Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008203.490ON20720710741e-151
KAFR0C019503.490ON1571681803e-16
ZYRO0D10032g3.490ON2092061686e-14
KLLA0E04643g3.490ON2211891573e-12
TDEL0D055803.490ON1931981413e-10
SAKL0F02816g3.490ON1921931282e-08
Skud_7.4403.490ON2132141185e-07
NDAI0G009503.490ON2131741161e-06
KLTH0F14784g3.490ON1952021151e-06
Kwal_55.212263.490ON1962011142e-06
NCAS0E008203.490ON2021771132e-06
CAGL0I10538g3.490ON2001951105e-06
YGR129W (SYF2)3.490ON2152041107e-06
TBLA0C044703.490ON222216992e-04
Ecym_12393.490ON193153964e-04
Smik_6.2253.490ON21351964e-04
Suva_7.4173.490ON212211920.002
Kpol_480.153.490ON207161850.012
AFR308W3.490ON192192840.013
TPHA0D042403.490ON209208730.47
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00820
         (207 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...   418   e-151
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    74   3e-16
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    69   6e-14
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    65   3e-12
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    59   3e-10
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    54   2e-08
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    50   5e-07
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    49   1e-06
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    49   1e-06
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    49   2e-06
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    48   2e-06
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    47   5e-06
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    47   7e-06
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    43   2e-04
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    42   4e-04
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    42   4e-04
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    40   0.002
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    37   0.012
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    37   0.013
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    33   0.47 

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score =  418 bits (1074), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/207 (100%), Positives = 207/207 (100%)

Query: 1   MKMRCPSRGTAVEQGLSKGRDRPDTSSTISFVGTMGLTELRDKFKTLSQESQRLRVRIRK 60
           MKMRCPSRGTAVEQGLSKGRDRPDTSSTISFVGTMGLTELRDKFKTLSQESQRLRVRIRK
Sbjct: 1   MKMRCPSRGTAVEQGLSKGRDRPDTSSTISFVGTMGLTELRDKFKTLSQESQRLRVRIRK 60

Query: 61  QQAEVEKPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRGENGDDAVA 120
           QQAEVEKPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRGENGDDAVA
Sbjct: 61  QQAEVEKPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRGENGDDAVA 120

Query: 121 RVEGDRVAKDTYKKELALLGRKSTRGTYRDNVERLVTHLNDVSKKRYLVRKNKMKRQGAR 180
           RVEGDRVAKDTYKKELALLGRKSTRGTYRDNVERLVTHLNDVSKKRYLVRKNKMKRQGAR
Sbjct: 121 RVEGDRVAKDTYKKELALLGRKSTRGTYRDNVERLVTHLNDVSKKRYLVRKNKMKRQGAR 180

Query: 181 GGSSLDGYINEKNKQFNKKLQRNGPST 207
           GGSSLDGYINEKNKQFNKKLQRNGPST
Sbjct: 181 GGSSLDGYINEKNKQFNKKLQRNGPST 207

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 73.9 bits (180), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 93/168 (55%), Gaps = 20/168 (11%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRKQQAEVEKPKVYSLQAAEPSVDGIDGAEVVDNVTV 94
           M +  LR++F+ L ++ + +++  RK  +   KPK YS++  E   +  D  E  D+  +
Sbjct: 3   MDMANLREEFRDLRKKCREIKIENRKLISIASKPKTYSIREEEIGAEVSDEDE-DDSEII 61

Query: 95  KLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRKSTRGTYRDNVER 154
           KLL  PLR+ E  EA   EN +D       DR+   TY KE+  LG++  R     +VE 
Sbjct: 62  KLLTKPLREFET-EAHVAENKEDI------DRL---TYNKEVMSLGKREKR-----DVES 106

Query: 155 LVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202
           LV+ +N +S +RY  +K   KR+  R   +  G+INE+NK FN +L++
Sbjct: 107 LVSEMNRISDERY--KKGAQKRR--RLKDTERGFINEQNKAFNLRLEK 150

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 69.3 bits (168), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 96/206 (46%), Gaps = 41/206 (19%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRK-------QQAEVEKPKVYSLQAAEPSVDGIDGAE 87
           M L +    F  L ++S  + V  RK       + A   KP+VY L+A EPS+   D   
Sbjct: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQD--- 67

Query: 88  VVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGD--RVAKDTYKKEL------ALL 139
             D    +L+N  ++Q E   +R+    D    R  G+   +AK TY KEL       +L
Sbjct: 68  --DKHGNQLMNYTIQQYEEWNSRQR---DQTNKRDSGNLQDMAKYTYDKELNKLHKDTML 122

Query: 140 GRKSTRG---------------TYRDN---VERLVTHLNDVSKKRYLVRKNKMKRQGARG 181
             + T G               T +D+   V++L   ++  + +RY  R+ +M+R   + 
Sbjct: 123 QNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQN 182

Query: 182 GSSLDGYINEKNKQFNKKLQRNGPST 207
            SS  GYINEKNKQFN+KL R  P +
Sbjct: 183 ASSGGGYINEKNKQFNEKLDRQMPQS 208

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/189 (32%), Positives = 96/189 (50%), Gaps = 36/189 (19%)

Query: 37  LTELRDKFKTLSQESQRLRVRIRKQQAEVEKPK------VYSLQAAEPSVDGIDGA---- 86
           L E+  K K+L +  Q++ V IR ++A + + K      VYS+     + DG D A    
Sbjct: 39  LMEIEKKLKSLRK--QKVEVSIRNKKAIIAEEKKNSERRVYSM-----ADDGEDKARSNK 91

Query: 87  -EVVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRKST- 144
            E  D   +KL N  +R+ E  EA+   +  +     +   +AK++YKKE+  L +  + 
Sbjct: 92  SEPED--PIKLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDISH 149

Query: 145 ----------RGTYRDN---VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINE 191
                     +    DN   VE++V  LN+ SKKRY+VRK K+ +Q        DG+IN+
Sbjct: 150 PLKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLD--DGFIND 207

Query: 192 KNKQFNKKL 200
           KNK+FN KL
Sbjct: 208 KNKRFNAKL 216

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 58.9 bits (141), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 98/198 (49%), Gaps = 32/198 (16%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRK-------QQAEVEKPKVYSLQ-AAEPSVDGIDGA 86
           M L  + ++FK L + S  + ++IRK        ++ V KPK+YS++   E     +D +
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 87  EVVDNVTVKLLNTPLRQLEAREAR-RGENGDDAVARVEGDRVAKDTYKKELALLGR---- 141
           E      +KL+N  +R+ E  + + +G+      A V+   +AK +Y+K+L+   +    
Sbjct: 61  E---RRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQ--ELAKYSYEKDLSRSKQNNGN 115

Query: 142 ---------KSTRGTYRDN---VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYI 189
                    K+ R   +D+   V +L   L   +++R+L RK  M++  AR      GYI
Sbjct: 116 RVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPG--GYI 173

Query: 190 NEKNKQFNKKLQRNGPST 207
           NEKNKQFN KL R    T
Sbjct: 174 NEKNKQFNLKLDRQMKET 191

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 95/193 (49%), Gaps = 34/193 (17%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRKQQAEVEK-------PKVYSLQAAEPSVDGIDGAE 87
           M LT+L  K K L ++   + V+ RK+  + EK       PKVYS+   E   D     +
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKD-----Q 55

Query: 88  VVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKELALL-------- 139
             ++   KLLN  ++  E  + +R     ++    + D +AK TY KE+  +        
Sbjct: 56  KEEDTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQD-LAKYTYDKEIREMEKDGSLNR 114

Query: 140 -----GRKSTRGTYRDN-----VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYI 189
                 R + +G  + N     +E+L  +LN  +K+RY+ RK + ++  +   S+  G+I
Sbjct: 115 GKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDS---STTGGFI 171

Query: 190 NEKNKQFNKKLQR 202
           N+KNKQFN+KL R
Sbjct: 172 NDKNKQFNEKLSR 184

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 96/214 (44%), Gaps = 53/214 (24%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRK------QQAEVE-KPKVYSLQAAEPSVDGIDGAE 87
           M L +L  K K L ++   + ++ RK      Q+A +  KPKVYS++      + ++ AE
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 88  VVD-----NVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKEL-ALLGR 141
             D     + TV+  N   ++   R+  +G+   ++      D+VAK +Y+K L  L+ +
Sbjct: 61  TSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSY-----DQVAKLSYEKTLRNLVTQ 115

Query: 142 KSTRGTYRDN---------------------------------VERLVTHLNDVSKKRYL 168
            S +     N                                 V +L   L   SKKRY 
Sbjct: 116 NSNKNENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYE 175

Query: 169 VRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202
            R+ +M  + A+  SS++ +IN+KNKQFN+KL R
Sbjct: 176 ARRKQM--ENAKTPSSVESFINDKNKQFNEKLSR 207

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 83/174 (47%), Gaps = 37/174 (21%)

Query: 60  KQQAEVEKPKVYSLQAAEPS------VDGI-DGAEVVDNVTVKLLNTPLRQLEAREARRG 112
           K++++  KPKVY ++A E         DG+ D +   +    KL+N  +R+ E  + ++ 
Sbjct: 36  KEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLMNYTIREYEEWDKQQK 95

Query: 113 ENGDDAVARVEGD---RVAKDTYKKELALLGRKSTRGTYRDNVERLVTHLN--------- 160
              D    RV+G     +A  TY+KEL+ L  K    ++    +  V   N         
Sbjct: 96  ---DKQRKRVDGSDLTELATFTYEKELSKLNSKLENISHEQKHQIGVNTRNGKLNVKDEE 152

Query: 161 -----------DVSKKRYLVRKNKMKRQGARGGSSLDG-YINEKNKQFNKKLQR 202
                      + +KKRY+VRK K++   ++  S + G Y  +KNKQFN+KL+R
Sbjct: 153 RLLNNLVNNLNETAKKRYMVRKKKLQ---SKASSDIAGNYFKDKNKQFNEKLER 203

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 91/202 (45%), Gaps = 49/202 (24%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRKQQAEVEK-------PKVYSLQAAE-PSVDGIDGA 86
           M L +  D+ K L ++   L V+ ++Q  + EK       P VYS++  E PS +  + +
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 87  EVVDNVTVKLLNTPLR---QLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRKS 143
           +       KLL   ++   Q + +E R+ +   D VA+ +   +AK TY KE+  L    
Sbjct: 61  K-----EAKLLQYSMKDFEQWQDKERRKSQKSSD-VAKYQD--LAKFTYDKEVQQL---- 108

Query: 144 TRGTYRDNVER-----------------------LVTHLNDVSKKRYLVRKNKMKRQGAR 180
            R  Y + VE+                       L   LN  + +RY   + K+ RQ   
Sbjct: 109 -RKNYTNKVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMV- 166

Query: 181 GGSSLDGYINEKNKQFNKKLQR 202
              +  G+INEKNKQFN K++R
Sbjct: 167 -SDTPGGFINEKNKQFNDKIER 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 94/201 (46%), Gaps = 47/201 (23%)

Query: 35  MGLTELRDKFKTLSQESQRLRVR-----IRKQQ--AEVEKPKVYSLQAAEPSVDGIDGAE 87
           M L++  D+ K L ++   L V+     IR+++  +   KP VYS+ A        +GAE
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNA--------EGAE 52

Query: 88  --VVDNVTV--KLLNTPLRQLEAREARRGENGDDAVARVEG----DRVAKDTYKKELALL 139
             +  +VT   KLL   + + E  + +  +N      R+EG      +AK TY KE+  L
Sbjct: 53  EEIAKDVTEANKLLKYSMLEYEQWQDKVKKNS----HRLEGGASFQDLAKSTYDKEVQQL 108

Query: 140 ----GRKSTRGT-YRDN-------------VERLVTHLNDVSKKRYLVRKNKMKRQGARG 181
               G +  + T YR N             V  LV  LN  + +RY   + K+ RQ    
Sbjct: 109 SKIDGNRVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQMNNT 168

Query: 182 GSSLDGYINEKNKQFNKKLQR 202
            S   GYINEKNKQFN KL+R
Sbjct: 169 TSG--GYINEKNKQFNDKLER 187

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 84/177 (47%), Gaps = 38/177 (21%)

Query: 55  RVRIRKQQAEVE---KPKVYSLQAAEPSVDGIDG-----AEVVDNVTVKLLNTPLRQLEA 106
           R+ + ++  ++E   KP+VY++Q      D  D       E  D+   KL+N  LRQ E 
Sbjct: 26  RLLVDRESKDIESSGKPRVYNMQ------DDQDNQLETQEEDADDKVAKLMNYTLRQYEE 79

Query: 107 REARRGE----------------NGDDAVARVEGDRVAKDTYKKELAL-LGRKSTRGTYR 149
            E ++ +                + D  V+ +   R  K T ++E+ + +  K+ +   +
Sbjct: 80  WEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNRFRTDKTTTEREVQIQVNSKTGKVNIQ 139

Query: 150 DN---VERLVTHLNDVSKKRYLVRKNKMKRQGARG-GSSLDGYINEKNKQFNKKLQR 202
           D    V  L  +L   + KRY+V K K+    AR   SS +GYINE+NK FN+KL R
Sbjct: 140 DEKKLVNDLAKNLTKTANKRYMVTKKKL---DARSKDSSAEGYINERNKHFNEKLDR 193

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 86/195 (44%), Gaps = 32/195 (16%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIR---KQQAEVE----KPKVYSLQAAEPSVDGIDGAE 87
           M L +  +K K L +  Q +++R R   KQ+AE +    KP+VYS+   E   D    ++
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 88  VVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDRV---AKDTYKKELALLGR--- 141
              ++   L    ++     E R+       +    G R+   AK+TY KEL  L R   
Sbjct: 61  EQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEF 120

Query: 142 --KSTRGTYRDN--------------VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSL 185
             K+    +R N              V+RL  +L + +K+RY   +   K    +  +SL
Sbjct: 121 KMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQRYDSNR---KIANDKEHTSL 177

Query: 186 DGYINEKNKQFNKKL 200
            G IN KN QFNK L
Sbjct: 178 SGSINAKNLQFNKSL 192

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 92/204 (45%), Gaps = 42/204 (20%)

Query: 37  LTELRDKFKTLSQESQRLRVRIRKQQAEVEKPKVYSLQAAEPSVDGIDGAEVVDNVTVKL 96
           L EL+ K   +S +S++L  R  ++ +   KP+VYS++    + + +   E  +    K 
Sbjct: 10  LKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKE--KA 67

Query: 97  LNTPLRQLEAREAR--RGENGDDAVARVEGDRVAKDTYKKELALLGRKSTRGTYRDN--- 151
            +  +++ +A E R  +G+ G      +  D++AK +Y+K L  L  ++   + +D+   
Sbjct: 68  FHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSAD 127

Query: 152 ---------------------------------VERLVTHLNDVSKKRYLVRKNKMKRQG 178
                                            V +L   L   SKKRY  RK +M  Q 
Sbjct: 128 EEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQM--QN 185

Query: 179 ARGGSSLDGYINEKNKQFNKKLQR 202
           A+    ++ +IN+KNKQFN+KL R
Sbjct: 186 AKTLYGVESFINDKNKQFNEKLSR 209

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 94/216 (43%), Gaps = 59/216 (27%)

Query: 37  LTELRDKFKTLSQESQRLRVR-------IRKQQAEVEKPKVYSLQAAEPSVDGIDGAEVV 89
           + EL   +KTL ++++  R+        +R + A   KPKVYS+       D  D  E+ 
Sbjct: 4   INELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSM------TDEFDKDELP 57

Query: 90  DNV------------TVKLLNTPLRQLEAREARRGE--------NGDDAVARVEGDRVAK 129
            N               KL+N  LR+ +  E ++ E        + DD +  +  D +AK
Sbjct: 58  INDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESL--DSLAK 115

Query: 130 DTYKKELALLGRKSTRGTYRDNVER-----LVTHLNDVSK-----KRYLVRK--NKMKRQ 177
            TY K++  L  K+ R T   N        +  H N+ +K      ++LV +  N +K +
Sbjct: 116 RTYDKDIRKLN-KALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTK 174

Query: 178 GAR-----------GGSSLDGYINEKNKQFNKKLQR 202
             R             ++L G++N KN++FN+KL R
Sbjct: 175 SDRLYKHLGERRKNYSTTLSGHVNTKNQEFNEKLTR 210

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 67/153 (43%), Gaps = 23/153 (15%)

Query: 67  KPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDR 126
           KP+VYS+     +V+ +      +    KLLN  L   E  + +  +   D      GD 
Sbjct: 40  KPEVYSINDEGAAVNEVQSTSNTERR--KLLNYSLIDYEKWDEKEKQANFDGT--YSGD- 94

Query: 127 VAKDTYKKELALL------------GRKSTRGTY-----RDNVERLVTHLNDVSKKRYLV 169
           +A  TYK E+  L            GR S  G       ++ V +L   L   S++R+L 
Sbjct: 95  IAYSTYKNEIKQLRKGGLTKGKITKGRISESGKVAIEDEKELVNKLAQTLEKTSRERFLR 154

Query: 170 RKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202
            K ++    A   S L  ++NEKN+ FN+KL R
Sbjct: 155 EKKRLDGHKA-NTSELGNFVNEKNRHFNEKLSR 186

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 152 VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202
           V +L   L   SKKRY  RK +M  + A   S ++ +IN+KNKQFN+KL R
Sbjct: 159 VNKLAVSLESESKKRYEARKRQM--ESAVIPSGVESFINDKNKQFNEKLSR 207

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 97/211 (45%), Gaps = 48/211 (22%)

Query: 35  MGLTELRDKFKTL-------SQESQRLRVRIRKQQAEVEKPKVYSLQAA-------EPSV 80
           M L EL +K K L       S ++++L  R  ++ +   KP+VYS++ A       E   
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 81  DGIDGAEVVDNVTVKLLNTPLRQLEAREARRGE---NGDDAVARVEGDRVAKD----TYK 133
           D  D A    + TV+  N   ++ + R++ + +   N  D +A++  D+  ++     Y 
Sbjct: 61  DDKDRAF---HYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYG 117

Query: 134 KELALLGRKSTRGTYRDN----------------------VERLVTHLNDVSKKRYLVRK 171
           K  + +  K ++G+   +                      V +L + L   SKKR+  RK
Sbjct: 118 KHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARK 177

Query: 172 NKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202
            +M  +  +  S ++ +IN+KNKQFN+KL R
Sbjct: 178 RQM--ENVKTPSGVESFINDKNKQFNEKLGR 206

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 71/161 (44%), Gaps = 30/161 (18%)

Query: 67  KPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREARRG---ENGDDAVARVE 123
           KPK YS++  E + D       VD    +LLN  +R+ E  E ++G   EN     + V 
Sbjct: 42  KPKTYSME--ELAEDDTVNTGTVDEAD-RLLNYSIREYEEWEKKQGRHKENVHVTKSSVN 98

Query: 124 GD-RVAKDTYKKELALLGRKSTRGTYRDNVER---------------------LVTHLND 161
              ++AK TY K++  L ++ +    R  + +                     L   LN 
Sbjct: 99  STAQIAKFTYDKQIKKLQKQKSTNDNRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQ 158

Query: 162 VSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202
            +K+RY   +   KRQ     +    YINEKNK+FN KL+R
Sbjct: 159 TTKERY--DRTNQKRQKNSDQNENYSYINEKNKEFNDKLER 197

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 85/192 (44%), Gaps = 31/192 (16%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRKQQAEVE-------KPKVYSLQAAEPSVDGIDGAE 87
           MG+ ++  + + L ++     +R RK+ A  E       KP+VYS+            A+
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAE---AD 57

Query: 88  VVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGDRVAKDTYKKELALLGRK----- 142
              +  +KLLN  +   E  + ++  +   +     G+ +A  TY+ EL  L R+     
Sbjct: 58  DTQSEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGE-LANSTYRSELHQLHRRGVVKG 116

Query: 143 -STRGTYRDN-----------VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYIN 190
            +T G    +           VE+L   +   +K+R+  R+ K  + G R  +   G +N
Sbjct: 117 RATNGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKAAKDGGRATA---GSLN 173

Query: 191 EKNKQFNKKLQR 202
           +KN+ FN+KL R
Sbjct: 174 DKNRHFNEKLDR 185

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 32.7 bits (73), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 84/208 (40%), Gaps = 41/208 (19%)

Query: 35  MGLTELRDKFKTLSQESQRLRVRIRK-------QQAEVEKPKVYSLQAAEPSVDGIDGAE 87
           M +  L D+FK L +++    +  RK       ++  V KPKVYS+   +          
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 88  VVDNVTVKLLNTPLRQLEAREA---RRGEN-GDDAVARVEGDRVAKDTYKKELALLGRKS 143
           + +N    LL   +R  E  E    R+ +N  + + +     + AK TY KE+  + ++ 
Sbjct: 61  LTNNSERALLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEIHRMKKRQ 120

Query: 144 ---------TRGT------------YRDN---VERLVTHLNDVSKKRYLVRK--NKMKRQ 177
                    TRG+             +D+   V   ++ +N VS  RY+ R   N +   
Sbjct: 121 GKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIKRMKLNAVNND 180

Query: 178 GARGGSSLD----GYINEKNKQFNKKLQ 201
                 S D     Y N KNK FN KL+
Sbjct: 181 ATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,522,969
Number of extensions: 837518
Number of successful extensions: 2492
Number of sequences better than 10.0: 63
Number of HSP's gapped: 2470
Number of HSP's successfully gapped: 64
Length of query: 207
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 103
Effective length of database: 41,556,135
Effective search space: 4280281905
Effective search space used: 4280281905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)