Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008403.487ON31331316750.0
NCAS0E008403.487ON3363187308e-95
KAFR0C019303.487ON3133227027e-91
Skud_7.4383.487ON3133236801e-87
YGR127W3.487ON3123206722e-86
NDAI0G009703.487ON3323356724e-86
CAGL0I10582g3.487ON3193216592e-84
Smik_6.2233.487ON3133236522e-83
Suva_7.4153.487ON3133236513e-83
SAKL0F02882g3.487ON2983126121e-77
TDEL0D055503.487ON3103165896e-74
TPHA0D032603.487ON3143065559e-69
KLLA0E04687g3.487ON3063175504e-68
KLTH0F14718g3.487ON3003135443e-67
Kpol_1017.93.487ON3103235426e-67
Ecym_12423.487ON3113255141e-62
ZYRO0D10098g3.487ON2762605059e-62
Kwal_55.212173.487ON3033105079e-62
TBLA0D029903.487ON3183224705e-56
AFR305W3.487ON3093204522e-53
TBLA0H006108.431ON70866703.1
NCAS0D015405.102ON520140684.9
KAFR0G019408.634ON29299659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00840
         (313 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   649   0.0  
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   285   8e-95
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   275   7e-91
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   266   1e-87
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   263   2e-86
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   263   4e-86
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   258   2e-84
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   255   2e-83
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   255   3e-83
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   240   1e-77
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   231   6e-74
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   218   9e-69
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   216   4e-68
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   214   3e-67
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   213   6e-67
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   202   1e-62
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   199   9e-62
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   199   9e-62
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   185   5e-56
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   178   2e-53
TBLA0H00610 Chr8 complement(127408..129534) [2127 bp, 708 aa] {O...    32   3.1  
NCAS0D01540 Chr4 (287591..289153) [1563 bp, 520 aa] {ON} Anc_5.1...    31   4.9  
KAFR0G01940 Chr7 (410924..411802) [879 bp, 292 aa] {ON} Anc_8.63...    30   9.6  

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/313 (100%), Positives = 313/313 (100%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR 120
           WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR 120

Query: 121 DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI 180
           DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI
Sbjct: 121 DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI 180

Query: 181 SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF 240
           SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF
Sbjct: 181 SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF 240

Query: 241 VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN 300
           VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN
Sbjct: 241 VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN 300

Query: 301 PKEVKQFTFDLSD 313
           PKEVKQFTFDLSD
Sbjct: 301 PKEVKQFTFDLSD 313

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  285 bits (730), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 149/318 (46%), Positives = 207/318 (65%), Gaps = 14/318 (4%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCILL T  HP Y+L+LISNRDEFFER TH++ WH+ D+ILSP+DM K      K + GT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFEKF 119
           W+G+NR  +++T+LNLKLE +      K  VK +SRG+IPF+FLS+     ++WD++EKF
Sbjct: 77  WIGINRDAKIATILNLKLESQL---DLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKF 133

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSND-------TY 172
             +Y  L K+GDFN F GD    +Y+++DS GNTF VL  +    + VSND       T 
Sbjct: 134 DGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVL--SGDPYLTVSNDMFATGGITV 191

Query: 173 KEFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIE-KSHEDISKT 231
           +  + N I+EW K+K GK+ L +LV  + +LD+   I+KCF  AS CS++ K +   ++ 
Sbjct: 192 ERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQPKENTKFNQN 251

Query: 232 PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDL 291
             +   TIFVPPL+C+   D+G + S G Y+GTRSQ+V L+SK+  +V + E IL+TSD 
Sbjct: 252 STLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHILYTSDN 311

Query: 292 DRDFNSPHNPKEVKQFTF 309
           D    S  NPKEVK F F
Sbjct: 312 DIQHYSSTNPKEVKSFEF 329

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  275 bits (702), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 211/322 (65%), Gaps = 19/322 (5%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL  TR H +Y+L+LISNRDE+  R TH T WH+ ++ILSPYDM++   + G  + GT
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSRE-ENHGNKIFGT 59

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHS----KNPVKRRSRGLIPFMFL----SDRGFIDQ 112
           W+G+N+ G+++T+LNL       R+ S    K  VK RSRGLIPF FL    ++    ++
Sbjct: 60  WLGMNKKGKIATILNL-------RRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEE 112

Query: 113 WDSFEKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTY 172
           W++FEKF+ +YP L+ SGDFN F GDI++ +Y+++DS GNTF VL +    NM++SND Y
Sbjct: 113 WETFEKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVL-DNNNRNMIISNDLY 171

Query: 173 KEFNEND-ISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKS-HEDISK 230
           +  +E +    W K+K+G  +L++ +      ++   + KCF  AS+CSI+ S   + + 
Sbjct: 172 QHKDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREENP 231

Query: 231 TPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSD 290
             E+ + TI+VPPLK  P +D+GLTK+ G Y+GTR+Q+V LV KDR+ VT+ E  +H SD
Sbjct: 232 NKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNSD 291

Query: 291 LDRDFNSPHNPKEVKQFTFDLS 312
            +    S  NPKEV++  F ++
Sbjct: 292 EEIYKYSGLNPKEVQRLDFTIT 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  266 bits (680), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 202/323 (62%), Gaps = 22/323 (6%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL+ TR HPDY+L+LISNRDEF  R TH T WH+ D+ILSPYD+ K   +  K + GT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKE--KQIFGT 58

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD-RGFIDQWDSFEKF 119
           W G+NR G+++T+LNLKL+G+      ++ +K +SRGL+PF FLS  +     WD+++KF
Sbjct: 59  WSGINREGKLATILNLKLDGQ------RDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKF 112

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175
              Y  L  +GDFN F GD+ ++ YK++DS G TF+VL+ T   N    M VSN  +  +
Sbjct: 113 EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEF--Y 170

Query: 176 NENDISE--WNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHE-----DI 228
           N   ISE  W KVK+ +  L +LV   ++ D+ + I  CF  AS  S+  +        +
Sbjct: 171 NSPSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQM 230

Query: 229 SKTPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288
              P VI NTI+VPPL+  P  D+G +   G Y+GTRSQ+V LVSK+  +VT  ERIL++
Sbjct: 231 LADPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYS 290

Query: 289 SDLDRDFNSPHNPKEVKQFTFDL 311
           SD D +  S   PKE K+F F L
Sbjct: 291 SDEDVNHYSVATPKEEKRFEFKL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  263 bits (672), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 199/320 (62%), Gaps = 17/320 (5%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL+ TR HPDY+L+LISNRDEF  R TH T WH+ D+ILSPYD+ K      K + GT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKT--SAEKQIFGT 58

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLS-DRGFIDQWDSFEKF 119
           W G+N+ G+++T+LNLKL+ E      +N  K RSRGL+PF+FLS  +   + WD+++KF
Sbjct: 59  WSGINKEGKLATILNLKLDNE------QNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKF 112

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175
              Y  L+ +GDFN F GD+ ++ YKV+DS G TF VL+ T   +    MVVSN  + + 
Sbjct: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172

Query: 176 NENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEK--SHEDISKT-- 231
           +      W KVK+ +  L  LV   +  D+   I  CF  AS  S+    S+ D+ +   
Sbjct: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232

Query: 232 PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDL 291
           P V  NTI+VPPL+  P+ D+G +   G Y+GTRSQ+V LVSKD  +VT  ER+L++SD 
Sbjct: 233 PNVTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292

Query: 292 DRDFNSPHNPKEVKQFTFDL 311
           D    S  +PKE K+F F L
Sbjct: 293 DVRKYSVTSPKEEKRFKFKL 312

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  263 bits (672), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 142/335 (42%), Positives = 199/335 (59%), Gaps = 27/335 (8%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCILL T  HPDY+L+LISNRDEF +R TH + WH+ D+ILSPYDM K      K V GT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD--RGFIDQWDSFEK 118
           W+G+N+ G+++TVLNLKL      K    P   +SRG++PF++LSD       +WD ++ 
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAP---KSRGMLPFVYLSDMTEDSFAEWDGYDN 117

Query: 119 FRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYK----- 173
           F  +YP L+ +GDFNLF GD++++ Y+++DS GNT S LN +    +VVSND +      
Sbjct: 118 FTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLN-SNCQYLVVSNDVFTCNGQL 176

Query: 174 -EFNEN------------DISEWNKVKLGKLKLHELVNTAV--NLDKSSFIDKCFHAASF 218
            E   N             I  W KVKLG   L  LVN ++    D+ + I +CF  +S 
Sbjct: 177 GELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSST 236

Query: 219 CSIE-KSHEDISKTPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRR 277
           CS+  + H    +   + + TI VPPL+C+   DVG +   G Y+GTRSQ+V L+ +   
Sbjct: 237 CSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIKRGTY 296

Query: 278 QVTVAERILHTSDLDRDFNSPHNPKEVKQFTFDLS 312
           +V  AE +++TSD D    SP NPKE  +F F L+
Sbjct: 297 EVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  258 bits (659), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 198/321 (61%), Gaps = 13/321 (4%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL  TREHPDY+L++ISNRDEF ER TH T WH+ D+ILSPYD+ +          GT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDR-GFIDQWDSFEKF 119
           W G+NR GRV+TVLNL++  E      K  +  RSRG +PF+FL+DR G  + WD++ KF
Sbjct: 61  WTGVNRKGRVATVLNLRICDEL---DMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKF 117

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFN--E 177
              YPD++++GDFNLF GD ++  Y ++DS GNT  + ++     +V+SN+ + + +   
Sbjct: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNNIHDKLHLQS 177

Query: 178 NDIS----EWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSI-EKSHE--DISK 230
            DI+    EW K+K GK  + E V T  NL K   I+ CF  AS   I +K  E  D+ K
Sbjct: 178 QDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDLVK 237

Query: 231 TPEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSD 290
           +  V   TI+V PL   P +++G   + G Y+GTRSQ+V LV K + + T  ERI+++SD
Sbjct: 238 SLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERIIYSSD 297

Query: 291 LDRDFNSPHNPKEVKQFTFDL 311
            D    S  NPKE  ++ +D+
Sbjct: 298 QDISLYSTSNPKEELRYEYDI 318

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  255 bits (652), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 202/323 (62%), Gaps = 22/323 (6%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL+ TR HPDY+L+LISNRDEF  R TH T WH+ D+ILSPYD+ +   +  +   GT
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEF--GT 58

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD-RGFIDQWDSFEKF 119
           W G+N+ G+++T+LNLKL  E      ++ +K +SRGL+P++FLS+       WDS+ KF
Sbjct: 59  WSGINKEGKLATILNLKLGSE------RSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKF 112

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175
            + Y  L+ +GDFN F GD+ ++ YKV+DS G TF VL+ T   +    MV+SN  +  +
Sbjct: 113 GNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRF--Y 170

Query: 176 NENDISE--WNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEK--SHEDISKT 231
           N + I E  W KVKL +  L +LV+  + LD+ + I  CF  AS  S+    S  D+ + 
Sbjct: 171 NTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQM 230

Query: 232 ---PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288
              P V  +TI+VPPL+  P  D+G +   G ++GTRSQ+V L+SKD  + T  ERI+++
Sbjct: 231 LVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYS 290

Query: 289 SDLDRDFNSPHNPKEVKQFTFDL 311
           SD D    S   PKE K+F F+L
Sbjct: 291 SDEDVRQYSVSAPKEEKRFEFEL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  255 bits (651), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 142/323 (43%), Positives = 197/323 (60%), Gaps = 22/323 (6%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL+ TR HP Y+L+LISNRDEF ER TH T WH+ D+ILSPYD+ K   +  K + GT
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME--KQIFGT 58

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFL-SDRGFIDQWDSFEKF 119
           W G+N+ G+++T+LNLK++ +      ++  K +SRG++PF FL S +     WD + KF
Sbjct: 59  WSGINKEGKLATILNLKMDDQ------RSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKF 112

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175
              Y  L  +GDFN F GD+ ++ YKV+DS G+TF VL  T   +    MV+SN  Y   
Sbjct: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYH-- 170

Query: 176 NENDISE--WNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKS--HEDISKT 231
           N + ISE  W KVK+ +  L  L+   +  D+ + I  CF  AS  S+  +    D+ + 
Sbjct: 171 NSSSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQM 230

Query: 232 ---PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288
              P V  NTI+VPPL+  P  D+G +   G Y+GTRSQ+V LVSKD  +VT  ER+L++
Sbjct: 231 LVDPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYS 290

Query: 289 SDLDRDFNSPHNPKEVKQFTFDL 311
           SD D    S   PKE K+F F+L
Sbjct: 291 SDEDVSHYSASAPKEEKRFEFEL 313

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  240 bits (612), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 192/312 (61%), Gaps = 15/312 (4%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCILLGT  HP Y L+LISNRDEFFER+TH T  HS D+I+SP+DM+  +   G+   GT
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMS--ITTKGRNF-GT 57

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFEKF 119
           W G+N+ G+V+ +LNL++      K+ + P   +SRG++P  FL+ +    + WDS+EKF
Sbjct: 58  WCGVNKDGKVAVILNLRIASCGNPKNVECP---QSRGIVPMKFLAGKDVDFNNWDSYEKF 114

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNEND 179
              YP +EK+G+FNLF GD  + +YK++ S   T        G  MVVSND       + 
Sbjct: 115 SHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGY-MVVSNDLI-----SS 168

Query: 180 ISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTI 239
             +W K+ L K  L  LV ++V+  K S +DKCF  AS  +   S + + K   V + TI
Sbjct: 169 KKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTC--SEKIVVKHESVTNETI 226

Query: 240 FVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPH 299
           +VPPL  +  QD+ ++   G Y+GTRSQ+V LVSKD++++T  ER+L+T D D     P 
Sbjct: 227 YVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKYGPK 286

Query: 300 NPKEVKQFTFDL 311
           NPKE  +F FD+
Sbjct: 287 NPKEQIEFEFDI 298

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  231 bits (589), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 138/316 (43%), Positives = 183/316 (57%), Gaps = 13/316 (4%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL+ T +HP YDLVL+SNRDE+F R      W   +++L P D  KGL   G+ + GT
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLD--KGLDSSGEDL-GT 57

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFEKF 119
           W+G NR G++ TVLNLKL  +   + +  P    SRG IP  FLS RG     WD+++KF
Sbjct: 58  WIGANRDGKIGTVLNLKLFSDPRGRPAVCP---ESRGKIPVSFLSSRGANFKDWDTYDKF 114

Query: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYK-EFNEN 178
             ++  LE + DFN F GD    DY+V+DS GNT  VL +T    +VVSND ++ E N+N
Sbjct: 115 CHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIFQGESNKN 174

Query: 179 DISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHED---ISKTPEVI 235
            +  W+K+ L    LH LV    + D+  FI +CF  AS       H+      K  E+ 
Sbjct: 175 RV--WDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYYMKAVELS 232

Query: 236 SNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDF 295
             T+FVPPLK      +G +   G Y+GTRSQ V LVSKDR  +T  ERI+H SDLD   
Sbjct: 233 MQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQ 292

Query: 296 NSPHNPKEVKQFTFDL 311
            S  + KE K++ FDL
Sbjct: 293 YSRDHYKEQKRYDFDL 308

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  218 bits (555), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 124/306 (40%), Positives = 190/306 (62%), Gaps = 26/306 (8%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWH--SGDYILSPYDMTKGLYDPGKCVR 58
           MCIL  TR HPDY+L+LISNRDEF +R T  + W+  S   +L PYD+++   DP K   
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKF-- 58

Query: 59  GTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDR--GFIDQWDSF 116
           GTW G+N  GRVS+VLNLK++   +   +   V+++SRG +P  FL +R     + W+S+
Sbjct: 59  GTWCGINEFGRVSSVLNLKMDENKVEDKN---VRKKSRGYLPVKFLDNRKENSFNDWNSY 115

Query: 117 EKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVL---NETTGMNMVVSNDTYK 173
            KF  +YPDLEK+G FNLFIGD+++Q+Y ++DS G T  +L   +E    ++V+SN    
Sbjct: 116 SKFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVISN---S 172

Query: 174 EFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEK----SHEDIS 229
           EF  ND   W+K+  G+  + E ++  +  D++S I+ CF  AS   +      SH+DI 
Sbjct: 173 EFISNDKERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDI- 230

Query: 230 KTPEVISNTIFVPPLKCQ---PQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERIL 286
              ++++ T+FVPP+K +    + ++G +   G ++GTRSQ+V LV+K+R  V   ER+L
Sbjct: 231 --LDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVL 288

Query: 287 HTSDLD 292
           +  D D
Sbjct: 289 YECDDD 294

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  216 bits (550), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 178/317 (56%), Gaps = 19/317 (5%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL  TR HPDY L+L+SNRDEFFER TH T W+   +ILSPYDM       G    GT
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMAIEKKGQG---YGT 57

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLS--DRGFIDQWDSFEK 118
           W+G+NR GR++ +LNLK++     +      + RSRG++P  FL   D    D WDS+EK
Sbjct: 58  WLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEK 117

Query: 119 FRDRYPDLEKSGDFNLFIGDIRQQDYKVLD---SSGNTFSVLNETTGMNMVVSNDTYKEF 175
           F  ++ +L ++G F LF GD +  +Y V+D    S N F  +      +MV+SND +   
Sbjct: 118 FNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKME-----HMVISNDIFHCA 172

Query: 176 NENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVI 235
                S WNK + G + L  L      + K   + KCF   S  +  +  ED+     V 
Sbjct: 173 VGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEG-EDVDS---VT 228

Query: 236 SNTIFVPPLKCQPQQD-VGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRD 294
           +++I+VPPL+     D +G +   G Y+GTRSQ+V LV KD R VT  E +++ SD D +
Sbjct: 229 TSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDNR-VTYEEHVIYESDEDCE 287

Query: 295 FNSPHNPKEVKQFTFDL 311
             S  +PKEV QF F++
Sbjct: 288 TYSFMDPKEVIQFQFNM 304

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  214 bits (544), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 123/313 (39%), Positives = 176/313 (56%), Gaps = 14/313 (4%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCIL+ +  HP Y L+ ISNRDEFFER T  T  +  DYILSP D    L    K   GT
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDT--ALRSNNKPALGT 58

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR 120
           W G+NR GRV+ +LNL+ +  A R   K+P+   SRG +P  +L DRG    W+SFEKF 
Sbjct: 59  WCGVNRKGRVAVILNLRNKEPAKRIPVKSPI---SRGSVPMKYLMDRGPSTDWNSFEKFV 115

Query: 121 DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI 180
            +YP + +  +FN+F GD    +Y  +DS G +   L      N+V+SND       +  
Sbjct: 116 SKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALT-ANKPNLVLSNDHI-----DSS 168

Query: 181 SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF 240
           S W KV+   + L ELV ++ +  +   I+KCF  AS  + E +  D S   E   ++IF
Sbjct: 169 SRWPKVQKADILLQELVQSSQHDSEEELIEKCFALAS--NTEPAEIDNSDKEEFTCSSIF 226

Query: 241 VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN 300
           +PP++   + DVG +   G ++GTRSQ+V LV +  R ++  ER+LH SD +   +S  +
Sbjct: 227 IPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLHSEKH 286

Query: 301 PKEVKQFTFDLSD 313
           PKE  QF   + +
Sbjct: 287 PKEKLQFNLHVDE 299

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  213 bits (542), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 133/323 (41%), Positives = 187/323 (57%), Gaps = 25/323 (7%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDY--ILSPYDMTKGLYDPGKCVR 58
           MCILL +R+HP+YDL+LISNRDEF +R TH T W+ G+Y  IL PYDM+K        + 
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSKSNEKNVNKI- 59

Query: 59  GTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDR--GFIDQWDSF 116
           GTW G+N  GRVST+LNLK +       S  P  ++SRG +P  FL ++    +  WDS+
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSF---QSSVPSTKKSRGALPIKFLDNKETDSLLNWDSY 116

Query: 117 EKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFN 176
           EKF   YP ++++GDFN F GD+R   Y V+DS G+T  VL       +V+SND + + N
Sbjct: 117 EKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLT-VDNPYLVISNDKFGKSN 175

Query: 177 ENDISEWNKVKLGK--LKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISK---T 231
                EW K+ L K  LK   L  T  +L     I KCF  AS  ++   +ED+ K    
Sbjct: 176 GKSTKEWEKITLAKNLLKHLPLCETEDDL-----IHKCFDIASTNTL---NEDLIKDVDV 227

Query: 232 PEVISNTIFVPPLKCQPQQD---VGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHT 288
            E+++ TI VPPL    +++   +G +   G Y+GTRSQ+V LV+K+R +V   ERIL+ 
Sbjct: 228 RELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILYN 287

Query: 289 SDLDRDFNSPHNPKEVKQFTFDL 311
           SD D       +P +   + F +
Sbjct: 288 SDDDVTTQKLSSPIQDLTYNFTI 310

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  202 bits (514), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 179/325 (55%), Gaps = 29/325 (8%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDM--TKGLYDPGKC-- 56
           MCILL T +HPDY L+LISNRDEF+ER TH+T WH    IL+PYD+  ++   D  K   
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 57  VRGTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSD--RGFIDQWD 114
             GTW+G+NR G VS +LNLK   EA+   + N   R+SRG +   FL D   G  D+W+
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGN---RKSRGNVTVAFLRDLSNGNWDKWN 117

Query: 115 SFEKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDS---SGNTFSVLNETTGMNMVVSNDT 171
           ++EKF + +  L+ +  F LF GDI+  D+ ++DS   S N FS    +    +V+SN  
Sbjct: 118 NYEKFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFS----SKQPYVVISNSR 173

Query: 172 YKEFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKT 231
                E++   W KV  G+  L ELV   +N+ K   + KCF  A       S  D++  
Sbjct: 174 VN--CEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAG-----TSQFDVNGV 226

Query: 232 PEVI-----SNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERIL 286
            +V        TIFVP LK      +G++K  G Y+GTR+ +V LV  +   VT+ E ++
Sbjct: 227 IQVTDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVI 285

Query: 287 HTSDLDRDFNSPHNPKEVKQFTFDL 311
           H SD D   +S  NPK    + FD+
Sbjct: 286 HDSDKDIGLSSAMNPKTKVAYEFDI 310

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  199 bits (505), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 154/260 (59%), Gaps = 13/260 (5%)

Query: 59  GTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFE 117
           GTW G+N+ GRV TVLNLKL+  A R H   P+   SRG +P  FLS      +QW+S+ 
Sbjct: 24  GTWCGINKDGRVGTVLNLKLDQGAQRGH---PLHLSSRGKVPTAFLSQHDLDWEQWNSYN 80

Query: 118 KFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYK 173
           KF +++ +L+ +GDFN F GD +   YK++DS   T  VL      +    MVVSND Y+
Sbjct: 81  KFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYR 140

Query: 174 EFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFC-SIEKSHEDISKTP 232
              E     W KV+L K  L +L+   VN D+ SFI KCF  AS    ++   E++ K+ 
Sbjct: 141 YQGE---ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSS 197

Query: 233 EVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLD 292
           +V   +IFVPPLK  P  ++G T   G Y GTRSQ+V LVSKDR++VT  ER+LH SD  
Sbjct: 198 DVTKQSIFVPPLKFPPDLNLGTTTHAGFY-GTRSQIVLLVSKDRQKVTFVERVLHNSDEQ 256

Query: 293 RDFNSPHNPKEVKQFTFDLS 312
               SP +P E  +F FDL+
Sbjct: 257 VSQRSPDHPAEQLKFQFDLN 276

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  199 bits (507), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 177/310 (57%), Gaps = 15/310 (4%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60
           MCILL +  HP Y L+LISNRDEF ER T  T  +  DY++SP DMT  L D  +   GT
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMT--LKDNNEPNLGT 58

Query: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGFIDQWDSFEKFR 120
           W G NR GR++ +LNL+  G   +  +K  V   SRG +   +L+D+     W+S+ KF 
Sbjct: 59  WCGANRNGRIAVILNLR-TGNTNQTKTKRIV---SRGNVTMRYLTDKQPASDWNSYAKFA 114

Query: 121 DRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDTYKEFNENDI 180
            + PD+ KS +FN+F GD +  DY  +DSSG++F VL  +    +V+SND+ +       
Sbjct: 115 SKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVL-RSQNPYLVISNDSIES-----A 167

Query: 181 SEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKTPEVISNTIF 240
           ++W K++L +  + +LV  +VN  +   + +CF  AS    +  + D     +V S+ IF
Sbjct: 168 TKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASH--KQDYNVDHMDKEKVTSSNIF 225

Query: 241 VPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLDRDFNSPHN 300
           VPPL+    +D+G +   G ++GTRSQ+V LVSK+ + +   E +L+ SD +       N
Sbjct: 226 VPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFCAAN 285

Query: 301 PKEVKQFTFD 310
           PK+   +  +
Sbjct: 286 PKKCVSYKIN 295

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  185 bits (470), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 128/322 (39%), Positives = 178/322 (55%), Gaps = 33/322 (10%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPG------ 54
           MCILLGT  HP Y L+LISNRDE FER+TH T W+    IL PYDM+K +   G      
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 55  KCVRGTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLS--DRGFIDQ 112
           K   GTW GLN+ G++ TVLNL  E EA R    N    +SRGLIP  +L   D GF D 
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNN-SLQSRGLIPIKYLCDFDHGFQD- 118

Query: 113 WDSFEKFRDRYPDLE-KSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDT 171
           W++++KF ++   ++ K G FNLF+GD++  +Y +++S G +  VL+E     MVVSN  
Sbjct: 119 WNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPY-MVVSNIN 177

Query: 172 YKEFNENDISEWNKVKLGKLKLHELVNTAV---NLDKSSFIDKCFHAASFCSIEKSHEDI 228
           + +     + EW+K+K G   L  L+N  +   N D+   ++ CF  +S  +I  S + I
Sbjct: 178 WGD--PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISS--TINLSGKKI 233

Query: 229 SKTPEVISNT---IFVPPLKCQPQQDVGLTKSGGL----------YFGTRSQLVTLVSKD 275
               E +  T   IFVPPLK + + +V     G            Y+GTRSQ+V L  + 
Sbjct: 234 DGNIERLEQTKDLIFVPPLK-RSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERK 292

Query: 276 RRQVTVAERILHTSDLDRDFNS 297
             +VT  ERILH  + D   N+
Sbjct: 293 SNKVTFVERILHCKNEDAKDNT 314

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  178 bits (452), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 161/320 (50%), Gaps = 23/320 (7%)

Query: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDM----TKGLYDPGKC 56
           MCIL  T  HP Y LVLISNRDE+F R TH T W   D IL+PYDM      GL     C
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  VRGTWMGLNRAGRVSTVLNLK---LEGEALRKHSKNPVKRRSRGLIPFMFLS--DRGFID 111
             GTW+G+NRAG VS +LNL     +G+    H      R SRG +   +L   D    D
Sbjct: 61  --GTWIGINRAGHVSVLLNLAPKDADGDHGYSH------RHSRGAVTMEYLKDFDHNNWD 112

Query: 112 QWDSFEKFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDT 171
            W+++EKF   +P L K+  F  F GD+    + V++S G T    +++     VVSN  
Sbjct: 113 SWNTYEKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQSP--YYVVSNGP 170

Query: 172 YKEFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHEDISKT 231
                   + +W KV  G     +++  ++++ +   + +CF+ AS+     +       
Sbjct: 171 SD--GAKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHD 228

Query: 232 PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDL 291
             +   TIFVP L     Q   L+ + G+Y+GTRS +V LVS+D   VT  E ++H SD 
Sbjct: 229 DSIPKRTIFVPALYNLSGQ-ANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQ 286

Query: 292 DRDFNSPHNPKEVKQFTFDL 311
           D D  S  NPKE     F L
Sbjct: 287 DLDSYSILNPKEQVTHRFSL 306

>TBLA0H00610 Chr8 complement(127408..129534) [2127 bp, 708 aa] {ON}
           Anc_8.431 YDR221W
          Length = 708

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 104 LSDRGFIDQWDSFEKFRDRYP------DLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVL 157
             D G I+  DS++K+ D YP      ++E S DF   + + +Q  YKV+    N   ++
Sbjct: 383 FQDSGVIEAVDSYKKYLDLYPMEQFNKEIELSNDFKDQLENCKQFLYKVIPQILNE-GII 441

Query: 158 NETTGM 163
           NE   M
Sbjct: 442 NENENM 447

>NCAS0D01540 Chr4 (287591..289153) [1563 bp, 520 aa] {ON} Anc_5.102
           YHR151C
          Length = 520

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 56/140 (40%), Gaps = 31/140 (22%)

Query: 95  SRGLIPFMFLSDRGFIDQWDSF-EKFRDRYPDLEKSGDF------NLFIGDIRQQDYKVL 147
           SR   P +  +DR   D WD+F E   D +P L   G F       + I D+  +    +
Sbjct: 181 SRIYSPSILAADRAMGDAWDAFGESKTDGWPTL---GTFLYTRKKRVLITDLSSKSNSTI 237

Query: 148 D------------SSGNTFS----VLNETTGMNMVVSNDTYKEFNENDISEWNKVKLGKL 191
           D            SSGN  S     L+  + M+ V        FNE+DISE+    +  +
Sbjct: 238 DSPYIFPNTITHYSSGNMTSDCPNTLSALSYMSTVSFQFLEAVFNEDDISEYVSCGVSPI 297

Query: 192 -----KLHELVNTAVNLDKS 206
                 ++ L N    LDK+
Sbjct: 298 ISNTYNVNSLSNIKTLLDKT 317

>KAFR0G01940 Chr7 (410924..411802) [879 bp, 292 aa] {ON} Anc_8.634
           YPL130W
          Length = 292

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 179 DISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEKSHED--ISKTP---E 233
           DI+  NK++   L  H+++N    +D +S   +C       S+ K+     +  +P   E
Sbjct: 185 DINTDNKIESLSLNSHKIINVTRAIDTTSVTFECSTTTVSFSVSKTETPTRVFTSPMAVE 244

Query: 234 VISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLV 272
              N  F P +        G  +SG  Y    + L++ +
Sbjct: 245 ATRNATFTPAVSNATAATSGQLQSGATYLMPATMLLSSI 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,290,891
Number of extensions: 1640317
Number of successful extensions: 5045
Number of sequences better than 10.0: 39
Number of HSP's gapped: 5070
Number of HSP's successfully gapped: 39
Length of query: 313
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 204
Effective length of database: 40,982,805
Effective search space: 8360492220
Effective search space used: 8360492220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)