120 aa] {O...    29   5.6  
YLR336C Chr12 complement(799697..802396) [2700 bp, 899 aa] {ON} ...    30   5.7  

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  427 bits (1099), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/225 (94%), Positives = 212/225 (94%)

Query: 1   MSNRSDIVTDPXXXXXXXXXXXXXYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENT 60
           MSNRSDIVTDP             YKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENT
Sbjct: 1   MSNRSDIVTDPEFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENT 60

Query: 61  ANTPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDIN 120
           ANTPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDIN
Sbjct: 61  ANTPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDIN 120

Query: 121 APLTLTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSM 180
           APLTLTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSM
Sbjct: 121 APLTLTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSM 180

Query: 181 EEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMFQ 225
           EEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMFQ
Sbjct: 181 EEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMFQ 225

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  146 bits (369), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 138/214 (64%), Gaps = 24/214 (11%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTIL------NSEDLAENTANTPSDLNSKASSTTLGK 78
           YKPEPF GF  + +  +  L KNDTI+      N E++ E   +  SD+ S  SS+TL +
Sbjct: 26  YKPEPFTGF-KDSQAPEQPLLKNDTIVGKAQSENEENIDEQHRH--SDVYSHHSSSTLKR 82

Query: 79  RDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSH---FPEEYQ 135
             SN+IE+++T NA+   SE+AD+L+ +GL+  K+  +PDI AP+T   +H   FPEEY+
Sbjct: 83  PSSNSIEKMITHNALEGNSETADSLKREGLNLNKKA-LPDITAPVT-NSAHNGAFPEEYR 140

Query: 136 VETETGLVKMKTIESLK---SRHSGGT--HNSKKSKGASTRSKNSLTSSMEEHGEAGLNA 190
           +ETETGLVK+KT+E+LK   SR S     H +  +   STRSK +  S       + L +
Sbjct: 141 LETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHSTRSKVTTYSQG-----SSLES 195

Query: 191 EKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
           +KLN AVE+N+K++E+Y K++ +KGIKGF  ++F
Sbjct: 196 DKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIF 229

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  141 bits (356), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/201 (44%), Positives = 125/201 (62%), Gaps = 17/201 (8%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSKASSTTLGKRDSNAI 84
           YKPEPF G    + ++ SR   N +     D          D  SK S  TL K DS AI
Sbjct: 26  YKPEPFTGLEHTKNENLSRKATNASQGTYMD----------DATSKHSGATLKKLDSLAI 75

Query: 85  ERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQS-HFPEEYQVETETGLV 143
           E+VVT+NA+   SE+ ++L++KGLD  +R+ IPD NAPLT T +  FPEEY++ET+TGLV
Sbjct: 76  EKVVTQNAVAGNSETIESLKAKGLDM-QRKAIPDYNAPLTTTGTNQFPEEYRLETDTGLV 134

Query: 144 KMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKLNSAVERNRKE 203
           KMKT+E+LK + +  + NS  S    + SK+    S     E    A+K+N AVERN+KE
Sbjct: 135 KMKTLETLKRKSTQVSRNSDLSSKDKSISKSQSNKS-----EVSDIAQKINMAVERNKKE 189

Query: 204 LERYEKNRGKKGIKGFLSKMF 224
           + +Y+K++ +KGIKGF  +MF
Sbjct: 190 IAKYQKHKSEKGIKGFFHRMF 210

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  140 bits (354), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 128/216 (59%), Gaps = 27/216 (12%)

Query: 25  YKPEPFVGF--------------GTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSK 70
           Y+PEPF G                T E+ HD      DT+++S          PS    +
Sbjct: 29  YQPEPFTGLKGNELPNAQPSTTATTTEQDHD------DTVISSHSHDTKHGEEPS----R 78

Query: 71  ASSTTLGKRDSNA--IERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQS 128
            S+ TL K DSN   IE+ +T N MN+++E+ D+L  +GL+T +++++ DIN PL    +
Sbjct: 79  TSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNT-RKKSVADINTPLNAGTA 137

Query: 129 HFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGL 188
            FPEEY++ETETGLVK KTIESL+ + S  + NS++S+   +       ++ +    + L
Sbjct: 138 EFPEEYRIETETGLVKAKTIESLRRQESIASANSRRSQDQGSFKSARTNNTRKSRASSSL 197

Query: 189 NAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
           +  KLN AVE+N+KELE+Y K++ +KGIKGF +++F
Sbjct: 198 DPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLF 233

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  138 bits (348), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 135/211 (63%), Gaps = 18/211 (8%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTIL----NSEDLAENTANTPSDLNSKASSTTLGKRD 80
           YKPEPF GF  + +  +  L KNDTI+    +  D + +  +  SD++S  SS+TL +  
Sbjct: 26  YKPEPFTGF-KDSQAPEQPLLKNDTIVGKGQSENDDSVDDQHRHSDVHSHHSSSTLKRPT 84

Query: 81  SNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT--LTQSHFPEEYQVET 138
           SN+IE++VT NA+   SE+ D+L+ +GL+  K+   PDI AP+T     + FPEEY++ET
Sbjct: 85  SNSIEKMVTHNALEGNSETVDSLKKEGLNLNKK-GTPDITAPVTNSAHDAAFPEEYRLET 143

Query: 139 ETGLVKMKTIESLK---SRHSGGT--HNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKL 193
           ETGLVK+KT+E+LK   SR SG    H    +   STRSK +  S       + L ++KL
Sbjct: 144 ETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHSTRSKATAYSQG-----SSLESDKL 198

Query: 194 NSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
           N AVE+N+K +E+Y+K++G+KGIKG   +MF
Sbjct: 199 NIAVEKNKKRIEKYQKHKGEKGIKGLFHRMF 229

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  135 bits (341), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 140/216 (64%), Gaps = 28/216 (12%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTILN-----SEDLAENTANTPSDLNSKASSTTLGKR 79
           YKPEPF GF  + +  D  L KNDTI+      ++D+ ++     SD++S  SS+TL + 
Sbjct: 26  YKPEPFTGFK-DSQLPDQPLMKNDTIVGKGQSENDDILDDQHRH-SDVHSHHSSSTLKRP 83

Query: 80  DSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSH---FPEEYQV 136
            SN+IE++VT+NA+   SE+ D+L+  GL+  K++ +PDI AP+T   +H   FPEEY++
Sbjct: 84  TSNSIEKMVTQNALEGTSETLDSLKEDGLNL-KKKALPDITAPVT-NSAHDATFPEEYRL 141

Query: 137 ETETGLVKMKTIESLKSRHSGGT-----HNSKKSKGASTRSK---NSLTSSMEEHGEAGL 188
           ETETGLVK+KT+E+L+   S  +     HN+  +   STRSK   NS  SS+E       
Sbjct: 142 ETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHSTRSKVTTNSQGSSLE------- 194

Query: 189 NAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
              KLN AVE+N+K++E+Y+K++ +KGIKGF  ++F
Sbjct: 195 -PNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIF 229

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  134 bits (337), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 134/214 (62%), Gaps = 24/214 (11%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENT----ANTPSDLNSKASSTTLGKRD 80
           YKPEPF GF  + E  +  L KNDTI+    L +++     +  SD++S  SS+TL +  
Sbjct: 26  YKPEPFTGFK-DSEAPEQPLLKNDTIVGKGQLEDDSNVDDQHRHSDVHSHHSSSTLKRPT 84

Query: 81  SNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT--LTQSHFPEEYQVET 138
           SN+IE++VT NA+   SE+ D+L+  GL+  K+  +PDI AP+T     + FPEEY++ET
Sbjct: 85  SNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKA-LPDITAPVTNSAHDAAFPEEYRLET 143

Query: 139 ETGLVKMKTIESLKSRHSGGT-----HNSKKSKGASTRSK---NSLTSSMEEHGEAGLNA 190
           ETGLVK+KT+ESLK   S  +     H +  +   STRSK   NS  SS+E         
Sbjct: 144 ETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLE--------P 195

Query: 191 EKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
            KLN AVE+N+K +E+Y+K++ +KGIKGF  ++F
Sbjct: 196 NKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIF 229

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  132 bits (331), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 125/211 (59%), Gaps = 18/211 (8%)

Query: 25  YKPEPFVGF-------GTEEEQHDSRLFKNDTILNSE--DLAENTANTPSDLNSKASSTT 75
           Y+PEPF G        GT+ +     L  ++T L  E  +    +++T   + S+ S +T
Sbjct: 26  YQPEPFTGVKEPTAYKGTDRKD---TLSGDETELKQEHTNATATSSHTKDGITSRTSMST 82

Query: 76  LGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSH--FPEE 133
           L + DSNAIERV+T NA    +E+  +L +KGLD  K+  + DINAPLT   +   FPEE
Sbjct: 83  LRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATL-DINAPLTSNPADVAFPEE 141

Query: 134 YQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKL 193
           Y +ETETGLVK KTIE+L+   S     S   +G    S  S  +   +     L AEKL
Sbjct: 142 YNLETETGLVKAKTIETLRRETS---RVSSTRRGDDVVSHKSQATGKSQRSAQSLQAEKL 198

Query: 194 NSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
           N AVE+N+KELE+ EK++ +KG+KGF++++F
Sbjct: 199 NLAVEKNKKELEKIEKHKHQKGLKGFMNRLF 229

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  124 bits (311), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 83/218 (38%), Positives = 124/218 (56%), Gaps = 32/218 (14%)

Query: 25  YKPEPFVGFGTEEEQHDSRLF----KNDTILNSEDLAENTANTPSDLN------------ 68
           YKPEPFVG G   E  D   F    K+     SE   E   +    +             
Sbjct: 19  YKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVDPLKQVQTNDSFWSFRSVS 78

Query: 69  --SKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLT 126
             S+ SS  L K+ S  IER+VT+NAM  ++E+ D+LR+ GLD TKR  +PDIN+P++  
Sbjct: 79  NTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATGLDLTKRA-VPDINSPIS-H 136

Query: 127 QSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEA 186
           +S   +E + ET+TGL+K KT+E+L   ++  + + +K  G    + NS TS        
Sbjct: 137 ESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKILG----NDNSNTS-------- 184

Query: 187 GLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
           GL+ E++N  VERNRK+LE+Y++++ +KG+KGF  K+F
Sbjct: 185 GLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIF 222

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  123 bits (308), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 118/211 (55%), Gaps = 34/211 (16%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSKASSTTLGKRDSNAI 84
           Y+P+PF G                     E+L +      S   S  S TTL  +DSN I
Sbjct: 28  YQPQPFTG--------------------QEELPQEKNPDSSSRRSSKSGTTLNHQDSNTI 67

Query: 85  ERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT--LTQSHFPEEYQVETETGL 142
           E+ VT NAMN  SE+A +L+  GLDT K+  IPDIN P+T     S FPEEY++ET+TGL
Sbjct: 68  EKEVTHNAMNGTSETAKSLQQAGLDTEKKA-IPDINGPITGNADTSQFPEEYRIETQTGL 126

Query: 143 VKMKTIESLK---SRHSGGTHN--SKKSKGASTRS----KNSLTSSMEEHGEAGLNAEKL 193
           VK+KT+  L    +R S G+    S+KS G  T          T+  E+  EA  NAE L
Sbjct: 127 VKLKTLNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQ--EAAQNAENL 184

Query: 194 NSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
             A+E+N+  +E++EK+R +KG+KGF+ ++F
Sbjct: 185 EHAIEKNKHRIEKFEKHRHEKGLKGFVHRLF 215

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  114 bits (284), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 80/202 (39%), Positives = 127/202 (62%), Gaps = 8/202 (3%)

Query: 25  YKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENTANTPSD-LNSKASSTTLGKRDSNA 83
           ++P+ F G     EQ        D I + E L+ N     S+ + S  SS TL K DSNA
Sbjct: 26  FEPQAFTGADPSVEQPTIDHELEDEI-DPEPLSGNPVRPNSEEILSVRSSNTLKKLDSNA 84

Query: 84  IERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLT-QSHFPEEYQVETETGL 142
           IE+V+T NA+   +E+ ++L+++GLD  +++ IPD N P   T +S FPEEYQ+ETETGL
Sbjct: 85  IEKVLTHNAVEGNTETLESLKTRGLDL-RKKAIPDYNNPAMHTDRSQFPEEYQIETETGL 143

Query: 143 VKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKLNSAVERNRK 202
           VK+KT++SL    +  +  +K S   +  ++    S+ +E    G + EKL  AV++N+K
Sbjct: 144 VKVKTLQSLNRLDTRVSLGNKPSTNQNMEAE----SAHDEQRPVGYDEEKLKKAVDKNKK 199

Query: 203 ELERYEKNRGKKGIKGFLSKMF 224
           ++E+Y+K++ +KGIKGF+S++F
Sbjct: 200 KIEKYQKHKHEKGIKGFMSRLF 221

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  110 bits (275), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 102/163 (62%), Gaps = 5/163 (3%)

Query: 66  DLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT- 124
           D +   S+ TL K+DSNAIE+++T NA   +SE+ ++L+  GL+  K+  IPDIN P   
Sbjct: 57  DFHRVKSNGTLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKA-IPDINNPAAN 115

Query: 125 LTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSS---ME 181
                FPEEYQ+ET+TGLVK +T+  L    S  +  S  S+  S R+ NS T+S     
Sbjct: 116 YKNCAFPEEYQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSIRTANSTTNSDLASA 175

Query: 182 EHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
            +   GL+ EKL  AVE+N+K++++Y+K++   G++ FL K+F
Sbjct: 176 NNTINGLDGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIF 218

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score = 98.6 bits (244), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 93/142 (65%), Gaps = 6/142 (4%)

Query: 88  VTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT-LTQSHFPEEYQVETETGLVKMK 146
           +T NA   +SE+ D+L+  GL+  ++  +PD N P    T   FPEEYQ+ET+TGLVK++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKA-VPDYNNPAANFTNCEFPEEYQLETDTGLVKVQ 59

Query: 147 TIES---LKSRHSGGTHNSKKSKGASTRSKN-SLTSSMEEHGEAGLNAEKLNSAVERNRK 202
           T++    L+SR S  + NS++    ST S + S++ S      +GL+AEKL  AVE+N++
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSISPSAGRSSNSGLDAEKLRKAVEKNKR 119

Query: 203 ELERYEKNRGKKGIKGFLSKMF 224
           ++++Y+K++   G+K FL K+F
Sbjct: 120 QIDKYQKHKASGGLKKFLGKIF 141

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 99.4 bits (246), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 97/152 (63%), Gaps = 4/152 (2%)

Query: 75  TLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLT-QSHFPEE 133
           T+    SN + R+V++N M+N  ES +AL+++  +   RR   DI  P ++   S+FPEE
Sbjct: 69  TIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR--ADIILPASMEGNSNFPEE 126

Query: 134 YQVETETGLVKMKTIESLKSRHSGGTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKL 193
           Y +ET TGLV +KT+E +K + +  + NS+KS  +S    +   ++++   E GLN  KL
Sbjct: 127 YTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVSSELKASKSNNTVKSRNEGGLNPAKL 186

Query: 194 NSAVERNRKELERYEKNRGKKG-IKGFLSKMF 224
           N+AVE+N++ELE+Y+ ++ +K  IK  L K+F
Sbjct: 187 NAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 80.5 bits (197), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 85/161 (52%), Gaps = 19/161 (11%)

Query: 65  SDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLT 124
           S L  K SS       +  +E  V  N    +++S D+L++  LD +K+  IP  N P+ 
Sbjct: 23  SSLVQKQSSPLSKISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKA-IPGFNQPIA 81

Query: 125 LTQSHFPEEYQVETETGLVKMKTIESLKSRHS-GGTHNSKKSKGASTRSKNSLTSSMEEH 183
              + FPEEY++ET TGLVK+ T+  L    +   TH+SKK    ST+ KN+        
Sbjct: 82  -EGAEFPEEYEIETRTGLVKVATLHQLNRLDTRVTTHSSKK----STKEKNT-------- 128

Query: 184 GEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224
              G + +KL   +ERN+KE++ Y K   K G K F+ K+F
Sbjct: 129 -SCGYDNDKLQKCIERNQKEIDSYHK---KSGFKKFIGKLF 165

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 68.2 bits (165), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 88/176 (50%), Gaps = 25/176 (14%)

Query: 71  ASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINA-PLTL-TQS 128
           + + TL    SN IE++VT+NA+ N +E+   LR      +K   +P  N  P T+   +
Sbjct: 58  SETNTLKVNSSNEIEKIVTRNALENNTETVATLRET---ESKLSKVPTENVLPATMENNA 114

Query: 129 HFPEEYQVETETGLVKMKTIESLKSRHSGG-----------THNSKKSKGASTRSKNSLT 177
            FPEEY++ET+TGLV +KT+E + S  S G            ++           KN   
Sbjct: 115 AFPEEYRIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDED 174

Query: 178 SSME-------EHGEAG-LNAEKLNSAVERNRKELERYEKNRGK-KGIKGFLSKMF 224
             +E       EH   G L  + ++  VERN+K+LE++E+++ +   +K F+ K  
Sbjct: 175 KDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFL 230

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 51.6 bits (122), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (57%), Gaps = 7/78 (8%)

Query: 97  SESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRHS 156
           +E+  +L+  GL + K   IPD+NAP T     FPEEY +ET TGLVK+ T+ SL     
Sbjct: 45  TETVKSLQEMGLSSEK--PIPDVNAPSTSAGVIFPEEYTLETPTGLVKIATLVSL----- 97

Query: 157 GGTHNSKKSKGASTRSKN 174
           G T ++    G+ T  +N
Sbjct: 98  GRTGSAVPRGGSGTEPEN 115

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 44/150 (29%), Positives = 74/150 (49%), Gaps = 16/150 (10%)

Query: 34  GTEEEQHDSRLFKNDTILNSEDLAENTANTPSDLNSKASSTTLGKRDSNAIERVVTKNAM 93
           G E+ Q    ++++ +  + +DL        S +NS  + TT   R SNA      K   
Sbjct: 19  GLEDTQPQQYIYQSVSRQSRDDLQ-------SSINSYLT-TTPTNRSSNASTNQRLKLV- 69

Query: 94  NNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKS 153
             ++E+  +L   G+ +      P INAP T  ++ FPEEY +ETETGLV + T+ SL  
Sbjct: 70  --KTETVKSLIDMGVSSYIPN--PAINAPKTSKKAIFPEEYTLETETGLVPVSTLHSLGR 125

Query: 154 RHSGGTHNSKKSKGASTRSKNSLTSSMEEH 183
            +   T+ S++    +   +N+  +S  +H
Sbjct: 126 TN---TNLSRQRTRHTLSRRNTRIASSAQH 152

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 7/89 (7%)

Query: 95  NQSESADALRSKGLDTTKRRNIPDINAPLTLTQ-SHFPEEYQVETETGLVKMKTIESLKS 153
            ++E+  +L+  G+  T+   IPD+NAP T T+ + FPEEY +ET TGLV + T++SL  
Sbjct: 49  TRTETVKSLQEMGM--TQDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQSL-G 105

Query: 154 RHSGGTHNSKK---SKGASTRSKNSLTSS 179
           R S     S+     +  S RS+N   SS
Sbjct: 106 RTSTAISKSRTRQIERSVSRRSQNIAASS 134

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 40/61 (65%), Gaps = 3/61 (4%)

Query: 92  AMN-NQSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIES 150
           A+N +++E+  +L+  GL  T    IPD+NAP +   S FPEEY +ET TGLV + T+ S
Sbjct: 39  ALNLSRTETVKSLQDMGL--TSDAPIPDVNAPTSNKHSIFPEEYTMETPTGLVPVATLHS 96

Query: 151 L 151
           L
Sbjct: 97  L 97

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 96  QSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           ++E+  +L+  G++ T    +PD+NAP +   + FPEEY +ET TGLV + T++SL
Sbjct: 51  RTETVKSLQDMGMNATPA--VPDVNAPQSNRNAIFPEEYTIETTTGLVPVATLQSL 104

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 40/65 (61%), Gaps = 4/65 (6%)

Query: 97  SESADALRSKGLDTTKRRNIPDINAPLTLT--QSHFPEEYQVETETGLVKMKTIESLKSR 154
           +E+  +L+  G+  T    +PD+NAP   T  ++ FPEEY +ET TGLV + T++SL   
Sbjct: 51  TETVKSLQEMGV--TPEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRT 108

Query: 155 HSGGT 159
            SG T
Sbjct: 109 TSGVT 113

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 39/57 (68%), Gaps = 3/57 (5%)

Query: 96  QSESADALRSKGLDTTKRRNIPDINAPLTLTQSH-FPEEYQVETETGLVKMKTIESL 151
           ++E+  +L+  G+  TK   IPD+NAP T  ++  FPEEY +ET TGLV + T++S+
Sbjct: 50  RTETVKSLQDMGM--TKNAPIPDVNAPQTAKKTAIFPEEYTMETPTGLVPVATLQSI 104

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 96  QSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRH 155
           ++E+  +L+  G+ +  R  +PD+NAP +     FPEEY +ET TGLV + T+ S+    
Sbjct: 49  RTETVKSLQDMGVSS--RAPVPDVNAPQSSKNKIFPEEYTIETPTGLVPVATLHSIGRTS 106

Query: 156 SGGTHN-SKKSKGASTRSKN 174
           +  +   +++  GAS+ S N
Sbjct: 107 TAISRTRTRQIDGASSPSSN 126

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 96  QSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRH 155
           ++E+  +L+  G+ +  +  IPD+NAP +     FPEEY +ET TGLV + T+ S+    
Sbjct: 49  RTETVKSLQDMGVSS--KAPIPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 156 SGGTHN-SKKSKGASTRSKN 174
           +  +   +++  GAST S N
Sbjct: 107 TAISRTRTRQIDGASTPSSN 126

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 97  SESADALRSKGLDTTKRRNIPDINAPLTLTQ--SHFPEEYQVETETGLVKMKTIESL 151
           +E+A +L+  GL  T    IPD NAP T     + FPEEY +ET TGLV + T+ SL
Sbjct: 48  TETAKSLQDMGL--TSEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSL 102

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 97  SESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           +E+A +L+  G+ +     IPDINAP  +    FPEEY +ET TGLV + T+ S+
Sbjct: 44  TETAKSLQEMGVSS--EAPIPDINAPQNVKSPIFPEEYTMETPTGLVPVATLHSI 96

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 108 LDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           L  T    +PDINAP T   + FPEEY +ET +GLV + T++S+
Sbjct: 54  LGVTSAAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSM 97

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 108 LDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           L  T    +PDINAP T   + FPEEY +ET +GLV + T++S+
Sbjct: 54  LGVTSAAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSM 97

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 108 LDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           L  T    +PDINAP T   + FPEEY +ET +GLV + T++S+
Sbjct: 54  LGVTSNAPVPDINAPQTAKNNIFPEEYTMETPSGLVPVATLQSM 97

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 108 LDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           L  T    +PDINAP T   + FPEEY +ET +GLV + T++S+
Sbjct: 54  LGVTSAAPVPDINAPKTAKNNIFPEEYTMETPSGLVPVATLQSM 97

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 37/58 (63%), Gaps = 3/58 (5%)

Query: 95  NQSESADALRSKGLDTTKRRNIPDINAPLTLTQSH-FPEEYQVETETGLVKMKTIESL 151
            ++E+  +L+  G+  T    +PD+NAP T  +   FPEEY +ET TGLV + T++S+
Sbjct: 43  TRTETVKSLQEMGMTATA--PVPDVNAPQTTARPQIFPEEYTMETPTGLVPVATLQSI 98

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 2/57 (3%)

Query: 95  NQSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESL 151
           +++E+  +L+  G+  T    IP +NAP T     FPEEY +ET TGLV + T++SL
Sbjct: 46  SRTETVKSLQDMGM--TSEAPIPGVNAPQTSRVQIFPEEYTMETPTGLVPVATLQSL 100

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 48/80 (60%), Gaps = 3/80 (3%)

Query: 96  QSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRH 155
           ++E+  +L+  G+ +  +  +PD+NAP +     FPEEY +ET TGLV + T+ S+    
Sbjct: 49  RTETVKSLQDMGVSS--KAPVPDVNAPQSGKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 156 SGGTHN-SKKSKGASTRSKN 174
           +  +   +++ +GAS+ S N
Sbjct: 107 TAISRTRTRQIEGASSPSSN 126

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 31/45 (68%), Gaps = 1/45 (2%)

Query: 108 LDTTKRRNIPDINAPLTLTQ-SHFPEEYQVETETGLVKMKTIESL 151
           L  T+   +PD+NAP T  + + FPEEY +ET TGLV + T++SL
Sbjct: 61  LGVTRDAPVPDVNAPQTSARNTIFPEEYTMETTTGLVPVSTLQSL 105

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 47/80 (58%), Gaps = 3/80 (3%)

Query: 96  QSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTIESLKSRH 155
           ++E+  +L+  G+ +  +  +PD+NAP +     FPEEY +ET TGLV + T+ S+    
Sbjct: 49  RTETVKSLQDMGVSS--KAPVPDVNAPQSSKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 156 SGGTHN-SKKSKGASTRSKN 174
           +  +   +++  GAS+ S N
Sbjct: 107 TAISRTRTRQIDGASSPSSN 126

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 97  SESADALRSKGLDTTKRRNIPDINAPLTL--TQSHFPEEYQVETETGLVKMKTIESLKSR 154
           +E+  +L+  G+  T    +PD+NAP T     + FPEEY +ET TGLV + T++SL   
Sbjct: 57  TETVKSLQDMGV--TPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRT 114

Query: 155 HSGG--THNSKKSKGASTRSKNS 175
            S    T      +GA+ R + S
Sbjct: 115 QSAVSRTRTRVMREGAAARRRGS 137

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 84  IERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLV 143
           +E+ VT  A++   E+A+ L++ G+   +   +PD+ AP       FPEEY +ET +G+V
Sbjct: 28  LEQDVTSRALSRH-ETAETLQTMGM--ARGTPLPDVVAPTYAAAPVFPEEYTMETPSGIV 84

Query: 144 KMKTIESL 151
            +  +ESL
Sbjct: 85  PLAQLESL 92

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 9/49 (18%)

Query: 108 LDTTKRRNIPDINAPLTLTQSH-----FPEEYQVETETGLVKMKTIESL 151
           L  T    +PDINAP    QS      FPEEY +ET TGLV + T++S+
Sbjct: 55  LGVTSHVPVPDINAP----QSSKKNAIFPEEYTMETTTGLVPVATLQSM 99

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 4/63 (6%)

Query: 91  NAMN-NQSESADALRSKGLDTTKRRNIPDINAPL-TLTQSHFPEEYQVETETGLVKMKTI 148
           N +N  ++E+A  L+  G+  T    +PDINAP  +   + FPEEY +ET TGLV + T+
Sbjct: 43  NQLNLTRTETAKTLQDMGM--TSEAPLPDINAPQGSKKPAIFPEEYTMETPTGLVPVVTL 100

Query: 149 ESL 151
           +S+
Sbjct: 101 QSI 103

>Kwal_33.13706 s33 complement(359208..359570) [363 bp, 120 aa] {OFF}
           [contig 114] FULL
          Length = 120

 Score = 28.9 bits (63), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 89  TKNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSHFPEEYQVETETGLVKMKTI 148
           TKN   ++S++   L  KGL T   R IP++    +L++    EEY+     G++K++ +
Sbjct: 61  TKNCTLSRSKNRRFLSLKGLMTGASRAIPEV----SLSKPRQIEEYRTLLRPGVLKIELL 116

Query: 149 ESL 151
            S+
Sbjct: 117 ASI 119

>YLR336C Chr12 complement(799697..802396) [2700 bp, 899 aa] {ON}
           SGD1Essential nuclear protein, required for biogenesis
           of the small ribosomal subunit; has a possible role in
           the osmoregulatory glycerol response; putative homolog
           of human NOM1 which is implicated in acute myeloid
           leukemia
          Length = 899

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 2/73 (2%)

Query: 145 MKTIESLKSRHSG--GTHNSKKSKGASTRSKNSLTSSMEEHGEAGLNAEKLNSAVERNRK 202
           MK +ESLK +  G  G  NS + KG S   K+       E+  +   A    SA ER+  
Sbjct: 136 MKKLESLKRKAKGIQGAENSGEIKGNSYEKKHIRNRDTNENFVSYPLAPSDRSAFERDEM 195

Query: 203 ELERYEKNRGKKG 215
           +++ Y K  G KG
Sbjct: 196 DMQYYAKKLGLKG 208

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.121    0.321 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,803,656
Number of extensions: 899994
Number of successful extensions: 5011
Number of sequences better than 10.0: 332
Number of HSP's gapped: 4947
Number of HSP's successfully gapped: 339
Length of query: 225
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 119
Effective length of database: 41,326,803
Effective search space: 4917889557
Effective search space used: 4917889557
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)