Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008103.492ON75775735290.0
NCAS0E008103.492ON6927175139e-55
KAFR0C019603.492ON5635154779e-51
Smik_6.2263.492ON8393743621e-34
YGR130C3.492ON8163703503e-33
Skud_7.4413.492ON8073813423e-32
Suva_7.4183.492ON8313723371e-31
NDAI0G009403.492ON6563883092e-28
CAGL0I10516g3.492ON8133482951e-26
Kpol_480.143.492ON6993712583e-22
SAKL0F02772g3.492ON7733162461e-20
TPHA0D042503.492ON6293262298e-19
ZYRO0D09988g3.492ON9943292272e-18
KLTH0F14828g3.492ON8362632102e-16
TDEL0D056003.492ON7002581968e-15
KLLA0D16236g3.492ON8712641923e-14
Kwal_55.212293.492ON7872641817e-13
TBLA0C044803.492ON802971646e-11
KNAG0A079403.492ON275751302e-07
Ecym_12373.492ON7272191333e-07
KAFR0G036903.492ON363103960.005
AFR310C3.492ON623265840.18
NDAI0B058603.492ON68151810.48
TPHA0I020507.115ON30866752.0
Kwal_27.115688.431ON65952733.9
ZYRO0F11198g7.325ON222122706.1
NCAS0B053303.126ON116057709.6
NOTE: 1 genes in the same pillar as KNAG0B00810 were not hit in these BLAST results
LIST: NCAS0F03550

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00810
         (757 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...  1363   0.0  
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   202   9e-55
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   188   9e-51
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   144   1e-34
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   139   3e-33
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   136   3e-32
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   134   1e-31
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   123   2e-28
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   118   1e-26
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   103   3e-22
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    99   1e-20
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    93   8e-19
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    92   2e-18
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    86   2e-16
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    80   8e-15
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    79   3e-14
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    74   7e-13
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    68   6e-11
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    55   2e-07
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    56   3e-07
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    42   0.005
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    37   0.18 
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    36   0.48 
TPHA0I02050 Chr9 complement(458058..458984) [927 bp, 308 aa] {ON...    33   2.0  
Kwal_27.11568 s27 (852845..854824) [1980 bp, 659 aa] {ON} YDR221...    33   3.9  
ZYRO0F11198g Chr6 (917238..917255,917321..917971) [669 bp, 222 a...    32   6.1  
NCAS0B05330 Chr2 complement(986513..989995) [3483 bp, 1160 aa] {...    32   9.6  

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 1363 bits (3529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/757 (90%), Positives = 682/757 (90%)

Query: 1   MAIAGYDRLVQEHEDAVSLQXXXXXXXXXXXXXXXXXXAIGTAATEEYVSPFRGGQLTKA 60
           MAIAGYDRLVQEHEDAVSLQ                  AIGTAATEEYVSPFRGGQLTKA
Sbjct: 1   MAIAGYDRLVQEHEDAVSLQSSGASSRGSRVSRGSFRRAIGTAATEEYVSPFRGGQLTKA 60

Query: 61  SKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFPEYLLENEDRQRL 120
           SKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFPEYLLENEDRQRL
Sbjct: 61  SKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFPEYLLENEDRQRL 120

Query: 121 ILKDLEKREQTLLHLQRCQSVLDRTCKPAKEEKRKELKAIEPVKRDTTNRFAIDYDFVPP 180
           ILKDLEKREQTLLHLQRCQSVLDRTCKPAKEEKRKELKAIEPVKRDTTNRFAIDYDFVPP
Sbjct: 121 ILKDLEKREQTLLHLQRCQSVLDRTCKPAKEEKRKELKAIEPVKRDTTNRFAIDYDFVPP 180

Query: 181 VDPTQEEKDEIDVSDPIVREYIRDARGIPRAEANXXXXXXXXXXXXXXRDVLNIEQNQLV 240
           VDPTQEEKDEIDVSDPIVREYIRDARGIPRAEAN              RDVLNIEQNQLV
Sbjct: 181 VDPTQEEKDEIDVSDPIVREYIRDARGIPRAEANGGDASGDASGYDYDRDVLNIEQNQLV 240

Query: 241 DAQQMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQA 300
           DAQQMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQA
Sbjct: 241 DAQQMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQA 300

Query: 301 TEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQ 360
           TEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQ
Sbjct: 301 TEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQ 360

Query: 361 VDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXX 420
           VDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEA        
Sbjct: 361 VDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVKLQKL 420

Query: 421 XXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQD 480
               FISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQD
Sbjct: 421 QDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQD 480

Query: 481 KITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLD 540
           KITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLD
Sbjct: 481 KITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLD 540

Query: 541 SLAVVKQEISGERLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDADLDERL 600
           SLAVVKQEISGERLKLIGITN           IWNEKLDSNTKFYEDKLGEKDADLDERL
Sbjct: 541 SLAVVKQEISGERLKLIGITNEMERARAERERIWNEKLDSNTKFYEDKLGEKDADLDERL 600

Query: 601 KQLDVEHTANLVQVREIYEAKLQDSXXXXXXXXXXXXXXXXXXXXIEKSLLDQEQQAKKE 660
           KQLDVEHTANLVQVREIYEAKLQDS                    IEKSLLDQEQQAKKE
Sbjct: 601 KQLDVEHTANLVQVREIYEAKLQDSAEKAEEAEQQLKLAAEEKAQIEKSLLDQEQQAKKE 660

Query: 661 LEDMQKERDFAERRAKDESERADQHLEQKVAIEMERKEWAKKIADAEERANIATKARVNA 720
           LEDMQKERDFAERRAKDESERADQHLEQKVAIEMERKEWAKKIADAEERANIATKARVNA
Sbjct: 661 LEDMQKERDFAERRAKDESERADQHLEQKVAIEMERKEWAKKIADAEERANIATKARVNA 720

Query: 721 QHERSNAESELTKARNKPIFENNSLYSFATEEVTTFK 757
           QHERSNAESELTKARNKPIFENNSLYSFATEEVTTFK
Sbjct: 721 QHERSNAESELTKARNKPIFENNSLYSFATEEVTTFK 757

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  202 bits (513), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 201/717 (28%), Positives = 333/717 (46%), Gaps = 106/717 (14%)

Query: 44  ATEEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103
           A  +Y SPFR     + S   +Q ++T++FPTVSATS Y   N ++ GF+ +   Q  A+
Sbjct: 69  AMSDYASPFRA----EYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAK 124

Query: 104 DIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTCKPAKEEKRKELKAIEPV 163
           DI FP YL ENE RQ+  L  LEK+E+ L +LQ  Q+++D T            K  EP 
Sbjct: 125 DIYFPNYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLT------------KKQEPK 172

Query: 164 KRDTTNRFAIDYDFVPPVDPTQEEKDEIDVSDPIVREYIRDARGIPRAEANXXXXXXXXX 223
           K  T            PV  T EE DE       + E I      P  E           
Sbjct: 173 KAPT------------PVASTTEEIDEATFPHSNISEEIN-----PDYE----------- 204

Query: 224 XXXXXRDVLNIEQNQLVDAQQ-MALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAV 282
                    N EQ  LV +++ +   N +E   P+DPA  P +           P S A 
Sbjct: 205 -DEEQSSAQNNEQLVLVQSEEEIHTPNVVE--PPIDPALAPMV-----------PFSLAT 250

Query: 283 GVSTKQRLMDTP--VTNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQ 340
                ++  + P   +NP A+    E ++K  ++G++S AV++K+ YD++ HK  +ADY+
Sbjct: 251 PNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYE 310

Query: 341 REQESKFAKKLQEYEQKLAQVDDRKLSVLAKMND----AKLDKIAKSEVIENQKIKQLFD 396
            +Q  K+  K+QEY++ L  +D++    ++++ND     +LD   K +V+  Q +K++FD
Sbjct: 311 TKQNEKYEAKMQEYKKSLQDMDNQ----MSELNDLIEKCELDTKEKIDVMHGQLVKKVFD 366

Query: 397 SNATFNDSKVKVLHEAXXXXXXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTT 456
                 + K+K+ +E              +    T ++  +++LT EK+    +Y  WTT
Sbjct: 367 KKGVQINDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTT 426

Query: 457 NLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLAD 516
           N+TNI   LDA+LFK+SQ N  Q  +  +I  LT +K  L+ EI  N+    +  + +  
Sbjct: 427 NMTNIGSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVES 486

Query: 517 LETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITNXXXXXXXXXXXIWNE 576
           ++  ++L   +L  + + I G L+ + +VKQE + E+++L  IT                
Sbjct: 487 VDNKEYLP--KLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQL 544

Query: 577 KLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANLVQVREIYEAKLQDSXXXXXXXXXXX 636
           + +   +  E+ LG++  +L+ +   + V H   +  ++  YE KL++            
Sbjct: 545 EAEERKRQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKNQLKQ----- 599

Query: 637 XXXXXXXXXIEKSLLDQEQQAKKELEDMQKERDFAERRAKDESERADQHLEQKVAIEMER 696
                     E+  LDQ ++ K  LE           +A DE +R      QK A ++ +
Sbjct: 600 ----------EQDQLDQVKRQKTRLEG---------EKALDEQKR------QKDADDVLK 634

Query: 697 KE-WAKKIADAEERANIATKARVNAQHERSNAESELTKARNKPIFENNSLYSFATEE 752
            E + K+   AE  +    K R   +H  +    E+T    KP  ++NSLY + TEE
Sbjct: 635 NEIFEKQHKQAEAFSAAQLKGR---KHPLAALAREIT-GEAKPSSKDNSLYDYETEE 687

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  188 bits (477), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 154/515 (29%), Positives = 258/515 (50%), Gaps = 65/515 (12%)

Query: 48  YVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVF 107
           Y SPFR    ++  KKQLQ  +T KFP VSATS YN+ +T+++ +  +   +  ARDI F
Sbjct: 51  YNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTYNT-DTKDV-YKDLDPKKNFARDIKF 108

Query: 108 PEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTCKPAKE-EKRKELKAIEPVKRD 166
           P  L++NE+RQ  IL DL+ ++  L  L+    V+D    P  + EK +E K  +PV   
Sbjct: 109 PSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDVEDLPRDDKEKGEEEKDSDPV--- 165

Query: 167 TTNRFAIDYDFVPPVDPTQEEKDEIDVSDPIVREYIRDARGIPRAEANXXXXXXXXXXXX 226
                        P  P+  E    +++D   ++ ++DA  +    A             
Sbjct: 166 -------------PEQPSNNE----NITD---KDALQDAYDLNSKAA----TKTDPDIVS 201

Query: 227 XXRDVLNIEQNQLVDAQQMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVST 286
               VLN  +N L+DA+ M+++N++ + KP+     PK                 V  +T
Sbjct: 202 HNYSVLN--KNNLIDAKDMSIENKLFYLKPIHRKDYPK-----------------VQSTT 242

Query: 287 KQRLMDTPVTNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESK 346
           + +    PV +P+      E ++KL     +S  V++K+ +D KV+   +  YQ +Q +K
Sbjct: 243 ESKF---PVASPE----NKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNK 295

Query: 347 FAKKLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKV 406
             K   EY +K+  +   K   L ++ +  L+     EVI+N+ +K L DS ATF+D+KV
Sbjct: 296 LNKLKSEYNEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKV 355

Query: 407 KVLHEAXXXXXXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLD 466
           K+L +             F++QK+ L++ E N + +EK   + +++    +L  I + LD
Sbjct: 356 KILRKTGQLKLQKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELD 415

Query: 467 AQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSH 526
           A+LFKLSQ N + + +  +I  L  +K  L  EID+ ++ K + D +   L         
Sbjct: 416 AKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQL--------- 466

Query: 527 ELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITN 561
           EL ++ + I  KL +L ++KQEI  E+LK+  +TN
Sbjct: 467 ELNEMDEQINSKLSNLNLIKQEIINEKLKISKLTN 501

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 101/374 (27%), Positives = 198/374 (52%), Gaps = 13/374 (3%)

Query: 256 PVDPATQPKLYVDLDSLQLIDPGSTAVGVSTK-------QRLMDTPVTNPQATEDTPELL 308
           P+DP+  PK+       +    G T +    K       Q+      +NP AT + PEL+
Sbjct: 376 PIDPSKAPKVPFQ----ERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELI 431

Query: 309 LKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSV 368
           +K  ++G++S AV++K+ YD+KVH+A + D +  +++K+  K +EYE+KL  + ++   V
Sbjct: 432 VKTKEHGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEV 491

Query: 369 LAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXXXXXFISQ 428
              M   + +   K EV +N+ +KQ+ D NA  N+ K+ +  +              +  
Sbjct: 492 EDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLN 551

Query: 429 KKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRD 488
           K+T ++ ++++L  EK++ +KD++ WTTNL+N++++LDAQ+FK++Q N KQ K+  +I  
Sbjct: 552 KQTNVKSQIDELNSEKTNVQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDS 611

Query: 489 LTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQE 548
           L Q+K  L  +   N+       + L  +E  ++L   ++  + + I   L+ + ++KQE
Sbjct: 612 LEQKKNALVTQTQENEKLHEKNVQVLESVENREYLP--QINDIDNQISTLLNEMTIIKQE 669

Query: 549 ISGERLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHT 608
            + E+ +L  IT                + +   +  E+ L ++  +L+E+ +Q  ++H 
Sbjct: 670 NANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHE 729

Query: 609 ANLVQVREIYEAKL 622
             + QV++ Y  +L
Sbjct: 730 EQITQVKKTYNDQL 743

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 70/103 (67%), Gaps = 3/103 (2%)

Query: 46  EEYVSPFRGGQL-TKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRA 102
           EE++SPFR   L +K +  +L ++  + +KFPTVSATS Y+    ++LG+  +  + +RA
Sbjct: 51  EEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRA 110

Query: 103 RDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145
           +DI FP YL +NE+RQ  +L +LE +E+ L +L++CQ + D T
Sbjct: 111 KDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLT 153

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  139 bits (350), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 97/370 (26%), Positives = 202/370 (54%), Gaps = 7/370 (1%)

Query: 257 VDPATQPKLYVDLDSLQ----LIDPGSTAVGVSTKQRLMDTPVTNPQATEDTPELLLKLP 312
           +DP+  PK+     S +    +     +    ST++     P +NP AT + PEL++K  
Sbjct: 354 IDPSKAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAP-SNPVATPENPELIVKTK 412

Query: 313 KYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKM 372
           ++G++S AV++K+ YD+K+H+A +AD + +++ K+  K +EY++KL  + ++   +   M
Sbjct: 413 EHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSM 472

Query: 373 NDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXXXXXFISQKKTL 432
              + +   K EV +N+ +K++ D NA  N+ K+ +L +              +  K+T 
Sbjct: 473 KAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTN 532

Query: 433 MQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQR 492
           ++ E++ L  EK++ +K+++ WTTNL+N++++LDAQ+FK++Q N KQ K+  +I +L ++
Sbjct: 533 VKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKK 592

Query: 493 KTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGE 552
           K +L  + + N+       + L  +E  ++L   ++  + + I   L+ + ++KQE + E
Sbjct: 593 KEDLVTQTEENKKLHEKNVQVLESVENKEYLP--QINDIDNQISSLLNEVTIIKQENANE 650

Query: 553 RLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANLV 612
           + +L  IT                + +   +  E+ L ++  +L+E+  Q  ++H   + 
Sbjct: 651 KTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQIT 710

Query: 613 QVREIYEAKL 622
           QV++ Y  +L
Sbjct: 711 QVKQTYNDQL 720

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 65/104 (62%), Gaps = 2/104 (1%)

Query: 44  ATEEYVSPFRGGQLTKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRR 101
             EE+VSPFR   L      +   +  + +KFPTVSATS Y+    ++LG+  +  + +R
Sbjct: 49  GKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKR 108

Query: 102 ARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145
           A+DI FP YL +NE+RQ  +L +LE +E+ L +L++CQ + D T
Sbjct: 109 AKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDLT 152

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 95/381 (24%), Positives = 200/381 (52%), Gaps = 17/381 (4%)

Query: 251 IEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGV---------STKQRLMDTPVTNPQAT 301
           +E + P+DP+  PK+           P     G+         S+ Q+   T  +NP AT
Sbjct: 339 VEDKAPIDPSKAPKVPFKER------PKKERTGIFALWKSPTSSSAQKGGVTAPSNPVAT 392

Query: 302 EDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQV 361
            + PEL++K  ++G++S AV++K+ YD+KVH+A +AD + ++++K+      Y ++L  +
Sbjct: 393 PENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDL 452

Query: 362 DDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXX 421
            ++   +   M   + +   K EV +N+ +KQ+ D N   N+ K+ +  +          
Sbjct: 453 QNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQ 512

Query: 422 XXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDK 481
               +  K+T ++ E+++L   K++ +K+++ WTTNL+N++++LDAQ+FK++Q N KQ K
Sbjct: 513 EKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSK 572

Query: 482 ITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDS 541
           +  +I  L ++K +L A+ + N+       + L  +E  ++L   ++  + + +   L+ 
Sbjct: 573 VQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLP--QINDIDNQVSTLLNK 630

Query: 542 LAVVKQEISGERLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDADLDERLK 601
           + +++QE + E+ +L  IT                + +   +  E+ L ++  +L+E+  
Sbjct: 631 MTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAH 690

Query: 602 QLDVEHTANLVQVREIYEAKL 622
           Q  ++H   + QV++ Y  +L
Sbjct: 691 QAQLDHEQQITQVKQTYNDQL 711

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 46  EEYVSPFRGGQLTKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103
           EE+VSPFR   L++    +L +   + KKFPTVSATS Y+    ++LG+  +  + +RA+
Sbjct: 51  EEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAK 110

Query: 104 DIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTC 146
           DI FP YL +NE+RQ  +L +LE +E+ L +L+ CQ + D T 
Sbjct: 111 DIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLTS 153

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 98/372 (26%), Positives = 198/372 (53%), Gaps = 9/372 (2%)

Query: 256 PVDPATQPKLYVD----LDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQATEDTPELLLKL 311
           P+DP+  PK+        +         +    S K+     P+ NP AT + PEL++K 
Sbjct: 367 PIDPSKAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPL-NPVATPENPELIVKT 425

Query: 312 PKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAK 371
            ++G++S AV++K+ YD+K+H+A + D +  +++K+  K  EY++KL  + ++   +   
Sbjct: 426 KEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENS 485

Query: 372 MNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXXXXXFISQKKT 431
           M   + +   K EV +N+ +KQ+ D N   N+ K+ +  +              +  K+T
Sbjct: 486 MKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQT 545

Query: 432 LMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQ 491
            ++ E+++L  EKS+ +K+++ WTTNL++++++LDAQ+FK++Q N KQ K   +I +L +
Sbjct: 546 NVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEK 605

Query: 492 RKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDS-IQGKLDSLAVVKQEIS 550
           +K +L  + + N   K   ++N+  LE+ ++ +    +   D+ I   L+ + +++QE +
Sbjct: 606 QKKDLITQTEEN---KKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENA 662

Query: 551 GERLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHTAN 610
            ER  L  IT                + +   +  E+ L ++  +L+E+  Q ++EH   
Sbjct: 663 NERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHEEQ 722

Query: 611 LVQVREIYEAKL 622
           + QV++ Y  +L
Sbjct: 723 ITQVKKTYNDQL 734

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 46  EEYVSPFRGGQLTKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103
           E++VSPFR   L+     +L +   + +KFPTVSATS Y+    ++LG+  +  D +RA+
Sbjct: 49  EDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAK 108

Query: 104 DIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTC 146
           DI FP YL +NE+RQ  +L +LE +E+ L +L++CQ + D T 
Sbjct: 109 DIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLTG 151

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 102/388 (26%), Positives = 189/388 (48%), Gaps = 42/388 (10%)

Query: 255 KPVDPATQPKLYVDLDSLQLIDPGSTAVGVST--------KQRLMDTPVTNPQATEDTPE 306
           KP+DP   P +     S QL  P        T        K+R       NP+AT ++ E
Sbjct: 189 KPIDPKLTPMV-----SFQLSTPPVNNKNKKTQVVPEEEEKER-------NPKATPNSKE 236

Query: 307 LLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKL 366
            ++K  K+G +S ++++++ YD + H+  +A Y+ E + K+  K+QEYE +L  +D++ +
Sbjct: 237 EIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKIV 296

Query: 367 SVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXXXXXFI 426
           +    +   K D  AK +++  + +K++FD  +   D K+K+  E              +
Sbjct: 297 ASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIKREKIDEKINV 356

Query: 427 SQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQI 486
            +    +  E++QL  EK     +++ WT N+TNI E+LDA+LFK+ Q N  Q  +  +I
Sbjct: 357 EELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQINITQMNLQNKI 416

Query: 487 RDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVK 546
             L   K  L  EI+AN+F+  N    + +++  Q+L   +L  +   I   L+ L ++K
Sbjct: 417 DGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLP--KLNNIDSQINDLLNQLTLIK 474

Query: 547 QEISGERLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFY----------EDKLGEKDADL 596
           QE + E+++L  +T            +  E++D   K            E+ LG++  +L
Sbjct: 475 QENANEKIQLSELT----------QKLEKERMDHEEKLKLDAEERKRQEENLLGKQREEL 524

Query: 597 DERLKQLDVEHTANLVQVREIYEAKLQD 624
           +++   L + H   +  ++  YE +L D
Sbjct: 525 EQKANDLQLNHETEMTNLKTSYEQQLAD 552

 Score = 90.1 bits (222), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 46  EEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDI 105
           EEY+SPFR   +T  +K  +Q ++TK+FPTVSATS Y +  ++E+GF K+  D+  A+DI
Sbjct: 66  EEYLSPFRSNLVTN-NKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDI 124

Query: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145
            FP YL +NE RQ++ L  L K E+ L + +  Q+++D T
Sbjct: 125 FFPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  118 bits (295), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/348 (26%), Positives = 178/348 (51%), Gaps = 6/348 (1%)

Query: 277 PGSTAVGVSTKQRLMDTPVTNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEM 336
           P  T V V   Q  +D P+    AT + PEL+ K  +YG++S  +++KV+YD+  H+  +
Sbjct: 401 PVITDVPVIPDQSQLDFPI----ATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWL 456

Query: 337 ADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFD 396
             +++ +++K+  K++EY  +L ++      +   M + K +   K EV EN  +K++F+
Sbjct: 457 KGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFE 516

Query: 397 SNATFNDSKVKVLHEAXXXXXXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTT 456
            N   N+ K K+  E              I  K  ++Q E+ QL   K    +++  WTT
Sbjct: 517 RNTLHNEQKNKIFKETENIKNQKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTT 576

Query: 457 NLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLAD 516
           N+T + ++LDA++ K++Q   KQD+  ++I  L  +K E +A+IDA +       + +  
Sbjct: 577 NMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVES 636

Query: 517 LETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITNXXXXXXXXXXXIWNE 576
            E  ++L   ++  + + I   L+ LA++KQE + E+ +L  IT                
Sbjct: 637 YENKEYLP--KIHTIDNQISELLNELAIIKQENANEQTELSKITKELEEERRAHEEKLKL 694

Query: 577 KLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANLVQVREIYEAKLQD 624
           + +   +  ++ L ++  +L+E+ +Q   EH   + +++E YE +L +
Sbjct: 695 EAEERERQEKNLLEKQRLELEEKAEQQKREHEEQVRKMKEQYENELNN 742

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (59%), Gaps = 6/99 (6%)

Query: 49  VSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFP 108
           V+PF        + KQ+      KFPTVSATS   + + +ELGF  +    +RA+DI FP
Sbjct: 105 VNPFTNKPAYNKNAKQM------KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFP 158

Query: 109 EYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRTCK 147
            YL ENE RQ+ ILK+LE +E  L +L+  Q ++D T +
Sbjct: 159 VYLTENEFRQQTILKELELKEGKLQYLKDSQKIIDLTIR 197

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 98/371 (26%), Positives = 177/371 (47%), Gaps = 16/371 (4%)

Query: 256 PVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQATEDTPELLLKLPKYG 315
           P++P   P L++     Q    G  A+        +     NP ++ + PE ++K  ++G
Sbjct: 314 PINPDEAPMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSKNPMSSPENPEYVIKTKQHG 373

Query: 316 HVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAKMNDA 375
           ++S AV++KV YD  VH+  + + +  +E K+  K  EYE  LA +  +  ++   M++ 
Sbjct: 374 YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDEL 433

Query: 376 KLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAX-XXXXXXXXXXXFISQKKTLMQ 434
           KL    K EV+E Q +K + D   T NDSK K+  E              FIS K+  ++
Sbjct: 434 KLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFIS-KQAEIR 492

Query: 435 HEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQRKT 494
            E+  L+ E++    D++ W + L  IT +LDA++  +   N ++  I +++  L   K 
Sbjct: 493 KEIENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKM 552

Query: 495 ELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGERL 554
           ELE EI  N+    N    L DL   ++     + ++ + I G+L+ L+ +K+E   E  
Sbjct: 553 ELEEEIKKNEEIHKNNTELLTDLNVRKNYLPR-INEIDNEIAGRLEKLSTIKKETIEENN 611

Query: 555 KLIGITNX---XXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANL 611
           +L  +T               + NEKL            E++  L ++L +L  +H   L
Sbjct: 612 RLTILTKKLEDERIARENEIRLKNEKLKR----------EQEQKLQKQLAELKAKHNEEL 661

Query: 612 VQVREIYEAKL 622
           +++++ YE K+
Sbjct: 662 LEIQKKYEKKM 672

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 62/97 (63%), Gaps = 1/97 (1%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106
           EYVSPFR     +A+    + ++ ++FPTVSA+S ++  +  ELG+  ++   +RA+DI 
Sbjct: 37  EYVSPFRDPSNVQAAN-YAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDIS 95

Query: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143
           FP +L+ NE RQ  I+ DLE +E  L +L+  Q +L+
Sbjct: 96  FPSFLIANERRQGGIITDLELKEANLKYLRNSQILLN 132

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 156/316 (49%), Gaps = 35/316 (11%)

Query: 255 KPVDPATQPKLYVDLDSLQLIDPGSTAVGVS---TKQRLMDTPVTNPQATEDTPELLLKL 311
           +P+DP   P++           P     GV    T+    D P+  PQ     PE +++ 
Sbjct: 319 QPIDPNKAPRV-----------PFKAKTGVFALWTRSDKQDQPLATPQ----DPEYIVRT 363

Query: 312 PKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVDDRKLSVLAK 371
            K G++S A+++K+ YD++VH+ E+A + +EQ  K+    +EY  KL  +  +   + A 
Sbjct: 364 DK-GYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQAT 422

Query: 372 MNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXXXXXFISQKKT 431
           M   +LD   K +V E++  K++ D NAT   SK  +  E              I+ K  
Sbjct: 423 MEQLRLDTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHE 482

Query: 432 LMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKITRQIRDLTQ 491
            ++ E+ +L + K   + +++ +   L ++T +LD+++ K+ + N KQ +IT  I +L Q
Sbjct: 483 EVKAEIEELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQ 542

Query: 492 RKTELEAEI-DANQFSKGNADRNLADLETG--QHLKSHELVKVTDSIQGK----LDSLAV 544
           +K E+E E  DA +  K +         TG  + +K+ E +   ++I  +    L SL +
Sbjct: 543 KKLEIETETRDAEELHKES---------TGILESIKNKEYLPKINAIDSQVATLLGSLTL 593

Query: 545 VKQEISGERLKLIGIT 560
           +KQE + ++ +   IT
Sbjct: 594 IKQENANQKTEFAAIT 609

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 6/97 (6%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106
           +Y SPFR  Q   A+K      + KKFPTVSATS   + +  +LG+  +   +RRA+DI 
Sbjct: 44  DYSSPFRSQQELIAAKNV----KAKKFPTVSATS--GTASAADLGYKVIDSAKRRAKDIS 97

Query: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143
            P YL   +++QR  L  LE +E  L +L+  Q ++D
Sbjct: 98  VPRYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVD 134

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 92.8 bits (229), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 147/326 (45%), Gaps = 23/326 (7%)

Query: 256 PVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRL--------------------MDTPV 295
           P+DP+  P + +      L+    T    S K  +                    +  P 
Sbjct: 252 PIDPSIVPMVRIPPICTDLLSAPKTNATFSIKSLISGAKGSNKTAKAGASNMTLGVAVPE 311

Query: 296 TNPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYE 355
           T+  A+ + PE L++  +Y  VS AV++++ Y+ K+H   + ++   ++ K+  K QEYE
Sbjct: 312 THAVASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371

Query: 356 QKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXX 415
            KL ++  +   +  K   + + K  K E++E Q +K + D  + +N  K KV+ E    
Sbjct: 372 DKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELM 431

Query: 416 XXXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQF 475
                     +  K+  +++E+ +L  EK     +Y++W  NL N+T  LD ++ K+   
Sbjct: 432 KLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAI 491

Query: 476 NHKQDKITRQIRDLTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDS 534
           N    +I + I  L  +K  LE EI D  +  K N D  L  L   +      L ++ + 
Sbjct: 492 NENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDV-LQKLNVEKDYLPR-LNEIDEQ 549

Query: 535 IQGKLDSLAVVKQEISGERLKLIGIT 560
           I  K D LA++K E   E  +L  +T
Sbjct: 550 IAAKFDKLAIIKNETISENNQLSILT 575

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 60/96 (62%), Gaps = 1/96 (1%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106
           EY+SPFR  Q T  S     L + KKFPT SATS +N     E+G+S +  + +RA+DI 
Sbjct: 36  EYISPFRNPQDTVRSNYAKSL-KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQ 94

Query: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142
           FP+YLL+NE RQ  +L +L+ +E  L  LQ+   VL
Sbjct: 95  FPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/329 (24%), Positives = 154/329 (46%), Gaps = 4/329 (1%)

Query: 297 NPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQ 356
           NP AT + PE+L+K  + G +S AV++KV Y++  H   + ++   ++ ++ +K  +Y+ 
Sbjct: 487 NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDN 546

Query: 357 KLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXX 416
           +L ++      +   M + K D     E+   +  K+  +S   + + K  + HE     
Sbjct: 547 RLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQ 606

Query: 417 XXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFN 476
                    I  ++  +Q E+  L  EK +  +++  WT  L + +  LDA+++ L    
Sbjct: 607 DQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQ 666

Query: 477 HKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHL-KSHELVKVTDSI 535
            K  K   QI +L+ +K  LE E+ A++ +     + +      ++L K HE   + D I
Sbjct: 667 QKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHE---IDDKI 723

Query: 536 QGKLDSLAVVKQEISGERLKLIGITNXXXXXXXXXXXIWNEKLDSNTKFYEDKLGEKDAD 595
              L  L+V+KQE + E+LKL  IT                + +   +  +D LG++  +
Sbjct: 724 SNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREE 783

Query: 596 LDERLKQLDVEHTANLVQVREIYEAKLQD 624
            +     L  +H   L ++++ YE +LQ+
Sbjct: 784 HEAVAAGLKKQHEEELRKMKQDYEKRLQE 812

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (63%), Gaps = 4/99 (4%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106
           E+ SPFR     ++++K  + +R ++FPTVS  S+++  + +ELG+  +    RRA+DI 
Sbjct: 68  EFASPFR----LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQ 123

Query: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145
           FP YL ENE RQ  +L ++E REQ L +++  Q V D T
Sbjct: 124 FPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 127/263 (48%), Gaps = 3/263 (1%)

Query: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357
           P A+ + PE ++K  K G++S A+++ + Y++ +HK EM DY +E ++K+  K  EYE +
Sbjct: 376 PVASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDR 434

Query: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXX 417
           L  +  +   + A M   + D   K E+ E +   Q+ D NA  + SK  +  E      
Sbjct: 435 LTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKA 494

Query: 418 XXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNH 477
                   +  K+  ++ E+ +L   ++  + +       +  +T  LDA+L  + + N 
Sbjct: 495 AKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNT 554

Query: 478 KQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQG 537
           +Q ++   I DL Q+K  L +E +A     G+    L  +E  ++L   +L  +   I  
Sbjct: 555 QQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIENKEYLP--KLNAIDTKISE 612

Query: 538 KLDSLAVVKQEISGERLKLIGIT 560
            L SL VVKQE +  + +   ++
Sbjct: 613 LLTSLTVVKQETANHKTEFAAVS 635

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 60/97 (61%), Gaps = 8/97 (8%)

Query: 48  YVSPFRGGQ-LTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106
           Y SPFR  Q L  A K+++Q     KFPTVSA+   +++++ ++G+  +   +RRA+DI 
Sbjct: 41  YNSPFRTSQSLAAAQKRKMQ-----KFPTVSASV--SAHSSSDMGYKVIDAARRRAKDIA 93

Query: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143
            P YL  N++RQR  L  LE++E  L + +  Q ++D
Sbjct: 94  VPRYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVD 130

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 126/258 (48%), Gaps = 3/258 (1%)

Query: 303 DTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLAQVD 362
           + PE ++K  K G+++  +++K+   D+ H   +A Y+++++ KF  K  E  +K+  + 
Sbjct: 346 ENPEHVVKT-KDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 363 DRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXXXXX 422
            +   +  +M   + D  AK EV EN+  ++ F+        K +V  +           
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 423 XXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQDKI 482
              +  K+  +Q E+++L +EK   E++   WT ++  ++ R+DA++  L + N KQ   
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 483 TRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSL 542
             +I  L Q+K ++  +I+ N  +    ++ +   +   +L   +L +V + I   L  L
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLP--KLNEVDNQISVLLGQL 582

Query: 543 AVVKQEISGERLKLIGIT 560
             ++Q  + ER +L  IT
Sbjct: 583 TTIRQHCANERTELSAIT 600

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 4/93 (4%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106
           +YVSPFR  Q   ++    Q +RT++FPT SA S Y +    ELG+ K+   ++RA+DI 
Sbjct: 39  DYVSPFRDEQEVLSA----QRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDIS 94

Query: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQ 139
           FP YL E E +Q  +L++LE +E  L +L+ CQ
Sbjct: 95  FPVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 136/264 (51%), Gaps = 5/264 (1%)

Query: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357
           P AT + PEL+++  + G+VS +V++K+ YD+  H+A++A Y +EQ+ ++  K QEYE+K
Sbjct: 444 PVATPEDPELIVRT-QEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQEYEEK 502

Query: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXX 417
           +  +      + A+M   +L+   K ++ + +K + L ++N    ++K  +  +      
Sbjct: 503 IQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIKN 562

Query: 418 XXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNH 477
                          +Q E+++L L K    K+     + +  +T  LD +   L++   
Sbjct: 563 QTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESLA 622

Query: 478 KQDKITRQIRDLTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQ 536
           K+D+   +I+ L + K  LE EI +A +  + N  + +  ++  ++L    + ++   I 
Sbjct: 623 KKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSK-IESIDNKEYLPK--VNEINTEIS 679

Query: 537 GKLDSLAVVKQEISGERLKLIGIT 560
             L SL +++QEI+ ++++   +T
Sbjct: 680 SLLASLGLIQQEIANQKVEFSSVT 703

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 61/100 (61%), Gaps = 7/100 (7%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQ-RRARDI 105
           EY SPFR  + T+ +++     R +KFPT+S  ++    +  ++G+S VTD   ++A+DI
Sbjct: 60  EYHSPFRTAEETQRARQV----RQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDI 113

Query: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145
           + P  L + E  Q++ L  LEK+E+ L + ++ Q ++D T
Sbjct: 114 IIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLT 153

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 125/264 (47%), Gaps = 5/264 (1%)

Query: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357
           P A+ D PE ++K  K G++S A+++ + Y++ VHK EM  Y +E   K+  K QEYE  
Sbjct: 348 PVASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDH 406

Query: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXX 417
           L  +  +   + A M   +LD   K  +   +   ++ +SNA  +++K  +  E      
Sbjct: 407 LTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNTKNVIFKETENSKA 466

Query: 418 XXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNH 477
                   +  K+  ++ E  +L  +++ A+       + +  +T +LD++   + + N 
Sbjct: 467 AKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELND 526

Query: 478 KQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDS-IQ 536
           +Q +I   I  L Q+K  L A+  A   +    + N+A LE   +      +   DS I 
Sbjct: 527 QQAEIQASIDALEQQKDTLVADATA---ADELHNSNIAILEGISNKDYLPKINALDSQIS 583

Query: 537 GKLDSLAVVKQEISGERLKLIGIT 560
             L SLA+VKQE + +  +   ++
Sbjct: 584 QLLSSLALVKQETANQHTEFAAVS 607

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 58/95 (61%), Gaps = 6/95 (6%)

Query: 48  YVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVF 107
           Y SPFR  Q    S+ + Q ++ ++FPTVSA+S     ++ E+GF  +   ++RA+DI  
Sbjct: 40  YSSPFRTSQ----SQVEAQKRKVQRFPTVSASS--GGNSSAEMGFKVIDAARKRAKDIAV 93

Query: 108 PEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142
           P YL  N++RQR  L  LE++E +L + +  Q ++
Sbjct: 94  PRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIV 128

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 46  EEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDI 105
           ++Y SPFR  Q        L+ ++  ++PT+SATS Y++   ++LG+  +    +RA+DI
Sbjct: 54  KQYKSPFRDTQTPSNMNVALK-KKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDI 112

Query: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142
            FP  L+ENE RQ  +   L ++E  L +LQ+ Q ++
Sbjct: 113 PFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 95/216 (43%), Gaps = 37/216 (17%)

Query: 295 VTNPQATEDTPELLLKLPKYGH----VSAAVFNKVLYDDKVHKAEMADYQREQESKFAKK 350
           V NP+AT   PELL+K  +Y +    +S +V++ V Y+ KVH   + DY  +   K+ +K
Sbjct: 374 VINPKATPKNPELLVKT-RYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEK 432

Query: 351 LQEYEQKLAQVDDRKLSVLAKMND--AKLDKIAKSEV------IENQKIKQLFDSNATF- 401
            +E+   + ++D +  S+   + D  AK+D +    V      IEN   K L   N    
Sbjct: 433 NEEFNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIK 492

Query: 402 -NDSKVKVLHEAXXXXXXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTN 460
            ND    +L  +             +++     Q +   L        KD   W +  + 
Sbjct: 493 KNDEITYILQSSPPTAAISLDTKDAVTK-----QSDCTPLI-------KD---WKSEQSK 537

Query: 461 ITERLDAQLFKLSQFNHKQDKITRQIRDLTQRKTEL 496
           + E++D+++  + Q N       + + D+ Q+ TEL
Sbjct: 538 LNEQIDSKVNVIKQLN-------KNLADVKQKITEL 566

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 68  QRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFPEYLLENEDRQRLILKDLEK 127
           ++ K  P  +  S YN+    ELG+ K    ++ AR+I FP  L ENE RQR IL+DL++
Sbjct: 8   KKRKSSPISNPHSSYNTLKPEELGY-KQKFPKKYAREIHFPAELTENEMRQRAILQDLDE 66

Query: 128 REQTLLHLQRCQSVL 142
           +EQ L HL++ Q V+
Sbjct: 67  KEQHLDHLKKSQRVV 81

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 297 NPQATEDTPELLLKLPKYGHVSAA-------VFNKVLYDDKVHKAEMADYQREQESKFAK 349
           NP AT +TPE ++    Y H++         +F+ +  D   H A +   + +   + A 
Sbjct: 120 NPVATPETPEEVVI---YKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCAT 176

Query: 350 KLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVL 409
           K++EY ++LA +DD+  S  A MN+ +  +    ++ EN+  K        F   K K+ 
Sbjct: 177 KMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIY 236

Query: 410 HEA 412
            E 
Sbjct: 237 KET 239

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 108/219 (49%), Gaps = 1/219 (0%)

Query: 300 ATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQKLA 359
           AT + PE ++ L + G++S  +++++ Y++++H+ ++A   +   +K+    + YE+KLA
Sbjct: 323 ATPEDPEFIV-LTEKGYMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEEKLA 381

Query: 360 QVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAXXXXXXX 419
            +++    V A M+  K     + + IE    + L D  A  ++ K  +L EA       
Sbjct: 382 SLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEKNAK 441

Query: 420 XXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFNHKQ 479
                 I++K T ++ E+  L   +   + +   + + +  +T  LDA+L +L   + +Q
Sbjct: 442 ITEKNTINEKLTQVEPELEALKRLELERKVELQQYQSEVQALTAELDARLGELQNVSDEQ 501

Query: 480 DKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLE 518
            ++   +  L +R+ ++E +I  +     N    L +LE
Sbjct: 502 TEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNLE 540

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 16/98 (16%)

Query: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDD-QRRARDI 105
           EYVSPFR  +    +++   L    KFPT    S             +V D+ +R+A+DI
Sbjct: 56  EYVSPFRDDKAVAEAERIRDL----KFPTTGHHSTV-----------RVKDNVKRKAQDI 100

Query: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143
             P      + +Q+  L +L  +E  L +L+  Q ++D
Sbjct: 101 AEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVD 138

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 4/103 (3%)

Query: 43  AATEEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRR- 101
           A   +Y SPFR   +       ++  +  K+   +  S +N  N   +G+  +  D++  
Sbjct: 34  AHDAKYQSPFRRN-INPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSR 92

Query: 102 --ARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142
             A+DI FP  L ENE+ Q   L +L+ +E  L  L+  Q+++
Sbjct: 93  KIAKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLV 135

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 123/265 (46%), Gaps = 9/265 (3%)

Query: 298 PQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQK 357
           P  T + PE++L L   G++S AV++++  ++K H   + +   +    +    Q YE++
Sbjct: 279 PNGTPEEPEVVL-LTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 358 LAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHE-AXXXX 416
           +A +D     + A +   + +   + + +E    K + D  A  N  K  VLHE A    
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAE-NADKQHVLHEQAEAQR 396

Query: 417 XXXXXXXXFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFN 476
                    I  +   +Q E+++L   K +   +       +  + ++LDAQ  +L    
Sbjct: 397 AEQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVT 456

Query: 477 HKQDKITRQIRDLTQRKTELEAEI-DANQFSKGNADRNLADLETGQHLKSHELVKVTDSI 535
            +Q +++  +  L ++K +LE E+ D+N+F+K    RN   LE          V+  D+ 
Sbjct: 457 DQQAEVSVVLATLQEQKAQLEREVADSNEFTK----RNREALERLNQTDYTATVREIDAK 512

Query: 536 QGK-LDSLAVVKQEISGERLKLIGI 559
             + L  +A ++QEI  +R +L+ +
Sbjct: 513 NSEILTEIAKIRQEIEFQRKELVAL 537

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 20/104 (19%)

Query: 41  GTAATEEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDD-Q 99
           G A+ +EY SPFR       + ++     T KFPT                 + VT++ +
Sbjct: 49  GDASHDEYYSPFRDA----IAVEEAHGSGTLKFPTTG---------------THVTEEAR 89

Query: 100 RRARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLD 143
           RR  DI  P+ L   ++RQR  L++LE +E  L   +  Q ++D
Sbjct: 90  RRVPDIDEPKRLSTVDERQRQQLQELELKEGQLRLYKESQKIVD 133

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 31/51 (60%)

Query: 95  VTDDQRRARDIVFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145
            T +Q + ++ + P +L+EN+ +Q  IL+D+  RE    HL+  Q ++ ++
Sbjct: 277 TTKNQLQNKEKITPNFLIENDSKQHRILQDIITRETNFNHLKNLQKIISQS 327

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 66/138 (47%), Gaps = 11/138 (7%)

Query: 237 NQLVDAQQMALQNEIE-------WRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQR 289
           N L + Q++  Q+E+E        +K  D    PK+Y    ++    P +    +S  Q+
Sbjct: 315 NHLKNLQKIISQSELESQDLTPTMQKIKDSKIYPKVYYKNFNMTK-HPPNINQQLSQNQK 373

Query: 290 LMD--TPVTNPQATEDTPELLLKLP-KYGHVSAAVFNKVLYDDKVHKAEMADYQREQESK 346
           +     P  NP AT   PE+L+KL      ++   ++K+L  ++ H   M +   E  + 
Sbjct: 374 IYPPFNPQLNPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNL 433

Query: 347 FAKKLQEYEQKLAQVDDR 364
           +  K + Y++KL +++++
Sbjct: 434 YNTKFKTYQEKLNKLNEQ 451

>TPHA0I02050 Chr9 complement(458058..458984) [927 bp, 308 aa] {ON}
           Anc_7.115 YIR018W
          Length = 308

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 4/66 (6%)

Query: 650 LLDQEQQAKKELEDMQKERDFAERRAKDESERADQHLEQKVAIEMERKEWAKKIADAEER 709
           L +QE +A+K L++ + +R F ER+    SE AD+    K  I    KEW KK A+   +
Sbjct: 26  LSEQEMKARKLLQNRKAQRAFRERKTSRISELADEVGSLKKTI----KEWEKKYAELNLK 81

Query: 710 ANIATK 715
             IA K
Sbjct: 82  YEIALK 87

>Kwal_27.11568 s27 (852845..854824) [1980 bp, 659 aa] {ON} YDR221W -
           Hypothetical ORF [contig 27] FULL
          Length = 659

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 573 IWNEKLDSNTKFYEDKLGEKDADLDERLKQLDVEHTANLVQVREIYEAKLQD 624
           I N  L+SNT   ++K  E D +L+ RLK       +NL Q +EIY+ +LQ+
Sbjct: 162 ISNNALNSNTSLLQEKKSEID-ELEARLKTC----VSNLAQAKEIYKQRLQN 208

>ZYRO0F11198g Chr6 (917238..917255,917321..917971) [669 bp, 222 aa]
           {ON} similar to uniprot|Q05789 Saccharomyces cerevisiae
           YLR211C Hypothetical ORF
          Length = 222

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 10/122 (8%)

Query: 240 VDAQQMALQNEIEWRKPVDPATQPKLYVDLDSLQLIDPGSTAVGVSTKQRLMDTPVTNPQ 299
           +DA+   L++ IE +KP+  A          SL      +++ G + K R  D+P     
Sbjct: 60  IDARIKELESLIEGQKPISAAAVAAAVAKNGSL------ASSTGSTAKTRGWDSPRNLNS 113

Query: 300 ATEDTPELLLKLPKYGHVSAAVFNKVLY----DDKVHKAEMADYQREQESKFAKKLQEYE 355
           +    P   L    +G + A + N +      +D     E+ +  R+Q  +F K+L  YE
Sbjct: 114 SVMGPPGDPLLASIFGKLQANLVNSICEQFKEEDPHIVGEVENRVRQQLVRFKKELGLYE 173

Query: 356 QK 357
           QK
Sbjct: 174 QK 175

>NCAS0B05330 Chr2 complement(986513..989995) [3483 bp, 1160 aa] {ON}
           Anc_3.126 YOL078W
          Length = 1160

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 496 LEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQGKLDSLAVVKQEISGE 552
           L    +   FSK N+D  + D+  G  L +    ++TDS  GK    ++++ E SG+
Sbjct: 393 LTTNTEKGSFSKHNSDNEMGDIREGNRLTAQATGELTDSSYGK----SLLESEFSGD 445

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,060,700
Number of extensions: 2911364
Number of successful extensions: 17096
Number of sequences better than 10.0: 497
Number of HSP's gapped: 17184
Number of HSP's successfully gapped: 719
Length of query: 757
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 640
Effective length of database: 40,065,477
Effective search space: 25641905280
Effective search space used: 25641905280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)