Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B008003.493ON1821828771e-121
CAGL0L08448g3.493ON1731826034e-80
CAGL0I10494g3.493ON1721835672e-74
Smik_16.4023.493ON1731825472e-71
KNAG0A079503.493ON1821825464e-71
YPR149W (NCE102)3.493ON1731825429e-71
Skud_16.4443.493ON1731825332e-69
KAFR0C019703.493ON1791835245e-68
NDAI0B058803.493ON1821835134e-66
NDAI0G009303.493ON1761835012e-64
NCAS0E008003.493ON1741824985e-64
Suva_16.4783.493ON1661824837e-62
Kpol_1017.63.493ON1871874796e-61
TDEL0D056103.493ON1751824742e-60
TPHA0D032803.493ON1841854691e-59
YGR131W (FHN1)3.493ON1741824622e-58
KAFR0G037003.493ON1861864571e-57
NCAS0F035603.493ON1831564343e-54
Smik_6.2273.493ON1741824273e-53
TBLA0D029603.493ON1891514275e-53
ZYRO0D09966g3.493ON1781834203e-52
KLLA0D16280g3.493ON1691824179e-52
Suva_7.4193.493ON1741414161e-51
TBLA0C044903.493ON1861534128e-51
Skud_7.4423.493ON1741823934e-48
SAKL0F02750g3.493ON1701453891e-47
KLTH0F14850g3.493ON1711833543e-42
Kwal_55.212383.493ON1701823456e-41
Ecym_12363.493ON1691823186e-37
AFR312W3.493ON1681462804e-31
KLLA0B06644g1.350ON27154681.5
Smik_10.1941.343ON84288646.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00800
         (182 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   342   e-121
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   236   4e-80
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   223   2e-74
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   215   2e-71
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   214   4e-71
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   213   9e-71
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   209   2e-69
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   206   5e-68
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   202   4e-66
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   197   2e-64
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   196   5e-64
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   190   7e-62
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   189   6e-61
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   187   2e-60
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   185   1e-59
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   182   2e-58
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   180   1e-57
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   171   3e-54
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   169   3e-53
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   169   5e-53
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   166   3e-52
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   165   9e-52
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   164   1e-51
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   163   8e-51
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   155   4e-48
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   154   1e-47
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   140   3e-42
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   137   6e-41
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   127   6e-37
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   112   4e-31
KLLA0B06644g Chr2 complement(586591..587406) [816 bp, 271 aa] {O...    31   1.5  
Smik_10.194 Chr10 complement(341089..343617) [2529 bp, 842 aa] {...    29   6.8  

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  342 bits (877), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/182 (93%), Positives = 170/182 (93%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKF            PETSGVPSIS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 181 QV 182
           QV
Sbjct: 181 QV 182

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  236 bits (603), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 136/182 (74%), Gaps = 9/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML V DNLLR++NF F+VIC+  IS LI T+  H SRVNYCMFAAAYGIATD LYG+ AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F+E LAWPLILFTLDFLNFAF LTAG VLAVGIRAHSC N  YRE N IIQGSE RCR S
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AFFFFSM IF+AKM+MS +N+ SNGAF T   KF                GVPS+S
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGT---KFIRRRRNNAEV------GVPSVS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  223 bits (567), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 113/183 (61%), Positives = 133/183 (72%), Gaps = 12/183 (6%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML VADNLLR++N  FL+IC+   S+LINT+K H SRVN+C+FAAAYGIATD LYG+ AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERN-HIIQGSENRCRI 119
           F+EPLAWPL+LF LDFLNF FT TAG VLAVGIRAHSC N RY ER   I+QGS  RCR 
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSI 179
           +QA  AFF+FSM IF+AKM+MS +++ SNGAF     +                 GVPSI
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRR-----------KHHTEVGVPSI 169

Query: 180 SQV 182
           SQV
Sbjct: 170 SQV 172

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  215 bits (547), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 111/182 (60%), Positives = 128/182 (70%), Gaps = 9/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML +ADN+LR++NF FLVI +A IS+L+NTQ  H SRVNYCMFA AYGI TD LYG+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F EPLAWPL+LFTLDFLNF FT TAG VLAVGIRAHSC N  Y + N I QGS  RCR +
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AF +FS  IF+AK +MS  N+ SNGAF + S                   GVP+IS
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGS---------FSKRRRTGQVGVPTIS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  214 bits (546), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 114/182 (62%), Positives = 133/182 (73%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML +AD  LRL+NF FLVIC+  IS L+NTQ  H SR+NYCMF AAYGI TD  YG++AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           FWEPL+WPL+L  LDFLNF FTLTAG VLAVGIRAHSCKNV YR +N I+QGSENRCR +
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AFFFFSM IF+AK +MS +N+ +NG F +A S                  GVP+IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 181 QV 182
            V
Sbjct: 181 TV 182

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  213 bits (542), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 127/182 (69%), Gaps = 9/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML +ADN+LR++NF FLVI +  IS+L+NTQ  H SRVNYCMFA AYGI TD LYG+ AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F EPLAWPL+LFTLDFLNF FT TAG VLAVGIRAHSC N  Y + N I QGS  RCR +
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AF +FS  IF+AK +MS  N+ SNGAF + S                   GVP+IS
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS---------FSKRRRTGQVGVPTIS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  209 bits (533), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 109/182 (59%), Positives = 128/182 (70%), Gaps = 9/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML  ADN+LR++NF FLVI +  IS+L+NTQ  + SRVN+CMFAAAYGI TD LYG+ AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F+EPLAWPL+LFTLDFLNF FT TAG VLAVGIRAHSC N  Y + N I QGS  RCR +
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AF +FS  IF+AK +MS  N+ SNGAF + S                   GVP+IS
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS---------FSKRRRTGQVGVPTIS 171

Query: 181 QV 182
           QV
Sbjct: 172 QV 173

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  206 bits (524), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 130/183 (71%), Gaps = 5/183 (2%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQK-FHISRVNYCMFAAAYGIATDGLYGLLA 59
           MLGVADN+LRL+N  FL+I +A  S LINTQ   H SRVNYCMFA A+G+  D +YG+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
           NF++ LAWPL+LFTLDFLNFAFT +A   LAVGIRAHSC N  Y + N I++GS  RCR 
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSI 179
           +QA  AF +FS  IFIAKM+MS INL  NGAF++ SS+F             +  GVP+I
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRF----ISRRKKHATDVGGVPNI 176

Query: 180 SQV 182
           SQV
Sbjct: 177 SQV 179

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  202 bits (513), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 104/183 (56%), Positives = 130/183 (71%), Gaps = 2/183 (1%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML   DN+LR++N  FLV+ +AFIS L+NTQ+ + SR+N+CMFAAA+G+ TD  +G+  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FWEPLA-WPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
            ++ LA WP++LF  DFLNF FT TAG VLAV IRAHSCKN RY   N I QGSENRCR+
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSI 179
           SQAA AFF+FS  IF+AKM+MSGIN+ASNG F + +                E  GVP+I
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEV-GVPTI 179

Query: 180 SQV 182
           SQV
Sbjct: 180 SQV 182

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  197 bits (501), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 126/183 (68%), Gaps = 8/183 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML VADNLLRLLN  FLVIC+   S L+NTQ+ H SR+NYCMF   Y + TD  +G+LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F+E L++P ILFTLDFLNF+FT  AG VLA GIR+HSC N  Y +RN I QGS NRCR S
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFT-TASSKFXXXXXXXXXXXXPETSGVPSI 179
           QA  AFF+FSM IF+ K+ MS I++  NGAF+ T +S+                 GVPSI
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSR-------RRRRNGAAEVGVPSI 173

Query: 180 SQV 182
           SQV
Sbjct: 174 SQV 176

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  196 bits (498), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 122/182 (67%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           MLGVADNLLR+LN  FLVIC+   S L+NT+  + SR+NYCMF  AY + TD +YG+ AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F++ LA P + F LDFLNFAFT  AG VLA GIRAHSCK+  Y   N I QG +NRCR S
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QA  AFF+FSM IF+AK++MS IN+  NGAFT    +                 GVPSIS
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGR--------RRRRNAAEIGVPSIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  190 bits (483), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 120/182 (65%), Gaps = 16/182 (8%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML   DN+LR++NF FLVI +  IS+L+NTQ  + SR+NYCMFA AY I TD LYG+ AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F+EPLAWPLILF+LDFLNF FT TA       IRAHSC+N  Y   N I QGS NRCR +
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AF +FS  IF+AK +MS  N+ SNGAF + S                   GVP+IS
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS---------FSKRRRTGQVGVPTIS 164

Query: 181 QV 182
           QV
Sbjct: 165 QV 166

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  189 bits (479), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 102/187 (54%), Positives = 124/187 (66%), Gaps = 5/187 (2%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML +ADN++R +NFCF VIC+  I +L+ T+K H SRVNYCMF   + + TD  YG+LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FWE-PLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
            W  P AWP+ILF  DFLNFAFT TAG VL+VGIR HSCKN  Y + N IIQGS +RCR 
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETS----G 175
           +QA+ AFF+FS  IF  K+VMS INL SNGA   ++               P  S    G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 176 VPSISQV 182
           VP+ISQV
Sbjct: 181 VPNISQV 187

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  187 bits (474), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 125/182 (68%), Gaps = 7/182 (3%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML + DN LRL+NF FLVI L  +  LI+++  H SRVN+CMFAAA+GI TD  YG+LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
            WE  AWP+ILF LDFLNFAFT +A   LAVGIR HSCKN  Y + N+I QGS  RCR++
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QA+ AFF+FS  IF+AKM+MS I + +NG F++ ++                  GVP+IS
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTT-------LTSRRRKSAQVGVPTIS 173

Query: 181 QV 182
           QV
Sbjct: 174 QV 175

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  185 bits (469), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 103/185 (55%), Positives = 126/185 (68%), Gaps = 4/185 (2%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           MLG+ADN+LR +NFCF VICL  + +L+ TQ  H SRVNYC+F   + + TD  YG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FWE-PLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
            W  PLAWP+ILF  DFLNFAFT TAG VLAVG R HSC N  Y + N+I QGS +RCR 
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTAS--SKFXXXXXXXXXXXXPETSGVP 177
           +QAATAFF+FS  IF+AK++MS INL +NGA  + S   +             P+  GVP
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQI-GVP 179

Query: 178 SISQV 182
           +ISQV
Sbjct: 180 NISQV 184

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  182 bits (462), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 115/182 (63%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML  ADNL+R++N  FL+I +  IS LI TQ  H SRVN+CMFAA YG+ TD LYG LAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           FW  L +P IL  LDFLNF FT  A   LAVGIR HSCKN  Y E+N IIQGS +RC  S
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AFF+FS  +F+ K+ ++ + +  NG F + +                   G+P+IS
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTG--------FSRRRARRQMGIPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  180 bits (457), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 106/186 (56%), Positives = 130/186 (69%), Gaps = 4/186 (2%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHIS-RVNYCMFAAAYGIATDGLYGLLA 59
           ML +ADN LRL+NFCF+VI +AFI+ L+NT++ H S RVNYCMFA A+GI TD +YGL A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
           NF+E LAWP+ILF  DFLNF F  TAG VLAVGIRAH+C N  YR  N I++GSE RCR+
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXX--PETS-GV 176
           +QAA AFF+FSM IF+ K V S +   S G F + SS                P TS GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 177 PSISQV 182
           P++S+V
Sbjct: 181 PTVSEV 186

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  171 bits (434), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 96/156 (61%), Positives = 116/156 (74%), Gaps = 1/156 (0%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML   DN LR  N  FLV+ +AFISTL++TQ    SRVNYCMFAAA+G+ TD  +G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FWEPLA-WPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
             + L+ WP+ILF  DFLNF FT TAG VLAVGIR HSC N RY E N IIQGS  RCR+
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTAS 155
           SQAA AFF+F+  +F+AKM+MS I++ASNGAF + S
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGS 156

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  169 bits (427), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 109/182 (59%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML  ADNL+R++N  FL+I +  IS LI+TQ  H SRVN+CMF AAYG+ TD LYG LAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           FW  L +P IL  LD LNF FT  A   LAVGIR HSCKN  Y E+N I Q S +RC  S
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AFF+FS  +F+ K+ ++        A  T  +                  GVP+IS
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVT--------AAGTIQNGGFGFNSGFGRRRARRQLGVPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  169 bits (427), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 83/151 (54%), Positives = 104/151 (68%), Gaps = 2/151 (1%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQK-FHISRVNYCMFAAAYGIATDGLYGLLA 59
           ML + DN+ R+ NFCF VI    I  L+NT+   H SRVNYCMF  A+G+ +D  YG+LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NF-WEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCR 118
           N   EP A+P ILF  DFLNF FT TAG VLAVGIR HSC N  YR  N+IIQGSE RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 ISQAATAFFFFSMGIFIAKMVMSGINLASNG 149
            +QA  AFF+FSM +F+ K++++ +   + G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGG 151

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  166 bits (420), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 120/183 (65%), Gaps = 6/183 (3%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA 59
           ML + DN+LR +NFCF VI L  +  LI ++K  H SRVN+CMFAAA+GI  D  YG+LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
           N + P A+P+ILF LDFLNF FT TA   LAVGIR HSC N  Y + N I QGS +RCR 
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSI 179
           +QA  AFF+F+  IF+ KMVMS ++L SNGAF ++S                   GVP+I
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGF-----SSRRRRTQQANVGVPTI 175

Query: 180 SQV 182
           SQV
Sbjct: 176 SQV 178

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  165 bits (417), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 85/182 (46%), Positives = 114/182 (62%), Gaps = 13/182 (7%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML + DN LR +NF FL+I L  +  LI TQ    SRVN+ +FAA +GI  D LY L+AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F   LAWP+IL +LDFLN+ FT +A   LAVGIR  SC N  +   N I +GS++RCR +
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QA+T F +FS  IF+ K ++S +N  ++GAF T+S++                 GVP+IS
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSNR-------------KTQVGVPTIS 167

Query: 181 QV 182
           QV
Sbjct: 168 QV 169

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  164 bits (416), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 101/141 (71%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML VADN++R++N  FL+I +  +S LI++Q  H SRVN+CMFAAAYG+ TD  YG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
            W  L +P+I+F LDFLNF FT  AG  LAVGIR HSC N  Y + N I QGS +RC  +
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAATAFFFFSMGIFIAKMVMS 141
           +AA  FF+FS  +F+ K+V+S
Sbjct: 121 KAAVVFFYFSCILFLIKVVVS 141

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  163 bits (412), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 79/153 (51%), Positives = 103/153 (67%), Gaps = 2/153 (1%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA 59
           ML    N+LR++NFCFLVI    I  LI ++K  H  RVNYCMFAA + + TD  Y + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFW-EPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCR 118
           NFW  P AWP++L++ DFLNF FT TAG VL+VGIR HSC N  Y   N I QGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 ISQAATAFFFFSMGIFIAKMVMSGINLASNGAF 151
           ++QA+ AF++FS  I++ ++V S + +  NG F
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLF 153

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  155 bits (393), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 111/182 (60%), Gaps = 8/182 (4%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML  ADNL+R+++  FL+I +  I  L+ TQ    SRVN+CMFAAAYG+ TD  YG LAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           FW  L +P IL  LDFLNF FT  A   LAVGIR HSCKN  Y E+N+I QGS +RC  S
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QAA AFF+FS  +F+ K+ +S   +  NG F   +                   GVP+IS
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTG--------YGRRRARRQMGVPTIS 172

Query: 181 QV 182
           QV
Sbjct: 173 QV 174

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  154 bits (389), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 95/145 (65%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML + DN LRL+NF FLVI L    +LI TQ  H  RVN+ +F AA+ + TD  Y + AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
            +   AWP++L T DFLNF FT +A   LAVGIR HSC N  Y   N+I QGS +RCR +
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINL 145
           QA  AF +FS  IF+ K+V+S IN+
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINV 145

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  140 bits (354), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 86/183 (46%), Positives = 109/183 (59%), Gaps = 13/183 (7%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHIS-RVNYCMFAAAYGIATDGLYGLLA 59
           ML + DN LR LNF FLVI L    +L  T K H + +VN+ +F AA+G+  D LY + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRI 119
           NF   LAWPL++   DFLNF FT  A   LAV IR HSC N  Y + N + QGS +RCR 
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSI 179
           +QA+ AF +FS  IF+AK+ +S +NL S GAF   SS+                 GVP+I
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGAGSSR------------RTGNVGVPTI 168

Query: 180 SQV 182
           SQV
Sbjct: 169 SQV 171

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  137 bits (345), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 109/182 (59%), Gaps = 12/182 (6%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML + DN LR  NF FL+I L    +L  T+  +  +VN+ +FAAA+G+  D LY + AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F   LAWPL++   DFLNF FT  A   LAV IR HSC N  Y + N + QGS +RCR +
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QA+ AF +F+  +F+ K+ +S +N+ S GAF+T+S +                 GVP+IS
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSGR------------KSANVGVPTIS 168

Query: 181 QV 182
           QV
Sbjct: 169 QV 170

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  127 bits (318), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 103/182 (56%), Gaps = 13/182 (7%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML + DN LR  NF FL+I LA   +LIN Q    SRVN+ +F A + +  D LY +LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F   LAWP++L T D LN  FT  A   L   I  HSC N  +   N I +G E RCR  
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFXXXXXXXXXXXXPETSGVPSIS 180
           QA++ F FFS  IF+AK V+SG+N+ S GAF++ S +                 GVP+IS
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSGR-------------KTGGGVPTIS 167

Query: 181 QV 182
           QV
Sbjct: 168 QV 169

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  112 bits (280), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/146 (44%), Positives = 87/146 (59%)

Query: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60
           ML + DN LR +NF FL+I L    +LI+ Q+   SRVN+ +F A + + TD  Y ++AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120
           F    AWP+I   LD LN  FT  A   L   I AHSC N  + + N I + S +RCR  
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QAATAFFFFSMGIFIAKMVMSGINLA 146
           QA++ F FFS  IF+AK V SG+N+ 
Sbjct: 121 QASSTFLFFSFFIFLAKAVFSGLNIF 146

>KLLA0B06644g Chr2 complement(586591..587406) [816 bp, 271 aa] {ON}
           similar to uniprot|P43605 Saccharomyces cerevisiae
           YFR027W ECO1 Acetyltransferase required for the
           establishment of sister chromatid cohesion during DNA
           replication but not for its maintenance during G2 and M
           phases also required for postreplicative double-strand
           break repair interacts with Chl1p
          Length = 271

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 9/54 (16%)

Query: 22  AFISTLINTQKFHISRVNYCMFAAAYGIAT--------DGLYGLLANFWEPLAW 67
           A +  ++   K  ISR+  C     +GIAT          +YG + N WE LAW
Sbjct: 189 AIVPNVVPDVKLGISRIWVCRNQRQHGIATRLLEVARKKSIYGCIVNKWE-LAW 241

>Smik_10.194 Chr10 complement(341089..343617) [2529 bp, 842 aa] {ON}
           YJL047C (REAL)
          Length = 842

 Score = 29.3 bits (64), Expect = 6.8,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 34/88 (38%), Gaps = 3/88 (3%)

Query: 46  AYGIATDGLYGLLANFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRE 105
           A  I+T  LY L  N   P    +I    +F NF  + T  +     I+   C N +   
Sbjct: 20  ANTISTSSLYHLFNNEKNPKYQKMIAELHEFFNFTLSETISV---TDIKELECDNEKVAT 76

Query: 106 RNHIIQGSENRCRISQAATAFFFFSMGI 133
              I+    N CR       +  F++G+
Sbjct: 77  FRRIMPRMLNNCRELTQRKTYISFNLGL 104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,792,631
Number of extensions: 508250
Number of successful extensions: 1404
Number of sequences better than 10.0: 43
Number of HSP's gapped: 1408
Number of HSP's successfully gapped: 43
Length of query: 182
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 79
Effective length of database: 41,670,801
Effective search space: 3291993279
Effective search space used: 3291993279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)