Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008303.489ON60760732060.0
KAFR0C019403.489ON60962212591e-166
Kpol_480.163.489ON6556708971e-111
SAKL0F02838g3.489ON6546738821e-109
ZYRO0D10054g3.489ON6646818651e-107
NCAS0E008303.489ON6716778571e-105
TPHA0D042303.489ON6526698241e-101
TDEL0D055703.489ON6496698211e-100
AFR307C3.489ON6506378123e-99
KLTH0F14762g3.489ON6506738012e-97
TBLA0C044603.489ON6987237912e-95
KLLA0E04665g3.489ON6476377828e-95
CAGL0I10560g3.489ON6786957665e-92
Suva_7.4163.489ON7136477311e-86
Kwal_55.212223.489ON3733856972e-85
NDAI0G009603.489ON7004607126e-84
Smik_6.2243.489ON7056496872e-80
Skud_7.4393.489ON7136176856e-80
YGR128C (UTP8)3.489ON7135666794e-79
Kwal_55.21225singletonOFF215991301e-07
ZYRO0B07480g4.219ON1426106771.0
TBLA0C010202.666ON62345751.7
Skud_10.3201.114ON65566714.7
ZYRO0C02266g3.61ON162180708.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00830
         (607 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...  1239   0.0  
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   489   e-166
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   350   e-111
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   344   e-109
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   337   e-107
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   334   e-105
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   322   e-101
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   320   e-100
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   317   3e-99
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   313   2e-97
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   309   2e-95
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   305   8e-95
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   299   5e-92
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   286   1e-86
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   273   2e-85
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   278   6e-84
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   269   2e-80
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   268   6e-80
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   266   4e-79
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...    55   1e-07
ZYRO0B07480g Chr2 complement(584441..588721) [4281 bp, 1426 aa] ...    34   1.0  
TBLA0C01020 Chr3 complement(201774..203645) [1872 bp, 623 aa] {O...    33   1.7  
Skud_10.320 Chr10 complement(570536..572503) [1968 bp, 655 aa] {...    32   4.7  
ZYRO0C02266g Chr3 (176474..181339) [4866 bp, 1621 aa] {ON} simil...    32   8.5  

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score = 1239 bits (3206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/607 (100%), Positives = 607/607 (100%)

Query: 1   MSASISQPFTIANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNS 60
           MSASISQPFTIANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNS
Sbjct: 1   MSASISQPFTIANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNS 60

Query: 61  KAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAI 120
           KAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAI
Sbjct: 61  KAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAI 120

Query: 121 LQDGTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELRVSTT 180
           LQDGTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELRVSTT
Sbjct: 121 LQDGTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELRVSTT 180

Query: 181 LHFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGD 240
           LHFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGD
Sbjct: 181 LHFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGD 240

Query: 241 SRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGARDGSFAIALSHGPQDNAVSLD 300
           SRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGARDGSFAIALSHGPQDNAVSLD
Sbjct: 241 SRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGARDGSFAIALSHGPQDNAVSLD 300

Query: 301 IINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYASILKKLTA 360
           IINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYASILKKLTA
Sbjct: 301 IINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYASILKKLTA 360

Query: 361 AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFT 420
           AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFT
Sbjct: 361 AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFT 420

Query: 421 YLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSL 480
           YLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSL
Sbjct: 421 YLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSL 480

Query: 481 KILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGL 540
           KILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGL
Sbjct: 481 KILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGL 540

Query: 541 FALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPY 600
           FALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPY
Sbjct: 541 FALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPY 600

Query: 601 LVDHLEI 607
           LVDHLEI
Sbjct: 601 LVDHLEI 607

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  489 bits (1259), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 262/622 (42%), Positives = 406/622 (65%), Gaps = 33/622 (5%)

Query: 4   SISQPFTIANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNSKAI 63
           SISQPF I  VP+Q+S + +++S HSLT+N+N+LDVA+SKY++S+++INPTPKL+NS  I
Sbjct: 3   SISQPFAITTVPKQSSTSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPTPKLINSIPI 62

Query: 64  PSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQD 123
           PSN  VTAF + V+AT + N+ + L+L+   ++P++S ++   S    DES  T  IL++
Sbjct: 63  PSNEVVTAFHDTVFATATVNQKYTLHLN-GKKVPIQSKIMKLFS----DESQ-TITILEN 116

Query: 124 GTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELRVSTTLHF 183
           GT++KY           P KD+  VEFI+ +YAL+++  S +LY++  + ELR    +  
Sbjct: 117 GTIEKYDSNLIKSTYKTPHKDLVNVEFIESKYALLISQNSISLYDINTMIELRNVANVQD 176

Query: 184 EQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRV 243
                 +   GK+YQF+   + F I+E++++  + ++ IPF++  +   ++FTVV D+ V
Sbjct: 177 IVDSDFKSLDGKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCV 236

Query: 244 CLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGARDGSFAIALSHGPQDNAVSLDIIN 303
            +A+ + IY L+LHL SV+S ++   LK  +LI    +  F + LS   ++     ++IN
Sbjct: 237 VMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNLSN-QFVLGLSFNNEN--YKFELIN 293

Query: 304 LELGSR-SIKDSLGKGFATFMKERRSAESQVTLRPIL-----------DAGDKTKRSFDY 351
           L+L S   +KDSLGKGF  F+ +++S +  + L+ +            D+    + +F+Y
Sbjct: 294 LDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHTFNY 353

Query: 352 ASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEP 411
             I+  L  A K+P+KFD+IFF++  I +E YTE DRF+++Q+FL++ + +IL+NY F+ 
Sbjct: 354 DKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDT 413

Query: 412 S-SKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIE 470
             + YP   TYLLTHPLFP   T++LL K ++ PRLYKQ IVTCPNLPL ELL + F IE
Sbjct: 414 DGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIE 473

Query: 471 NNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQL 530
           NNELSLD+SL++LQDYTKDSIK+++K LP+V++ NFI+FV       DE    + QLFQL
Sbjct: 474 NNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFV-----TQDEDQQVSSQLFQL 528

Query: 531 LSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYV 590
           LSL+IDSIGLFALD ++L  ++ +I+    +A+ N+EL +LL++  +K S A  + SK +
Sbjct: 529 LSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQS-SKLI 587

Query: 591 KT-----QKKVFPPYLVDHLEI 607
                   +K  P Y V+HL++
Sbjct: 588 NNNNKSLHRKTLPTYTVEHLDL 609

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  350 bits (897), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 245/670 (36%), Positives = 372/670 (55%), Gaps = 83/670 (12%)

Query: 4   SISQPFTIANVPRQASQTKVLISQHSL------TSNANTLDVAVSKYSISQYIINPTPKL 57
           S SQPF +A +P+  S + V     SL      +  +N + + +S  +ISQYIINPTP L
Sbjct: 3   SFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTPSL 62

Query: 58  VNSKAIPSNLTVTAFDNGVYATQSNNK-----SFCLYLDESH--QIPLKSA--------- 101
           V +  IPS   VTA + G + + ++       ++ L  +++H   I +K++         
Sbjct: 63  VFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYATSG 122

Query: 102 --VVNCLSEK---------IHDESVVTTAILQDGTVQKYKGGEQVFAK-HLPLKDIKQVE 149
             VV   S+K         I+++  V   +L++G +Q Y    ++    ++   DI  VE
Sbjct: 123 GEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVE 182

Query: 150 FI--DG-QYALIVA-----AQSTALYEL-----ENLTELRVSTTLHFEQF--KQIRQHLG 194
               DG Q+A+I++       S  LYEL      ++ EL  ST L        QI    G
Sbjct: 183 HFEEDGKQFAIILSNIEGKKISFKLYELFTNDKTSINELS-STILEDADLGESQICYQFG 241

Query: 195 KIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEIYLL 254
           KIY+  L  +   I+ L        + +PF+       L+F+ + ++R+ L + N+IYLL
Sbjct: 242 KIYR--LFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYLL 299

Query: 255 DLHLGSVLSHNKFAQLKQVELIA-----------GARDGSFAIALSHGPQDNAVSLDIIN 303
           DL   S+L+    + +K  +L+             ++  +  +++ +GP   + SL++IN
Sbjct: 300 DLVHNSILAERDLSHVKVYQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPIS-SLEVIN 358

Query: 304 LELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKT------KRSFDYASILKK 357
           +++GS ++KDSLGK F        + +  + L+ +    D+T      ++SFDY +IL++
Sbjct: 359 VDVGSGTLKDSLGKSFQV-----ANVKKNIPLQSLF-PEDETIYAKGEQKSFDYKNILQE 412

Query: 358 LTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPA 417
           L     D  KFD IFFK+L I++E YTE DRFI DQ FLS+ + +I   +       YP 
Sbjct: 413 LQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFK----KDYPR 468

Query: 418 AFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLD 477
           A T+LLTHPLFP   TR+LL+K +  PRL+KQ +VTCPNLPL ELL E F I N EL LD
Sbjct: 469 ALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLD 528

Query: 478 LSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDS 537
           +SL+ILQDYT+DSIK+E+K L +V++ NFI+FVI    +S++ S   PQLFQLLSLV+D+
Sbjct: 529 ISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVID--TDSEDKSQFNPQLFQLLSLVLDA 586

Query: 538 IGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVF 597
            GLFAL+ E L +L+ YIDN V +AE N  LW+LL+  ++K S       + V  Q K  
Sbjct: 587 SGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNV-LQTKSL 645

Query: 598 PPYLVDHLEI 607
             Y V++LE+
Sbjct: 646 SAYSVEYLEL 655

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  344 bits (882), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 254/673 (37%), Positives = 352/673 (52%), Gaps = 90/673 (13%)

Query: 3   ASISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
           ASISQPF +  +P+ AS      QT  L   ++LT +AN +++ VS  SISQYIINPTPK
Sbjct: 2   ASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTPK 61

Query: 57  LVNSKAIPSNLTVTAFD-------NGVYATQS-------NNKSFCL-------------- 88
           LV++ +IPS   VTA D        G   TQ         NKSF L              
Sbjct: 62  LVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAPSV 121

Query: 89  ---YLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQ------------------ 127
                 E++++ +K  V    S KI        A+LQ+G VQ                  
Sbjct: 122 NSTQTFENYKVSIKHKVA---SVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGN 178

Query: 128 ----KYKGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELEN--LTELRVSTTL 181
               KY   E +    + L D+   +     + +I    +  L EL +  L    +  + 
Sbjct: 179 ISLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDSNVPLKELNSVILEGFSLQNSK 238

Query: 182 HFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDS 241
            F QF       GKIY   L+     I+ L        +N+PF++      ++F  +  +
Sbjct: 239 TFYQF-------GKIYT--LSNGKISIYSLPHFQLSNTINLPFVTHEN--VVSFKPISTN 287

Query: 242 RVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSFAIALSHGPQ 293
           R  L + N IYLLDL   ++LS  +   +K  +L+  A         + + AI +S    
Sbjct: 288 RALLTVDNRIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAENNKTIAIGVSTKSD 347

Query: 294 DNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYA 352
           +NA S LDI+N+ +GS ++KDS+ KGF T         S    +      D T + FDY 
Sbjct: 348 NNATSALDIVNINVGSGTLKDSMSKGFLTQDATEEVLNSLFDEQDDELDEDGTSQ-FDYN 406

Query: 353 SILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPS 412
            IL +L  A     KFD +FFK L I +E YTE DRF   Q FL + + +I +N++ E  
Sbjct: 407 QILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKE-- 464

Query: 413 SKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENN 472
             YP A TYLLTHPLFPA     LLSK K+ PRL++Q IVTCPNLPLD LL E F + N+
Sbjct: 465 --YPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVIND 522

Query: 473 ELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLS 532
           EL LDLSL+ILQD+TKDSIK+ +K + +V++ NFI FVI N ++ +E + + PQLFQLL+
Sbjct: 523 ELCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVI-NEDDDEERNKSKPQLFQLLN 581

Query: 533 LVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKT 592
           LV+DSIGLFALDGE L  L  +I+N V I E N EL NLL+  + K++   S+ S    T
Sbjct: 582 LVLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSST 641

Query: 593 QKKVFPPYLVDHL 605
            ++  P Y V++L
Sbjct: 642 TEQALPSYSVEYL 654

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 238/681 (34%), Positives = 357/681 (52%), Gaps = 96/681 (14%)

Query: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57
           SI QPF ++ +PR  +      Q+  L     ++ N+N + + +S+ +ISQYI+NPTPKL
Sbjct: 3   SIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTPKL 62

Query: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESH----------------------- 94
           +++ +IPS   V+A D    A       +C+   +SH                       
Sbjct: 63  LSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGDKT 122

Query: 95  ---QIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVFAK-HLPLKDIKQVEF 150
              +I + S VV     KI  +      +L+ G +Q Y    Q  +   +  +++K V +
Sbjct: 123 EDFKIKMDSKVVGI---KIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNY 179

Query: 151 I--DGQYALIVAAQ------STALYEL-----ENLTELRVSTTLHFEQFKQIRQHL---- 193
              +GQ  + V +          L+EL     +  T ++  +T   E F   +  L    
Sbjct: 180 FSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQS 239

Query: 194 GKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEIYL 253
           GK+YQ + +T   K + L   + +   ++P +       ++   V  +R+ L + N++YL
Sbjct: 240 GKLYQLEGST--IKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYL 297

Query: 254 LDLHLGSVLSHNKFAQLKQVEL-------IAGARDGS------FAIALSHGPQDNAVS-L 299
           LDL   SVLS       K  +L       ++ +  GS       AI ++    +N  S L
Sbjct: 298 LDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSAL 357

Query: 300 DIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPIL-----DAGDKTKR----SFD 350
           ++IN+++G+ ++KDSLGK F +    +        L+P+      DAGD        +F 
Sbjct: 358 EVINVDVGTGTLKDSLGKSFQSINDSKTH-----NLQPLFSDDESDAGDNADSDEVVAFA 412

Query: 351 YASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFE 410
           Y  I K+L+   K  +KFD  F K L I +E YT+ +RFI DQ FLS+ V +IL ++  E
Sbjct: 413 YEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQE 472

Query: 411 PSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIE 470
               YP A T+LLTHPLFP D TR LL + +  PRL+KQ IVTCPNLPLD+LL+E F I 
Sbjct: 473 ----YPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSIN 528

Query: 471 NNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQL 530
           N EL LD+SL+ILQD+T D IK E+K L +V+V NF+ F+I   +     + +T +LFQL
Sbjct: 529 NGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQL 588

Query: 531 LSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNK----ASVAGSNR 586
           LSLVID+IGLFALDG LL  L+ YID  V +AE N  LWNLL+ R        S+AGS+R
Sbjct: 589 LSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSR 648

Query: 587 SKYVKTQKKVFPPYLVDHLEI 607
           +K     ++  P Y V++LE+
Sbjct: 649 AK-----EQTLPKYTVEYLEL 664

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  334 bits (857), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 236/677 (34%), Positives = 363/677 (53%), Gaps = 81/677 (11%)

Query: 4   SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
           S+SQPF +  +P+ AS +        + ++  + +   N + + +S  S+SQYI+NPTPK
Sbjct: 3   SLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPTPK 62

Query: 57  LVNSKAIPSNLTVTAF----------DNGVYATQSNNKSFCLYLDESHQI---------- 96
           L+ +  IPS   VTA           +   +AT +N K+  L L   +Q           
Sbjct: 63  LIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMAN-KTSTLNLINKNQYQTNEEESGDS 121

Query: 97  -PLKSAVVNCLSEKIHDESV--------VTTAILQDGTVQKYKGGEQVF-AKHLPLKDIK 146
            P  S+V +    K  D  V            +L++G +Q Y    ++  + ++   +++
Sbjct: 122 APSDSSVTSEFKIKADDHVVDIKILNKKKIIVVLKNGKIQTYDFELKLLNSINMAYNNVR 181

Query: 147 QVEFI--DGQYALIVAAQ------STALYEL-ENLTELRVS----TTLHFEQF----KQI 189
            VE    DG+  + V            L+++ EN+  +  S    T+   E F     + 
Sbjct: 182 FVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLENAKF 241

Query: 190 RQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAP--LTFTVVGDSRVCLAL 247
               GK Y+  L  +   ++ L        + +P ++  K     ++F  +  +R+ L +
Sbjct: 242 CYQFGKFYK--LTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTV 299

Query: 248 ANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA-------RDGSFAIALSHGPQDNAVS-L 299
            N+IYLLDL   S+LS  +   LK  +L+  A       ++ + AI +S     N  S L
Sbjct: 300 NNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNINQNRTLAIGVSTKFGSNPTSSL 359

Query: 300 DIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTK--RSFDYASILKK 357
           +++N+++G+ +IKDSLGK F T   E      +       D  DK K  ++F+Y  I K+
Sbjct: 360 ELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLFDDENDYSDKKKQVKNFNYEKIYKE 419

Query: 358 LTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPA 417
           L  +  D  KFD IFFK   I +E YTE DRFI +  FL + + +I + +  E    YP 
Sbjct: 420 LVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFKEE----YPK 475

Query: 418 AFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLD 477
            FTYLLT PLFP ++T+ LL+++   PRL+KQ IVTCPNLPL+ELL E F I N ELSLD
Sbjct: 476 TFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLD 535

Query: 478 LSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDS 537
           +SL+ILQDYT+DSIKKE+K LP++ V NFI+F+I   ++  +++ A P LFQLLSLV+DS
Sbjct: 536 ISLRILQDYTRDSIKKELKKLPKIEVENFIEFIIDEESDIKDTTNA-PHLFQLLSLVVDS 594

Query: 538 IGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLE------FRTNKASVAGSNRSKY-V 590
           IGLFALD  +L  L+ YID  V IA+ NTELW+LL+      ++ +K   + S  S   +
Sbjct: 595 IGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSL 654

Query: 591 KTQKKVFPPYLVDHLEI 607
           K Q++V P Y V++L++
Sbjct: 655 KLQEEVLPKYSVEYLDL 671

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 234/669 (34%), Positives = 365/669 (54%), Gaps = 84/669 (12%)

Query: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57
           S+SQPF +A +P+ A       Q+K+L      T ++N + + VS  ++SQY+INPTP +
Sbjct: 3   SLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTPNV 62

Query: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYL-----------------------DESH 94
             +  IPS   VTA +   Y      + F +++                         + 
Sbjct: 63  SQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDKFSTTQ 122

Query: 95  QIPLKSAVVNC----LSEKIHDESVVTTAILQDGTVQKYKGGEQVF-AKHLPLKDIKQVE 149
              L++  V C    +  KI+ E       L +G +Q +    ++  + +    +I   E
Sbjct: 123 SDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSE 182

Query: 150 -FIDGQ--YALIVAA-----QSTALYEL--ENLTELR--VSTTLHFEQFK--QIRQHLGK 195
            F++ +  +A+I++       S  LYEL  ++ T ++   ST L   Q K  +I    GK
Sbjct: 183 HFVENKKSFAIILSTIEGNKLSYKLYELFGQDKTSIKELSSTILEDIQCKDSKISYQFGK 242

Query: 196 IYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEIYLLD 255
           +Y+  L  N   ++ L     +  + +P +   K   ++F  V ++R+ L + N+I++LD
Sbjct: 243 LYR--LYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILD 300

Query: 256 L-HLGS----VLSHNKFAQLKQVELI----AGARDGSFAIALS--HGPQDNAVSLDIINL 304
           L H  +    VL H K  QL +  +I    A     + AI +S  +GP     +L+IIN 
Sbjct: 301 LVHRATLAERVLGHVKMFQLLKSVVIETNDASNNHKTIAIGVSVKNGPSP-ITALEIINA 359

Query: 305 ELGSRSIKDSLGKGFATFMKERRSAESQVTLRPIL--DAGDKTKRSFDYASILKKLTAAA 362
            +G+ ++KDSLG  F       +S +S + L+P+   DA    +  F Y +ILKKL++  
Sbjct: 360 NVGTGTLKDSLGNSFDV----SKSFKSNI-LQPLFTDDANLVKRHDFKYEAILKKLSSTE 414

Query: 363 KDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYL 422
            D  KFD IFF +LYI Q  YT+ +RFI D  FLS+ + +I KN+  E    YP+A T+L
Sbjct: 415 NDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKE----YPSALTFL 470

Query: 423 LTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKI 482
           LTHPLFP  +T++LL K+++ PRL+KQ +VTCPNLP+DELLTE F I N ELS+D+SL+I
Sbjct: 471 LTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRI 530

Query: 483 LQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLFA 542
           LQDYTKDSIK E+K L ++++ NFI FVI    N++E      QLF LLSLV+D+ GLF+
Sbjct: 531 LQDYTKDSIKLELKNLNKIDIQNFIDFVID--PNNEEEKKHNEQLFVLLSLVLDASGLFS 588

Query: 543 LDGELLTELAGYIDNMVKIAEMNTELWNLLEF----RTNKASVAGSNRSKYVKTQKKVFP 598
           ++G LLT+L+ YID  V++ E + +LW+L++     R N    +G+   +      K   
Sbjct: 589 IEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEI-----KALT 643

Query: 599 PYLVDHLEI 607
            Y V++LE+
Sbjct: 644 AYSVEYLEL 652

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  320 bits (821), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 237/669 (35%), Positives = 359/669 (53%), Gaps = 87/669 (13%)

Query: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57
           S+SQ F +A +PR AS      QT  L     +   +N + + +S+ +ISQY++NPTPKL
Sbjct: 3   SLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTPKL 62

Query: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAV--------VN---CL 106
           V S  IPS   VTA D    A     + +C  L       L  A         VN    L
Sbjct: 63  VLSIPIPSTNIVTACD---VARSDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSDDVL 119

Query: 107 SEKIHDESV---------VTTAILQDGTVQKYKGGEQVF-AKHLPLKDIKQVEFI----- 151
             K+ D++V             +L++G +Q Y    ++  +  +   D+   +F      
Sbjct: 120 KVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGAN 179

Query: 152 DGQYALIVAAQSTALYELENLT-------ELRVSTTLHFEQFK----QIRQHLGKIYQFD 200
           D  + L    +    ++L  L+        ++  +++  E F     +I    G++Y+  
Sbjct: 180 DFLFILCSLPEDKVCFKLFELSLPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYR-- 237

Query: 201 LATNDFKIFELTTLNEIGVVNIPFLSASKGAP-LTFTVVGDSRVCLALANEIYLLDLHLG 259
           L  ++  ++ L     +  V +P +   +GA  ++   +  +R+ +   N+IYLL+L   
Sbjct: 238 LIGHEVLVYALPQCQLVQAVTLPMV---QGADVISMKPISSNRILVTADNKIYLLNLTHN 294

Query: 260 SVLSHNKFAQLKQVELIAGA-----------RDGSFAIALS--HGPQDNAVSLDIINLEL 306
           S+L   +   LK  +L+  A              +F I +   HG ++   SL+I+N+++
Sbjct: 295 SILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHG-KNPTSSLEIVNVDV 353

Query: 307 GSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTK-------RSFDYASILKKLT 359
           G+ ++KDSLGKGF           SQV L+P+    D            FD+  I + L 
Sbjct: 354 GTGTLKDSLGKGFTV----SNEPISQV-LKPLFSDEDNEAEDEDNKFEHFDFNQIYQHLE 408

Query: 360 AAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAF 419
              +  + FD+IF +EL I +E YTE DRFI D+ FLS  V +IL+N+  E    YP A 
Sbjct: 409 KNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEE----YPKAL 464

Query: 420 TYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLS 479
           T+LLTHPLFP D T  LLS++++ PRL+KQ IVTCPNLPL ELL+E F IEN ELSLD+S
Sbjct: 465 TFLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDIS 524

Query: 480 LKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSV-ATPQLFQLLSLVIDSI 538
           L+ILQDYT D IK+E++ L +++V NFI+FVI   +++DE+++ ++ QLFQLLSLV+DSI
Sbjct: 525 LRILQDYTTDMIKQEVRKLNKIDVQNFIEFVI---SSNDENAIRSSHQLFQLLSLVLDSI 581

Query: 539 GLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFP 598
           GLFALDG LL  LA YI   V IAE N++L +LL+ + N    A S       T++ V P
Sbjct: 582 GLFALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAV-P 640

Query: 599 PYLVDHLEI 607
            Y V++L++
Sbjct: 641 KYTVEYLDL 649

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  317 bits (812), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 232/637 (36%), Positives = 335/637 (52%), Gaps = 79/637 (12%)

Query: 3   ASISQPFTIANVPR------QASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
           A I+QPF +AN+P+       A QT  L     L   +NT+ V VS  SISQY+INPTPK
Sbjct: 2   AYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTPK 61

Query: 57  LVNSKAIPSNLTVTAFD-----NGV----YATQSNNKSFCLYL----------------- 90
           LV +  IPS   VT  D     +G     YA  +N K   L+                  
Sbjct: 62  LVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLRKAGAAPQETGLDAS 121

Query: 91  -DESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVF-AKHLPLKDIKQV 148
            DE  +  LK  VV     +I         +L  G +Q Y    Q+  +  +   ++  V
Sbjct: 122 EDEHFKQTLKGRVVRV---RILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLV 178

Query: 149 EFI------DGQYALIVAAQSTALYEL-------ENL--TELR--VSTTLHFEQFKQIRQ 191
           E+       D  + L         Y+L       ENL  TEL   +       + K + Q
Sbjct: 179 EYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQ 238

Query: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEI 251
             GK+Y+  L  +   ++ L        V +PF+   K   ++   +  +R+ L   N+I
Sbjct: 239 -FGKLYR--LVDSKMYVYSLPHFQLSHCVPLPFVR--KDDQVSLQAISTNRLLLTCCNKI 293

Query: 252 YLLDLHLGSVL-----SHNKFAQLKQVELIAGARDG----SFAIALSHGPQDNAVS-LDI 301
           +LLDL   ++L     S+ KF QL +  +I G   G    +FAI +S     N  S LD+
Sbjct: 294 FLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDV 353

Query: 302 INLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYASILKKLTAA 361
           + + +G+ ++KDSLGKGF +   E R  E+   L+P+    D    + D+A+IL +LT+ 
Sbjct: 354 VTIAVGTGTLKDSLGKGFLS--GEHRRTEA---LKPLFGTDDDESPNIDFAAILAELTSR 408

Query: 362 AKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTY 421
              P  FD IF+K L   +E YTE DRFI +  FL+  +  I   ++ E    +P A  Y
Sbjct: 409 TT-PKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADE----FPKALIY 463

Query: 422 LLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLK 481
           LLTHPLFP+  T+ LL K+K  PRL+KQ +VTCPNLPLDELL E F + N+ELSLDLSL+
Sbjct: 464 LLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLR 523

Query: 482 ILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLF 541
           +LQ++TK+ IK+ ++ L RV++ NF+ FVI +  + +E   A PQLFQLLSLVID++GL 
Sbjct: 524 VLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLL 583

Query: 542 ALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNK 578
           AL+G++L  L+ +ID+ V +A+   EL  LLE  + K
Sbjct: 584 ALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTK 620

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  313 bits (801), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 228/673 (33%), Positives = 350/673 (52%), Gaps = 94/673 (13%)

Query: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57
           SISQPF +  +P+ AS      Q   L    +LT   N ++V VS  ++SQYIINPTPKL
Sbjct: 3   SISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTPKL 62

Query: 58  VNSKAIPSNLTVTAFDNG--------------VYATQSNN-KSFCLYLD----------- 91
           V ++ I S   V+A                   Y  QSN   S C  +            
Sbjct: 63  VYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSSTASDSSF 122

Query: 92  ----ESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQ--------------KYKGGE 133
                +H++ +   +VN    K+  ++    A+L+ G +Q               YK   
Sbjct: 123 GETYAAHKVSVSDQIVNL---KVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179

Query: 134 QVFAKHLPLKDIKQVEF----IDGQ---YALIVAAQSTALYELENLTELRVSTTLHFEQF 186
             + +H   +  ++  F    IDG    + L    QS +      L+ + +      +  
Sbjct: 180 --YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSATPATELSSVILENMCLKD-- 235

Query: 187 KQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLA 246
            QI    G++Y+  L  N   I+ L        + +PFL+    + ++F  +  +R  L 
Sbjct: 236 SQIFYQFGQVYR--LHGNAVSIYNLPHFQHSRTIELPFLAPE--SIISFKPISTNRALLT 291

Query: 247 LANEIYLLDLHLGSVLS-----HNKFAQLKQVELIAGA-----RDGSFAIALSHGPQDNA 296
             N+I+LLDL   ++LS     H K  QL +  +I G      +  +  +++ HG   ++
Sbjct: 292 SDNKIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSS 351

Query: 297 VSLDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRS-FDYASIL 355
            SLDIIN+++G+ +++DS+GKGF +  +E +S      L+P++   + T+ + F+Y  IL
Sbjct: 352 -SLDIINIDVGTGTLRDSMGKGFMS--RENKSQH----LQPLISTLNDTEAAEFNYDRIL 404

Query: 356 KKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKY 415
           K+L+ AA +   FD +FFK L I    YT+ DRF+ D+ FL +   +I K++     S+Y
Sbjct: 405 KELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK----SEY 460

Query: 416 PAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELS 475
           P A TYLLT+PLFP   T +LL K+K  PRL+KQ IVTCPNL LDEL+ E F + N+EL 
Sbjct: 461 PKALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELC 520

Query: 476 LDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVAT-PQLFQLLSLV 534
           LDLSL+ILQD+ KDSIK+ +K   +++V NFI FVI    N +E  +   P+LFQLLSLV
Sbjct: 521 LDLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVIS--ENFEEDRIKNKPRLFQLLSLV 578

Query: 535 IDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQK 594
           +DS+GLFAL+ E+L +L  YID  + + + N EL+NL+E +  K    G        + +
Sbjct: 579 LDSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGF-GQPLGDTSTSGE 637

Query: 595 KVFPPYLVDHLEI 607
            V   Y ++ LE+
Sbjct: 638 PVITAYSIEQLEL 650

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  309 bits (791), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 248/723 (34%), Positives = 372/723 (51%), Gaps = 146/723 (20%)

Query: 4   SISQPFTIANVPRQAS------QTKVL-ISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
           S+SQPF +A +P+ AS      QT  L ++  + T + N + + +S   ISQYIINPTPK
Sbjct: 3   SLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPTPK 62

Query: 57  LVNSKAIPS-------------------NLTVTA-------FDN---------------- 74
           L+ + AIPS                   N TVT         DN                
Sbjct: 63  LLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTDVT 122

Query: 75  ---------GVYATQSNNKSFCLY---LDESHQIP----------LKSAVVNCLSEKIHD 112
                    G+ A +SN  +  +    LDE    P          + S VVN    KI  
Sbjct: 123 KRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNI---KIFK 179

Query: 113 ESVVTTAILQDGTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYAL-IVAAQSTALYELEN 171
           E      +L++G V+       +F   L LK    + + D Q+      ++   L  L N
Sbjct: 180 EFKTIVVVLKNGLVK-------LFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSN 232

Query: 172 LTELRVSTTLHFEQFK------QIRQHLGKIYQ-FDLATNDF-----KIFELTTLNEIGV 219
           + E + S      Q +      Q+ +    I Q FDL+ +       K++ LT  +E+ V
Sbjct: 233 IDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTG-SELFV 291

Query: 220 VNIP------FLSASKGAPLTFTV-----VGDSRVCLALANEIYLLDLHLGSVLSHNKFA 268
            ++P       +S ++  P T  V     V ++R+ LA+ N +YL+D    S+L+  +F 
Sbjct: 292 YSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFT 351

Query: 269 QLKQVELIAGARDG-------SFAIALS--HGPQDNAVSLDIINLELGSRSIKDSLGKGF 319
            +K  +L+  A  G       + AI +S   GP  +A +L++IN+E+GS ++KDSLGKG 
Sbjct: 352 HVKTFQLLQSATIGDSNITQRTIAIGVSTKSGPT-SASALELINIEVGSGTLKDSLGKG- 409

Query: 320 ATFMKERRSAESQVTLRPILDAGDKTK------------RSFDYASILKKLTAAAKDPAK 367
              + ++ S  S   L+P+ D  D+              +SF++  IL  L  ++   + 
Sbjct: 410 ---VSKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISD 465

Query: 368 FDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTHPL 427
           FD+ FF+ L I +  YTE DRFI DQ+F++ T+ +I K +  E    +P AFT+LLTHPL
Sbjct: 466 FDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTE----FPKAFTFLLTHPL 521

Query: 428 FPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYT 487
           FP   T  LL K+K  PRL+KQ IVTCPNLPL ELL + F ++N EL+LD+SL++LQDY+
Sbjct: 522 FPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYS 581

Query: 488 KDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLFALDGEL 547
           ++ +K+E+K L  V++ NFI+F+I     ++E    TPQLFQLLSLV+DSIGLFAL G L
Sbjct: 582 RNDVKQEIKKLDNVDIENFIEFIIT--PTTEEIQTNTPQLFQLLSLVLDSIGLFALKGPL 639

Query: 548 LTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKT---QKKVFPPYLVDH 604
           L  L+ YI+  V IAE ++ELW+LL+  T         ++ Y+K+    K+    Y VD+
Sbjct: 640 LERLSNYINEQVTIAERSSELWHLLDTSTTPRPF----KNAYLKSVIGNKETLSVYSVDY 695

Query: 605 LEI 607
           L+I
Sbjct: 696 LDI 698

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  305 bits (782), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 219/637 (34%), Positives = 338/637 (53%), Gaps = 74/637 (11%)

Query: 3   ASISQPFTIANVPR------QASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
           ASISQPF ++ +P+       A+QT  L    +L+ +AN +++ +S  SISQY+INPTPK
Sbjct: 2   ASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTPK 61

Query: 57  LVNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDE---SH------------------- 94
           LV +  IPS   VTA D  V    +N + +C  L+    SH                   
Sbjct: 62  LVFNLPIPSTNIVTACD--VVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAVSSSNAE 119

Query: 95  -----QIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVFAK-HLPLKDIKQV 148
                +  LKS VV   S KI+ ++     IL++G +Q +    ++     +   DI+ V
Sbjct: 120 ITSQFKYKLKSEVV---SIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFV 176

Query: 149 EFI-DGQ-----YALIVAAQSTALYELENLTELRVST----TLHFEQF----KQIRQHLG 194
           +F  DGQ     + L   +     Y+L  +    VS     ++  E +     ++    G
Sbjct: 177 QFFQDGQGNDFFFVLCQLSDEKICYKLFQVRSESVSCIELNSIILENYTLENAKLCFEFG 236

Query: 195 KIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEIYLL 254
           K+Y     +N+  I++L  L     + +PF+  SK A ++   V  +RV L   N IYL+
Sbjct: 237 KLYVLK-NSNELSIYQLPHLQLQTSIQLPFI--SKDAVVSIKPVSSNRVLLTADNTIYLV 293

Query: 255 DLHLGSVLSHNKFAQLKQVELIAGA------RDGSFAIALSHGPQDNA---VSLDIINLE 305
           DL   ++L       +K ++L++ A       D    IAL    ++ A     LD+IN++
Sbjct: 294 DLLYNAILFQKDLQNIKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINID 353

Query: 306 LGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGDKTKRSFDYASILKKLTAAAKDP 365
           +G+ ++KD++GKGF    K++     Q       +  D    S DY  I+K+L    K  
Sbjct: 354 VGTGTLKDAMGKGFMVKQKQKL----QKLFEESNEDDDVELPSPDYERIIKQLHICKK-I 408

Query: 366 AKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTH 425
             FD IFFK L + +E YT+ DRF+ D + L++ +  +  N+  E    YP A TYLLTH
Sbjct: 409 ENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDE----YPKALTYLLTH 464

Query: 426 PLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQD 485
           PLFP    + LL+K+K  PRL+KQ IVTCPN+PLD+LLTE F I N EL  D++L++LQD
Sbjct: 465 PLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQD 524

Query: 486 YTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLFALDG 545
           Y K+SIK  ++ + ++++TNF+  ++ +     +  +  PQ+FQL+SL+IDSIGLFALD 
Sbjct: 525 YKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDD 584

Query: 546 ELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVA 582
           E L +L+ ++D  V +   N EL +L E  T  +SV 
Sbjct: 585 EYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHSSVV 621

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  299 bits (766), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 235/695 (33%), Positives = 368/695 (52%), Gaps = 110/695 (15%)

Query: 4   SISQPFTIANVPRQAS-----QTKVLIS-QHSLTSNANTLDVAVSKYSISQYIINPTPKL 57
           S+SQPF +A +P+ AS     Q K  I    S T ++N++ + +S  SIS+Y+I PTP+L
Sbjct: 3   SLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTPRL 62

Query: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKS----------------------------FCLY 89
           + +  IPS   V+A + G Y+  S   S                            +C  
Sbjct: 63  IFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWCYA 122

Query: 90  LDESHQIPLKSAVVNCLSEKIHDESV---------------------------VTTAILQ 122
           L  ++    K+  +NCL  ++ + +                            V   + +
Sbjct: 123 LSANN----KTHTLNCLIREVDNNNTSITENNPQFNAKFKEQIINIEVDTKHKVIVILFE 178

Query: 123 DGTVQKYKGGEQVF-AKHLPLKDIKQVEFIDG---QYALIVAA---QSTAL--YEL---- 169
            G VQ Y    ++  + + P +DIK V+  +    +Y L+++    Q  AL  YE+    
Sbjct: 179 TGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTEE 238

Query: 170 ENLTELRVSTTLHFE-QFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSA- 227
           + + EL  S   +F  Q   +    G+IY+  L  ++ +++ + +L     V IPFLS  
Sbjct: 239 KKVKELTSSIIENFNLQDSLLCYQFGRIYR--LFKDEIEVYSIPSLQLNSKVKIPFLSEI 296

Query: 228 -SKGAPLTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--RDGS- 283
             K   ++   +  +RV L + N+IYLLDL   S+LS  + + +K  +++  A  RDGS 
Sbjct: 297 EDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTAMNRDGSE 356

Query: 284 ------FAIALSHGPQDNAVSLDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRP 337
                   I+  +G Q+   +L+IIN+++GS S+KDSLGK F      RR+ + Q  L+ 
Sbjct: 357 SKLTLALGISTKNG-QNPTSALEIINIDVGSNSLKDSLGKSFL-----RRNNQIQGQLKN 410

Query: 338 ILDAGDKTKRSFDYASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLS 397
           +         S ++  IL KL   A    KFD+ FF  L I +E +TE  RF+ DQ FL+
Sbjct: 411 LFPEPKYELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTENSRFLNDQRFLA 469

Query: 398 ETVGVILKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNL 457
             + +I     +  S   P +  +LLTHPLFP +K   LL+KVK   RL+KQ IVTCPNL
Sbjct: 470 SVLDLIFTKIDYNKSC--PRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLFKQAIVTCPNL 527

Query: 458 PLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNS 517
           PL ELL E F I+N+EL +D+S++ILQDYTKD+IK+E+K L +V+V NF+ F+I    N+
Sbjct: 528 PLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFMNFIIK--MNN 585

Query: 518 DESSVA-----TPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLL 572
            E++V+     TPQ+F+LLSL++DSIGLF L+  +L +L+  I+  VKIAE N ELWN++
Sbjct: 586 REAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAERNVELWNIM 645

Query: 573 EFRTNKASVAGSNRSKYVKTQKKVFPPYLVDHLEI 607
           + +    SV  S+ +   K  +    PY+V++++I
Sbjct: 646 DAKM--LSVKKSSSTAASKLAENSQTPYIVEYIDI 678

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  286 bits (731), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 227/647 (35%), Positives = 341/647 (52%), Gaps = 97/647 (14%)

Query: 26  SQHSLTSNANTLDVAVSKYSI----SQYIINPTPKLVNSKAIPSN--LTVTAFDNGVYAT 79
           + H +T+  +  DV +  + +      Y +N   K V      SN  LT    D   YA 
Sbjct: 99  TDHEVTNFQSKRDVEIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAG 158

Query: 80  QSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKY---------- 129
             +  S        ++I  K  V+N    KI  ++ +  A+LQ+G V+ Y          
Sbjct: 159 TDDILS-------QYKIKTKDKVMNI---KIDAKNSLVIAVLQNGLVEFYDFKLKLLHSY 208

Query: 130 ---------------KGGEQVFAKHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTE 174
                           G E VF    PL+D K V +   + +     +S+ + EL +   
Sbjct: 209 DISYGNLKYAKWFTENGTEFVFV-LCPLEDDK-VCYKLFELSDFEGKESSPIKELSS--- 263

Query: 175 LRVSTTLHFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLS--ASKGAP 232
             +     FE  K   Q  GK+Y+  L      ++ L       ++++P ++   S+   
Sbjct: 264 -TIIEGFSFESSKFCYQ-FGKLYK--LNQGKIHVYSLPHCQLQQIIDVPLINKPTSENDL 319

Query: 233 LTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSF 284
           ++F  V  +R+ L + N IYLLDL   S+L+  +   ++  +L+  A           + 
Sbjct: 320 ISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEKSQNSKTI 379

Query: 285 AIALS--HGPQDNAVSLDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILD-- 340
           AI +S  +GP   + SL+IIN+++G+ ++KDSLGK F       ++  S V L+P+ D  
Sbjct: 380 AIGISTKNGPNPTS-SLEIINIDVGTNTLKDSLGKSFQI----GKNDTSSVVLKPLFDDE 434

Query: 341 --AGDKTKR----------SFDYASILKKLTA-AAKDPAKFDQIFFKELYIVQECYTEGD 387
             A +  KR          +F Y  I+KK++A    D A FD IFFK+L + +E YTE D
Sbjct: 435 NVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFFKDLKVKEEHYTEKD 494

Query: 388 RFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLY 447
           RFI D  FL+  + +I + ++    + YP A T+LLTHPLFP ++T +LLS+++  PRL+
Sbjct: 495 RFISDSEFLNRVLDLIFEKFN---GNDYPKALTFLLTHPLFPLNRTHNLLSRLRDQPRLF 551

Query: 448 KQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFI 507
           KQ IVTCPNLPL+ELL E F I N EL LD+S +ILQD+T+DSIK+EMK L ++++ NFI
Sbjct: 552 KQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQNFI 611

Query: 508 KFVIGNYNNSDESSV-------ATPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVK 560
            F+     N+DE S         + QLFQLLSLV+DSIGLF+L+G LL  LA YID  V+
Sbjct: 612 DFIT----NTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLASYIDKQVE 667

Query: 561 IAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPYLVDHLEI 607
           IAE NTELWNL+E + ++      N S    +QK+  P Y +++LEI
Sbjct: 668 IAERNTELWNLVETKGSQHGFTNMN-SDSRTSQKQALPTYTMEYLEI 713

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 41/75 (54%), Gaps = 7/75 (9%)

Query: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
          S+SQPF +A +P+ AS +        V ++        N + + +S  SISQYIINPTPK
Sbjct: 3  SLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPTPK 62

Query: 57 LVNSKAIPSNLTVTA 71
          L     IPS   +TA
Sbjct: 63 LTFDYPIPSTNIITA 77

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  273 bits (697), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/385 (39%), Positives = 233/385 (60%), Gaps = 22/385 (5%)

Query: 233 LTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSF 284
           ++F  +  +R  L   N++YLLDL   ++LS  +F  +K  +L+  A         + + 
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 285 AIALSHGPQDNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDAGD 343
           AI ++  P + + S LD++N+++G+ ++KDS+GKGF +   + +  +S +         D
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKTKVQCPQSLLGT-----PND 115

Query: 344 KTKRSFDYASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVI 403
              +  +Y  ILK L     +  KFD +FFK+L I  + YT+ DRF+ DQ FL  ++ +I
Sbjct: 116 TEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFLGNSLKLI 175

Query: 404 LKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELL 463
            +N+     S+YP A TYLLTHPLFP   T  LL K+K  PRL+KQ IVTCPNLPL +LL
Sbjct: 176 FENFQ----SEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLSDLL 231

Query: 464 TESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVA 523
            E F + N+EL LDLSL+ILQD++KDSIK  +K   +V+V  FI FV+    N DE  V 
Sbjct: 232 QELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMN--ENVDEDRVK 289

Query: 524 T-PQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVA 582
             P+LFQLL+LV+DS+GLFAL+ E L +L+ YID  + + + N +L+NL++ R N  ++ 
Sbjct: 290 NKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDER-NFKNIL 348

Query: 583 GSNRSKYVKTQKKVFPPYLVDHLEI 607
           G + +  +   +     Y V+ LE+
Sbjct: 349 GQHHADSLSVGEGAITAYSVEQLEL 373

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  278 bits (712), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 181/460 (39%), Positives = 258/460 (56%), Gaps = 51/460 (11%)

Query: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEI 251
             GK Y+  L  N+  ++ L          IP +       ++   +  +R+ L + N+I
Sbjct: 248 QFGKFYK--LTNNNLMVYSLPQFQLEHTTTIPMIKTDDQI-VSMKPISTNRILLTINNKI 304

Query: 252 YLLDLHLGSVLSHNKFAQLKQVELIAGARDG---------SFAIALSHGPQDNAVSLDII 302
           YLLDL   S+LS  +   LK ++L+  A  G         +  ++   G    + SL+II
Sbjct: 305 YLLDLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTS-SLEII 363

Query: 303 NLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILDA---GDK---------TKRSFD 350
           N+++GS ++KDSLGK F     + +   S   L+P+ D    GDK         TK  F+
Sbjct: 364 NVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDDLFKKLVTKEQFN 423

Query: 351 YASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNY--- 407
           Y  IL KL+    D  KFD+IFF+   I +E YTE DRFI +  F  + + +I + +   
Sbjct: 424 YDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGST 483

Query: 408 -SFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTES 466
            +   +++YP   T+LLTHPLFP ++T+ LLS+    PRL+KQ IVTCPNLPL ELL E 
Sbjct: 484 ATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNEL 543

Query: 467 FVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQ 526
             I+NNELSLD+SL+ILQDY+KDSIK+E++ LPR+ + NFI F++ +    D++S   PQ
Sbjct: 544 LTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNS---PQ 600

Query: 527 LFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLE-----FRTNKASV 581
           LFQLL+LV+DSIGLFAL   +L  L+ YID  V I E NTELW L++     F  NK   
Sbjct: 601 LFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDN 660

Query: 582 AGSNRSKYVK--------------TQKKVFPPYLVDHLEI 607
           + S+ S                  TQK+  P Y VD+LE+
Sbjct: 661 SFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 7/77 (9%)

Query: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
          S+SQPF +  +P+ AS +        + +++ +     N + + VS  +ISQYIINPTPK
Sbjct: 3  SLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPTPK 62

Query: 57 LVNSKAIPSNLTVTAFD 73
          L+ +  IPS   VTA D
Sbjct: 63 LIFNYPIPSTNIVTACD 79

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  269 bits (687), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 222/649 (34%), Positives = 338/649 (52%), Gaps = 81/649 (12%)

Query: 12  ANVPRQASQTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKLVNS--KAIPSNLTV 69
            N+  + +  KV+ SQ        +  + V+K     Y +N   K++ +       NL  
Sbjct: 85  VNIEDKDNNEKVINSQTKRNIEIWSFGLMVNK---GNYTLNVITKVLENTINNTDENLVE 141

Query: 70  TAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKY 129
              +N VY            L   ++I  K+ V   +S KI  ++ +  AILQ+G ++ Y
Sbjct: 142 NKIENNVYTGSEG-------LLSQYKIKAKAKV---MSIKIDTKNNLIIAILQNGLIEFY 191

Query: 130 KGGEQVFA---------KHLPLKDIKQVEFIDGQYALIVAAQSTALYELENLTELR---- 176
               ++           K+        +EFI   + L         Y+L  LT+      
Sbjct: 192 DFKLKLLHSFDISYDNLKYAKWFTENGIEFI---FVLCPLQDDKVCYKLLELTDYENREN 248

Query: 177 -----VSTTL----HFEQFKQIRQHLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSA 227
                +S+T+     F+  K   Q  GK+Y+  L      ++ L       V+ +P ++ 
Sbjct: 249 SPIKELSSTIIEGFSFDDSKLCYQ-FGKLYK--LNKGKIYVYSLPHCQLQQVIELPLINN 305

Query: 228 S--KGAPLTFTVVGDSRVCLALANEIYLLDLHLGSVLSHNKFAQLKQVELIAGA------ 279
           S  +   ++F  V  +RV L + N +YLLDL   S L   + + +K  +L+  A      
Sbjct: 306 SDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEK 365

Query: 280 --RDGSFAIALSHGPQDNAVS-LDIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLR 336
                + AI +S     N  S L+IIN+++G+ ++KDSLGK F     +    +S V L+
Sbjct: 366 SHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSF-----QAEKKDSSVILK 420

Query: 337 PILDA--------------GDKTKRSFDYASILKKLTA-AAKDPAKFDQIFFKELYIVQE 381
           P+ D               GD +  +F Y  I+ KL+A  + D   FD IFFK+L I +E
Sbjct: 421 PLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEE 480

Query: 382 CYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVK 441
            YTE DRFI D  FL++ + +I + ++    + YP   T+LLTHPLFP D+TR+LLS ++
Sbjct: 481 HYTEKDRFISDLVFLNKVLDLIFEKFN---GNDYPKTLTFLLTHPLFPLDRTRNLLSLLR 537

Query: 442 QIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRV 501
             PRL+KQ IVTCPNLPL+ELL E F I N EL LD+S +ILQD+T+DSIK+EMK L ++
Sbjct: 538 DQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKL 597

Query: 502 NVTNFIKFVIGNYN-NSDE--SSVATPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNM 558
           ++ NFI+F+    N NS E  +   + QLFQLLSLV+DSIGLF+L+G LL  L  YID  
Sbjct: 598 DIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQ 657

Query: 559 VKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKTQKKVFPPYLVDHLEI 607
           VKIAE NTELWNL++ ++++         +   +QK+  P Y +++L+I
Sbjct: 658 VKIAERNTELWNLIDIKSSQHGFTNL-AFESASSQKQALPTYTMEYLDI 705

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 46/79 (58%), Gaps = 7/79 (8%)

Query: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
          S+SQPF +A +P+ AS +        V ++  +   + N + + +S  S+SQYIINPTPK
Sbjct: 3  SLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPTPK 62

Query: 57 LVNSKAIPSNLTVTAFDNG 75
          L+    IPS   +TA + G
Sbjct: 63 LIFDYPIPSTNIITACNAG 81

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  268 bits (685), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 212/617 (34%), Positives = 335/617 (54%), Gaps = 88/617 (14%)

Query: 49  YIINPTPKLVNSKAIPSN--LTVTAFDNGVYATQSNNKSFCLYLDESHQIPLKSAVVNCL 106
           Y +N T K++ S    SN  L   + D+  +A   +      +L + H+I  K+ V+N  
Sbjct: 127 YTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADD------FLSQ-HKIKTKAKVMNI- 178

Query: 107 SEKIHDESVVTTAILQDGTVQKYKGG-EQVFAKHLPLKDIKQVEFI-----DGQYALIVA 160
             KI  ++ +  A+LQ+G ++ Y    + +++  +   ++K  ++      D  + L   
Sbjct: 179 --KIDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPL 236

Query: 161 AQSTALYELENLTELR---------VSTTL----HFEQFKQIRQHLGKIYQFDLATNDFK 207
                 Y++  L++           +S+T+     FE  K   Q  GK+Y+  L      
Sbjct: 237 EDDKVCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQ-FGKLYK--LNQGKIY 293

Query: 208 IFELTTLNEIGVVNIPFL--SASKGAPLTFTVVGDSRVCLALANEIYLLDLHLGSVLSHN 265
           ++ L       ++ +P +  S S+   ++F  V  +R+ L + N IYLLDL   S+L+H 
Sbjct: 294 VYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHR 353

Query: 266 KFAQLKQVELIAGA--------RDGSFAIALS--HGPQDNAVSLDIINLELGSRSIKDSL 315
           +   +K  +L+  A           + AI +S  +GP   + SL+IIN+++G+ ++KDSL
Sbjct: 354 ELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTS-SLEIINIDVGTNTLKDSL 412

Query: 316 GKGFATFMKERRSAESQVTLRPILDAGDKT----KRS----------FDYASILKKLTA- 360
           GK F     +    ++ V L+P+ D  D T    KR+          F Y  +++KL+  
Sbjct: 413 GKSF-----QVGKNDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVL 467

Query: 361 AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFT 420
              D A FD+IFF +L + +E YTE DRFI D  FL++ + +I   +     + YP A T
Sbjct: 468 KNNDIASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFG---GNDYPKALT 524

Query: 421 YLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSL 480
           +LLTHPLFP ++T  LLS ++  PRL+KQ IVTCPNLPL+ELL E F I N EL LD+S 
Sbjct: 525 FLLTHPLFPLNRTHGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISF 584

Query: 481 KILQDYTKDSIKKEMKALPRVNVTNFIKFVIG----------NYNNSDESSVATPQLFQL 530
           ++LQD+T+DSIK+EMK L ++++ NFI+ +            N+N+S        QLFQL
Sbjct: 585 RVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHS-------SQLFQL 637

Query: 531 LSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYV 590
           LSLV+DSIGLF+L+G LL  L  YID  VKIAE NTELWNL++ + ++   A +  S   
Sbjct: 638 LSLVLDSIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFA-TLSSGST 696

Query: 591 KTQKKVFPPYLVDHLEI 607
            +QK+  P Y +++L+I
Sbjct: 697 TSQKQALPAYAMEYLDI 713

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 7/75 (9%)

Query: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
          S+SQPF +A +P+ AS +        V ++  +   + N + + +S  SISQYIINPTPK
Sbjct: 3  SLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPTPK 62

Query: 57 LVNSKAIPSNLTVTA 71
          L     IPS   +TA
Sbjct: 63 LTFDYPIPSTNVITA 77

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  266 bits (679), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 212/566 (37%), Positives = 304/566 (53%), Gaps = 82/566 (14%)

Query: 101 AVVNCLSEKIHDESVVTTAILQDGTVQ-------------------KY------KGGEQV 135
           A    +S KI  ++ +  AILQ+G ++                   KY       G E V
Sbjct: 171 AKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYV 230

Query: 136 FAKHLPLKD----IKQVEFIDGQYALIVAAQSTALYELENLTELRVSTTLHFEQFKQIRQ 191
           F    PL+D     K +E  D       + +S+ + EL +     +     FE  K   Q
Sbjct: 231 FV-LCPLQDDKVCYKLLELTDCG-----SGESSPIKELSS----TIIEGFSFENSKLCYQ 280

Query: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSA-SKGAPL-TFTVVGDSRVCLALAN 249
             GK+Y+  L      I+ L       V+  P +   S G  L +F  V  +RV L + N
Sbjct: 281 -FGKLYK--LNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNN 337

Query: 250 EIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSFAIALS--HGPQDNAVSL 299
            IYLLDL   S LS  +   +K  +L+  A           + AI +S  +GP   + SL
Sbjct: 338 VIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTS-SL 396

Query: 300 DIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILD--------------AGDKT 345
           +IIN+++G+ ++KDSLGK F     +  + +S V L+P+ D              +GD +
Sbjct: 397 EIINIDVGTNTLKDSLGKSF-----QVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSS 451

Query: 346 KRSFDYASILKKLTA-AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVIL 404
                   +++KL+A    D   FD IFFKEL I +E YTE DR+I D  FL++ + +I 
Sbjct: 452 VPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIF 511

Query: 405 KNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLT 464
             +S    + YP   T+LLTHPLFP  +TR+LLS ++  PRL+KQ IVTCPNLPL+ELL 
Sbjct: 512 GKFS---GNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLE 568

Query: 465 ESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVI-GNYNNSDE--SS 521
           E F I N EL LD+S +ILQD+T+DSIK+EMK L +++V NFI+F+  G  ++S E  + 
Sbjct: 569 ELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNP 628

Query: 522 VATPQLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASV 581
             + QLFQLLSLV+DSIGLF+L+G LL  L  YID  V+IAE NTELWNL++ +  +   
Sbjct: 629 SQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGF 688

Query: 582 AGSNRSKYVKTQKKVFPPYLVDHLEI 607
           A S       +QK+  P Y +++L+I
Sbjct: 689 ASSTFDNGT-SQKRALPTYTMEYLDI 713

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 7/75 (9%)

Query: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56
          S+SQPF +A +P+ AS +        V ++  +   + N + + +S  SISQYIINPTPK
Sbjct: 3  SLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPTPK 62

Query: 57 LVNSKAIPSNLTVTA 71
          L     IPS   +TA
Sbjct: 63 LTFDYPIPSTNIITA 77

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa]
          {OFF} YGR128C (UTP8) - Protein required for cell
          viability [contig 130] PARTIAL
          Length = 215

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 53/99 (53%), Gaps = 11/99 (11%)

Query: 4  SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57
          SISQPF +  +P+ AS      Q   L    +LT   N ++V +S  +ISQY+INPTPKL
Sbjct: 3  SISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTPKL 62

Query: 58 VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESHQI 96
          V +  I S   VTA D    A  +N  +      E+H++
Sbjct: 63 VYNLPISSTNVVTACDVAEVAGTNNEGT-----AEAHEV 96

>ZYRO0B07480g Chr2 complement(584441..588721) [4281 bp, 1426 aa]
           {ON} similar to uniprot|P51862 Saccharomyces cerevisiae
           YLR371W ROM2 GDP/GTP exchange protein (GEP) for Rho1p
           and Rho2p mutations are synthetically lethal with
           mutations in rom1 which also encodes a GEP
          Length = 1426

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 13/106 (12%)

Query: 288 LSHGPQDNAVSLDIINLELGSRSIKDSLG-KGFA-----TFMKERRSAESQVTLRPILDA 341
           L H    N      + L L +R+  +SL  K FA     T +++RRS+ S  + RP+L A
Sbjct: 409 LGHNSTGNQYGQSSMGLGLKTRNSSNSLASKRFASTSSNTLIQDRRSSGSLPSSRPLLSA 468

Query: 342 GDKTKRSFDYASILKKLTAAAK-----DPAKFDQIFFKELYIVQEC 382
              TKR   Y ++L ++    K     D  K D + +++ +  Q+ 
Sbjct: 469 S--TKRPQVYPALLSRVATKFKATIQTDAHKKDGLIYRDAFTGQQA 512

>TBLA0C01020 Chr3 complement(201774..203645) [1872 bp, 623 aa] {ON} 
          Length = 623

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 149 EFIDGQYALIVAAQSTALYELENLTELRVSTTLHFEQFKQIRQHL 193
           E ID Q  +I   Q     ELEN  E++ S TL  +  K++ +HL
Sbjct: 306 EIIDIQQKIINCRQELKQIELENKREMKSSKTLQKQIIKELEEHL 350

>Skud_10.320 Chr10 complement(570536..572503) [1968 bp, 655 aa] {ON}
           YJR098C (REAL)
          Length = 655

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 543 LDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVA---GSNRSKYVKTQKKVFPP 599
           L+G+++  + GY  ++++ A     +W  L+   N A V    G N    +KTQK++ P 
Sbjct: 240 LEGDVVV-MGGYRGSVLRDASTRKRIWIPLKAGLNMAKVDLLIGPNDEDELKTQKEIIPD 298

Query: 600 YLVDHL 605
            +V H+
Sbjct: 299 GMVTHI 304

>ZYRO0C02266g Chr3 (176474..181339) [4866 bp, 1621 aa] {ON} similar
           to uniprot|P48563 Saccharomyces cerevisiae YNL297C MON2
           Peripheral membrane protein with a role in endocytosis
           and vacuole integrity interacts with Arl1p and localizes
           to the endosome member of the Sec7p family of proteins
          Length = 1621

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 46/80 (57%), Gaps = 10/80 (12%)

Query: 407 YSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDEL--LT 464
           +S+E  S++P         PL  +  +++  +K+  I     Q + T P +P+D+L  + 
Sbjct: 48  HSYEELSRHPDFIV-----PLVMSCASKN--AKLTTISMQCFQKLATVPCIPVDKLSDVL 100

Query: 465 ESFVIENNELSLDLSLKILQ 484
           ++F IE N+L++D+ LK+LQ
Sbjct: 101 DAF-IEANQLAMDIKLKVLQ 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,420,735
Number of extensions: 2763172
Number of successful extensions: 9104
Number of sequences better than 10.0: 44
Number of HSP's gapped: 9357
Number of HSP's successfully gapped: 54
Length of query: 607
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 492
Effective length of database: 40,294,809
Effective search space: 19825046028
Effective search space used: 19825046028
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)