Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B007903.494ON28428413780.0
KAFR0C019803.494ON28328311721e-163
Suva_7.4203.494ON28728311381e-158
Smik_6.2283.494ON28728311371e-158
NCAS0E007903.494ON32728311351e-157
SAKL0F02728g3.494ON28228411261e-156
YGR132C (PHB1)3.494ON28728311181e-155
CAGL0I10472g3.494ON28828011171e-155
NDAI0G009203.494ON29628411161e-154
TDEL0D056203.494ON27928211061e-153
Skud_7.4433.494ON28728311031e-152
Kpol_1017.53.494ON28328411001e-152
KLTH0F14872g3.494ON28028410991e-152
TPHA0D032903.494ON28528310931e-151
TBLA0D029503.494ON28227710731e-148
ZYRO0D09900g3.494ON28328310601e-146
Kwal_55.212403.494ON28326710551e-145
Ecym_12353.494ON28328410181e-140
AFR313C3.494ON2832879791e-134
KLLA0D16302g3.494ON2262129211e-126
SAKL0G15510g5.98ON3082366787e-88
NDAI0D025305.98ON3162366641e-85
TBLA0H022205.98ON3072316631e-85
KLLA0E15731g5.98ON3082346596e-85
Kpol_1050.615.98ON3102316588e-85
ADL141W5.98ON3072316588e-85
Kwal_27.127475.98ON3072376571e-84
YGR231C (PHB2)5.98ON3102316571e-84
KLTH0C01672g5.98ON3072336543e-84
KAFR0B042505.98ON3102316543e-84
KNAG0A015805.98ON2882316515e-84
NCAS0F006005.98ON3132316536e-84
Smik_16.755.98ON3102316483e-83
ZYRO0B15136g5.98ON3102316483e-83
Skud_7.5655.98ON3102316474e-83
Suva_7.5235.98ON3102336474e-83
CAGL0L06490g5.98ON3132516474e-83
TPHA0A050905.98ON3102316465e-83
TDEL0G012105.98ON3092316432e-82
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00790
         (284 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   535   0.0  
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   456   e-163
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   442   e-158
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   442   e-158
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     441   e-157
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   438   e-156
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   435   e-155
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   434   e-155
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     434   e-154
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   430   e-153
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   429   e-152
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   428   e-152
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   427   e-152
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   425   e-151
TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   417   e-148
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   412   e-146
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   410   e-145
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   396   e-140
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   381   e-134
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   359   e-126
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   265   7e-88
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   260   1e-85
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   259   1e-85
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   258   6e-85
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   258   8e-85
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   258   8e-85
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   257   1e-84
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   257   1e-84
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   256   3e-84
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   256   3e-84
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   255   5e-84
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   256   6e-84
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   254   3e-83
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   254   3e-83
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   253   4e-83
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   253   4e-83
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   253   4e-83
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   253   5e-83
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   252   2e-82

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/284 (94%), Positives = 267/284 (94%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL
Sbjct: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS
Sbjct: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVEKAEQMRQASVIR                 VGDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRL 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR
Sbjct: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  456 bits (1172), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/283 (78%), Positives = 249/283 (87%), Gaps = 2/283 (0%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           ++AINV++K+AIP+GLL+ A DY+MYDVKGGSRGVIFDR+SGV++ V+GEGTHFLVPWLQ
Sbjct: 3   TRAINVVTKLAIPSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQ 62

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KAIIYDVR+KPKSI+TNTGTKDLQMVSLTLR+LHRP V+ELPRIYQ+LGLDYDERVLPSI
Sbjct: 63  KAIIYDVRTKPKSISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLKSIVAQFDAAELITQRE+VSQRIR+E+S RA EFGI+LEDVSITHMTFGAEFTKA
Sbjct: 123 GNEVLKSIVAQFDAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERA+FLVEKAEQ RQASVIR                 VGDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLE 242

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IARTLS+SSN+TYLP  G  G+ G E    N+LLLNIGR
Sbjct: 243 ASKDIARTLSKSSNITYLP--GGKGREGDEKTPPNSLLLNIGR 283

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  442 bits (1138), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/283 (75%), Positives = 244/283 (86%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           S+ I++++K+A+P GL+     Y+MYDVKGGSRGVIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 5   SRFIDIITKVALPIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KAIIYDVR+KPKSIATNTGT+DLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLKSIVAQFDAAELITQRE++SQ+IR+ELSTRA EFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERAKF+VEKAEQ RQASVIR                 VGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IA+TL+ SSNV YLPS  AG  +    GS N+LLLNIGR
Sbjct: 245 ASKDIAQTLANSSNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  442 bits (1137), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/283 (75%), Positives = 244/283 (86%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           S+ I++++K+A+P G++     Y+MYDVKGGSRGVIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 5   SRLIDIITKVALPIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KAIIYDVR+KPKSIATNTGT+DLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLKSIVAQFDAAELITQRE++SQ+IR+ELSTRA EFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ RQASVIR                 VGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IA+TL+ SSNV YLPS  +G  +    GS N+LLLNIGR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  441 bits (1135), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 216/283 (76%), Positives = 243/283 (85%), Gaps = 2/283 (0%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           +K +NV++++A+P G+L    +Y+MYDVKGGSRGVIFDR+SGVQ+RV+GEGTHFLVPWLQ
Sbjct: 47  TKLLNVITRVALPLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQ 106

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KA+IYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP + ELP+IYQ+LGLDYDE+VLPSI
Sbjct: 107 KAVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSI 166

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLKSIVAQFDAAELITQRE+VSQRI+ ELSTRA EFGIRLEDVSITHMTFG EFTKA
Sbjct: 167 GNEVLKSIVAQFDAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKA 226

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ RQASVIR                 VGDGLLLIRRLE
Sbjct: 227 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLE 286

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IA+TL+ S N+TYLP  G  G  G + GS N+LLLNIGR
Sbjct: 287 ASKDIAQTLANSPNITYLP--GQQGGRGNDSGSPNSLLLNIGR 327

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  438 bits (1126), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 242/284 (85%), Gaps = 2/284 (0%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MSK  + L+++A+P G+   A  Y+MYDVKGG+R VIFDR+SGVQQ+V+GEGTHFLVPWL
Sbjct: 1   MSKLADSLARIALPIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           Q+AI+YDVR+KPK+IATNTGTKDLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPS
Sbjct: 61  QRAIVYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR+ELS RA EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVE+AEQ RQA+VIR                  GDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRL 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           EASKEIA+TL+ SSNVTYLPS GAGG    + GS N+LLLN+GR
Sbjct: 241 EASKEIAQTLANSSNVTYLPSNGAGG--AEQQGSPNSLLLNLGR 282

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  435 bits (1118), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 217/283 (76%), Positives = 245/283 (86%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           +K I+V++K+A+P G++     Y+MYDVKGGSRGVIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 5   AKLIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KAIIYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLKSIVAQFDAAELITQRE++SQ+IR+ELSTRA EFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ RQASVIR                 VGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IA+TL+ SSNV YLPS  +GG +    GS N+LLLNIGR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  434 bits (1117), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/280 (76%), Positives = 239/280 (85%), Gaps = 1/280 (0%)

Query: 5   INVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAI 64
           + +++K+AIP G+ +    Y+MYDV+GGSRGVIFDR+ GV+  VVGEGTHFLVPWLQKAI
Sbjct: 9   VRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAI 68

Query: 65  IYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNE 124
           IYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP+VM+LP IYQ+LGLDYDERVLPSIGNE
Sbjct: 69  IYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNE 128

Query: 125 VLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQ 184
           VLKSIVAQFDAAELITQRE+VSQ+IR+ELS RA EFGIRLEDVSITHMTFG EFTKAVEQ
Sbjct: 129 VLKSIVAQFDAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQ 188

Query: 185 KQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASK 244
           KQIAQQDAERA+FLVEKAEQ RQASVIR                 VGDGLLLIRRLEASK
Sbjct: 189 KQIAQQDAERARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASK 248

Query: 245 EIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           EIA+TL+ S+N+TYLPS  AGG    + GS NTLLLN+GR
Sbjct: 249 EIAQTLANSNNITYLPSNHAGGDKD-DKGSPNTLLLNLGR 287

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  434 bits (1116), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 237/284 (83%), Gaps = 2/284 (0%)

Query: 3   KAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQK 62
           K  N+L+K+A+P GLL+   DY+MYDVKGGSRGVIFDR+SGV+  VVGEGTHFLVPWLQK
Sbjct: 13  KFFNLLTKVALPIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQK 72

Query: 63  AIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIG 122
           A+IYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP V ELP+IYQ+LGLDYDE+VLPSIG
Sbjct: 73  AVIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIG 132

Query: 123 NEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAV 182
           NEVLKSIVAQFDAAELITQRE+VSQRI+ ELS RA EFG+RLEDVSITHMTFG EFTKAV
Sbjct: 133 NEVLKSIVAQFDAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAV 192

Query: 183 EQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEA 242
           EQKQIAQQDAERAKFLVEKAEQ RQASVIR                 VGDGLLLIRRLEA
Sbjct: 193 EQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEA 252

Query: 243 SKEIARTLSRSSNVTYLPSAGAGGKHGREDG--SGNTLLLNIGR 284
           SK+IA+TL+ S NVTYLP        G + G  S N+LLLNIGR
Sbjct: 253 SKDIAQTLANSPNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  430 bits (1106), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/282 (74%), Positives = 240/282 (85%), Gaps = 4/282 (1%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MS+ +  L+++AIP G+++    Y+MYDV+GGSR VIFDR+SGVQ++VVGEGTHFLVPWL
Sbjct: 1   MSRLVENLARVAIPLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QKAI+YD+R+KPK IATNTGTKD+QMVSLTLRVLHRP+V++LPRIYQ+LGLDYDERVLPS
Sbjct: 61  QKAIVYDIRTKPKGIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR ELS RA EFGIRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           AVEQKQIAQQDAERAKFLVEKAEQ+R+ASVIR                  GDGLLLIRRL
Sbjct: 181 AVEQKQIAQQDAERAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRL 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNI 282
           EASKEIA+TL+ SSN+TYLP    G  HG  +GS N+LLLNI
Sbjct: 241 EASKEIAQTLAASSNITYLP----GKAHGNTEGSQNSLLLNI 278

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  429 bits (1103), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 216/283 (76%), Positives = 243/283 (85%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           S+ I+V++K+A+P G++     Y MYDVKGGSRGVIFDR++GV+Q+VVGEGTHFLVPWLQ
Sbjct: 5   SRLIDVITKVALPIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQ 64

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KAIIYDVR+KPKSIATNTGT+DLQMVSLTLRVLHRPEV++LP IYQ+LGLDYDERVLPSI
Sbjct: 65  KAIIYDVRTKPKSIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSI 124

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLKSIVAQFDAAELITQRE++SQ+IR+ELSTRA EFGI+LEDVSITHMTFG EFTKA
Sbjct: 125 GNEVLKSIVAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKA 184

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVEKAEQ RQASVIR                 VGDGLLLIRRLE
Sbjct: 185 VEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLE 244

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IA+TL+ SSNV YLPS  +G   G   GS N+LLLNIGR
Sbjct: 245 ASKDIAQTLANSSNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  428 bits (1100), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 238/284 (83%), Gaps = 1/284 (0%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MSK I+ ++K+A+P G+++    ++MYDVKGGSR VIFDR+SGV+Q ++GEGTHFL+PWL
Sbjct: 1   MSKIIDTVAKVALPIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QKAIIYDVR+KPKSIATNTGTKDLQMVSLTLRVLHRP+V++LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           I NEVLK+IVAQFDAAELITQREVVS RIR EL  R+ EFGIRLEDVSITHMTFG EFTK
Sbjct: 121 ISNEVLKAIVAQFDAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           AVE KQIAQQDAERAKFLVEKAEQ RQA+VIR                  GDGLLLIRRL
Sbjct: 181 AVELKQIAQQDAERAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRL 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           EASKEIA TLS+SSNVTYLP+ G G   G  DG+ NTLLLN+GR
Sbjct: 241 EASKEIAATLSQSSNVTYLPN-GHGNARGGSDGTPNTLLLNLGR 283

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  427 bits (1099), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 238/284 (83%), Gaps = 4/284 (1%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MS+  + L+K+A+P GL   A  Y+MYDVKGGSR VIFDR+SGVQQ+VVGEGTHFLVPWL
Sbjct: 1   MSRLADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QKA++YDVR+KPK+IATNTGTKDLQMVSLTLRVLHRP+VM+LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAVLYDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLK+IVAQFDAAELITQRE VSQRIR+ELS RA EF IRLEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           AVEQKQIAQQDAERA+++VE AEQ RQASVIR                  GDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           EASKEIA+TL+ SSNVTYLPS+ +      E GS N+LLLN+GR
Sbjct: 241 EASKEIAKTLANSSNVTYLPSSHSAS----EQGSPNSLLLNLGR 280

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  425 bits (1093), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 205/283 (72%), Positives = 236/283 (83%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           +K ++ L K+A+P G+ +    YAMYDVKGGSR VIFDR+SGV+Q+V+GEGTHFL PWLQ
Sbjct: 3   TKVLDRLIKIAVPLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQ 62

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KAI++DVR+KPKSIATNTGTKDLQMVSLTLRVLHRP+V +LP IYQ+LGLDYDERVLPSI
Sbjct: 63  KAIVFDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLK+IVAQFDAAELITQRE+VS +IR ELS R+ EFGI+LEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVAQFDAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VEQKQIAQQDAERAKFLVE+AEQ RQA+VIR                  GDGLLLIRRLE
Sbjct: 183 VEQKQIAQQDAERAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASKEIA+TLS+SSNVTYLPS  +   +    G+ N+LLLN+GR
Sbjct: 243 ASKEIAKTLSQSSNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  417 bits (1073), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 204/277 (73%), Positives = 232/277 (83%), Gaps = 4/277 (1%)

Query: 8   LSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYD 67
           L+K+AIP G+ +   DY+MYDVKGGSR VIFDR+ GV+Q VVGEGTHFLVPWLQK++I+D
Sbjct: 10  LAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFD 69

Query: 68  VRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLK 127
           +R+KPK+I TNTGT+DLQMVSLTLR+LHRP++++LP IYQ+LGLDYDERVLPSIGNEVLK
Sbjct: 70  IRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLK 129

Query: 128 SIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQI 187
           SIVAQFDAAELITQRE+VSQRIR+EL+ RA EFGIRLEDVSITHMTFG EFTKAVEQKQI
Sbjct: 130 SIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQI 189

Query: 188 AQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIA 247
           AQQDAERAKFLVEKAEQ RQASVIR                  GDGLLLIRRLE SKEIA
Sbjct: 190 AQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIA 249

Query: 248 RTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
            TL+ S +VTYLP    GG +  ED S N+LLLN+GR
Sbjct: 250 ETLAGSPHVTYLP----GGGNQAEDASKNSLLLNLGR 282

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  412 bits (1060), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 203/283 (71%), Positives = 234/283 (82%), Gaps = 3/283 (1%)

Query: 2   SKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQ 61
           S+    ++K+AIP G++     Y+MYDV+GGSR VIFDR+SGVQQ VVGEGTHFLVPWLQ
Sbjct: 3   SRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQ 62

Query: 62  KAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSI 121
           KA+IYDVR+KPKSIATNTGTKD+QMVSLTLRVLHRP+V++LP IYQ+LGLDYDERVLPSI
Sbjct: 63  KAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSI 122

Query: 122 GNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKA 181
           GNEVLK+IVA++DAAELITQRE+VS  IR ELS RA EF IRLEDVSITHMTFG EFTKA
Sbjct: 123 GNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKA 182

Query: 182 VEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLE 241
           VE KQIAQQDAERAKFLVEKAEQ+R+ SVIR                  GDGLLLIRRLE
Sbjct: 183 VELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLE 242

Query: 242 ASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           ASK+IA+TL+ SSNVTYLPS  +GG    ++G+  +LLLN+GR
Sbjct: 243 ASKDIAQTLANSSNVTYLPSQQSGGG---QEGTSQSLLLNLGR 282

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  410 bits (1055), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/267 (75%), Positives = 226/267 (84%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MS+  + L+K+A+P GL   A  Y+MYDVKGGSR VIFDR+SGVQQ+VVGEGTHFL+PWL
Sbjct: 1   MSRFADSLAKIALPLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QKA+++DVR+KPK+IATNTGTKDLQMVSLTLRVLHRP+VM+LP IYQ+LGLDYDERVLPS
Sbjct: 61  QKAVLFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLKSIVAQFDAAELITQRE VSQRIR+ELS RA EF IRLEDVSITHMTFG +FTK
Sbjct: 121 IGNEVLKSIVAQFDAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           AVEQKQIAQQDAERA+F+VE AEQ RQASVIR                  GDGLLLIRR+
Sbjct: 181 AVEQKQIAQQDAERARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRI 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGK 267
           EASKEIA+TL+ SSNVTYLPS   G +
Sbjct: 241 EASKEIAKTLANSSNVTYLPSNQQGAE 267

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  396 bits (1018), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/284 (66%), Positives = 235/284 (82%), Gaps = 1/284 (0%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MS+ +  ++ +A+P G+ I AA   +YDV+GG+R VIFDR+SGVQQ+VVGEGTHFL+PWL
Sbjct: 1   MSRFLENIANIAVPIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QKA+IYDVR+KPK+IATNTGTKDLQ+V+LTLRVLHRP+V+ LP+IYQ LGLDYDERVLPS
Sbjct: 61  QKAVIYDVRTKPKNIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQ+IR+EL+ RA  F I+LEDV+ITHM FG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRL 240
           +VE+KQIAQQ++ERAK+LV+ AEQ R A+VIR                  GDGLL+IRRL
Sbjct: 181 SVEKKQIAQQESERAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRL 240

Query: 241 EASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           EASK+IA+TL+ SSN+TYLPS+  GG H    G+ ++LLLN+GR
Sbjct: 241 EASKKIAQTLAGSSNITYLPSSSKGGSHD-ACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  381 bits (979), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/287 (65%), Positives = 227/287 (79%), Gaps = 7/287 (2%)

Query: 1   MSKAINVLSKMAIP---AGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLV 57
           MS+  + L ++ +P     L   A  ++MYDV+GG+R +IFDR+SGV+  VVGEGTHFL+
Sbjct: 1   MSRLADSLVRLTLPLTPIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLI 60

Query: 58  PWLQKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERV 117
           PWLQKAII+DVR+KP++IATNTGTKDLQMVSLTLRVLHRP+VM L RIY+ LG DYDERV
Sbjct: 61  PWLQKAIIFDVRTKPRNIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERV 120

Query: 118 LPSIGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAE 177
           LPSIGNEVLK+IVAQF+A+ELITQRE+VSQ+IR EL+ RA EF IRLEDVSITHMTFG E
Sbjct: 121 LPSIGNEVLKAIVAQFNASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQE 180

Query: 178 FTKAVEQKQIAQQDAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLI 237
           FTKAVEQKQIAQQ+++RAKF+VE+AEQ R+A+VIR                  GDGLL+I
Sbjct: 181 FTKAVEQKQIAQQESDRAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMI 240

Query: 238 RRLEASKEIARTLSRSSNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284
           RRLEASK IA TL+ S NVTYLPS G       + G+ N+LLLN+GR
Sbjct: 241 RRLEASKGIAETLANSPNVTYLPSKGQAA----DSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  359 bits (921), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 195/212 (91%)

Query: 1   MSKAINVLSKMAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWL 60
           MS+  +V++++AIP GL + A  Y+MYDV+GG R VIFDR+ GVQQ V+GEGTHFLVPWL
Sbjct: 1   MSRVADVMARIAIPVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWL 60

Query: 61  QKAIIYDVRSKPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPS 120
           QK+I++DVR+KPK+IATNTGTKDLQMVSLTLRVLHRP+VM+LP+IYQ+LG+DYDERVLPS
Sbjct: 61  QKSILFDVRTKPKNIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPS 120

Query: 121 IGNEVLKSIVAQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTK 180
           IGNEVLK+IVAQFDAAELITQRE+VSQRIR ELS RA EF I+LEDVSITHMTFG EFTK
Sbjct: 121 IGNEVLKAIVAQFDAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTK 180

Query: 181 AVEQKQIAQQDAERAKFLVEKAEQMRQASVIR 212
           AVEQKQIAQQDAERA+FLVEKAEQ R+A+VIR
Sbjct: 181 AVEQKQIAQQDAERARFLVEKAEQERKAAVIR 212

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  265 bits (678), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 172/236 (72%), Gaps = 1/236 (0%)

Query: 20  MAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNT 79
           M  + A+++V GG R +++ RV G+QQR+  EGTHF VPWL+  I+YDVR+KP+++A+ T
Sbjct: 53  MLVNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLT 112

Query: 80  GTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELI 139
           GTKDLQMV++T RVL RPEV +LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LI
Sbjct: 113 GTKDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLI 172

Query: 140 TQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLV 199
           TQRE VS+ IR  L  RA +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V
Sbjct: 173 TQRERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVV 232

Query: 200 EKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
           +KA Q +Q  V++                   D + L +RL+ ++EIA  LS+S N
Sbjct: 233 DKARQEKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPN 287

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  260 bits (664), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 169/236 (71%), Gaps = 1/236 (0%)

Query: 20  MAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNT 79
           M  + A+++V GG R +++ R+SGV  R+  EGTHF +PW++  IIYDVR+KP+++A+ T
Sbjct: 57  MLLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLT 116

Query: 80  GTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELI 139
           GTKDLQMV++T RVL RP V +LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LI
Sbjct: 117 GTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLI 176

Query: 140 TQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLV 199
           TQRE VS+ IR  L  RA  F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V
Sbjct: 177 TQREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVV 236

Query: 200 EKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
           +KA Q +Q  V+R                   D + L +RL+ ++EIAR L++S N
Sbjct: 237 DKARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPN 291

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  259 bits (663), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 126/231 (54%), Positives = 170/231 (73%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           ++++V GG R +++ R+SGV  ++  EGTHF++PWLQ  IIYDVR+KP+++A+ TGTKDL
Sbjct: 55  SLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGTKDL 114

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP++  LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 115 QMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 174

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RAG+F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA FLV++A Q
Sbjct: 175 VSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDRARQ 234

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ SK+IA+ L+ SSN
Sbjct: 235 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  258 bits (659), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 171/234 (73%), Gaps = 1/234 (0%)

Query: 22  ADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGT 81
           A+ A+++V GG R +++ R++GVQ R+  EGTHF++PW++  ++YDVR+KP+++++ TGT
Sbjct: 55  ANEALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGT 114

Query: 82  KDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 141
           KDLQMV++T RVL RP V  LP IY++LG+DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 115 KDLQMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQ 174

Query: 142 REVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEK 201
           RE VS+ IR  L  RA  F I L+DVSIT+MTF  EFT +VE KQIAQQDA++A F+V+K
Sbjct: 175 RERVSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDK 234

Query: 202 AEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
           A Q +Q  +++                   D + L +RL+ ++EIA  LSRS N
Sbjct: 235 ATQEKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPN 287

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  258 bits (658), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 122/231 (52%), Positives = 170/231 (73%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  ++  EGTHF++PWL+  ++YDVR+KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V +LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RAG F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ ++EIA  L++S N
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPN 289

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  258 bits (658), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 169/231 (73%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           ++++V GG R +++ R+SGVQQ V GEGTHF++PWL+  ++YDVRSKP+++++ TGT DL
Sbjct: 57  SLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTGTNDL 116

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V  LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLITQRES 176

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA  F I L+DVSIT+MTF  EFT AVE KQ+AQQDA+RA F VEKA+Q
Sbjct: 177 VSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVEKAKQ 236

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q+ +++                   D + L +RL+ ++EIA  L+ S N
Sbjct: 237 EKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  257 bits (657), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 171/237 (72%), Gaps = 1/237 (0%)

Query: 23  DYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTK 82
           + ++++V GG R +++ R++GVQ R+  EGTHF +PWL+  I+YDVR+KP+++A+ TGTK
Sbjct: 55  NASLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTK 114

Query: 83  DLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 142
           DLQMV++T RVL RP+V +LP ++++LG DYDERVLPSI NEVLKS+VAQF+A++LITQR
Sbjct: 115 DLQMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQR 174

Query: 143 EVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKA 202
           E VS+ IR  L  RA +F + L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA
Sbjct: 175 EKVSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKA 234

Query: 203 EQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSNVTYL 259
            Q +Q  V++                   D + L +RL+ ++EIA  LS S N   L
Sbjct: 235 RQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVIL 290

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  257 bits (657), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 125/231 (54%), Positives = 168/231 (72%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  R+  EGTHF+ PWL   IIYDVR+KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V++LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V+R                   D + L +RL+ +++IA+ L+ S N
Sbjct: 237 EKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  256 bits (654), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 169/233 (72%), Gaps = 1/233 (0%)

Query: 23  DYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTK 82
           + ++++V GG R +I+ R++GVQ R+  EGTHF +PW +  I+YDVR+KP+++A+ TGTK
Sbjct: 55  NSSLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTK 114

Query: 83  DLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 142
           DLQMV++T RVL RP V +LP ++++LG DYDERVLPSI NEVLKS+VAQF+A++LITQR
Sbjct: 115 DLQMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQR 174

Query: 143 EVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKA 202
           E VS+ IR  L  RA +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA
Sbjct: 175 EKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKA 234

Query: 203 EQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            Q +Q  V++                   D + L +RL+ ++EIA  LS+S N
Sbjct: 235 RQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPN 286

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  256 bits (654), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 169/231 (73%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           ++++V GG R +++ R++GV  R+  EGTHF++PWL+  I+YDVR+KP+++A+ TGTKDL
Sbjct: 56  SLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTGTKDL 115

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V  LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 116 QMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 175

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA +F I L+DVSIT MTF  EFT+AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 176 VSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVDKARQ 235

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ ++EIAR L+ S N
Sbjct: 236 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPN 285

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  255 bits (651), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 167/231 (72%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  R+  EGTHF++PWL+  I+YDVR+KP+++A+ TGTKDL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V +LP +Y++LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ +KEIA  L+ S N
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPN 264

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  256 bits (653), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           ++++V GG R +++ R+SGV  ++  EGTHF++PW++  IIYDVR+KP+++A+ TGTKDL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP V  LP IY++LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  R+  F I L+DVSIT MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V+R                   D + L +RL+ ++EIA  L++S N
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPN 288

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  254 bits (648), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 122/231 (52%), Positives = 168/231 (72%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  ++  EGTHF+ PWL   I+YDVR+KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V++LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 176

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ +++IA+ L+ S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  254 bits (648), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 168/231 (72%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  R+  EGTH L+PW +  ++YDVR+KP+++A+ TGTKDL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTGTKDL 119

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V +LP IY++LGLDYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V++A Q
Sbjct: 180 VSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVDRALQ 239

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ ++EIA+ LSRS N
Sbjct: 240 EKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPN 289

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  253 bits (647), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 124/231 (53%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  ++  EGTHF+ PWL   IIYDVR+KP+++A+ TGTKDL
Sbjct: 57  ALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGTKDL 116

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP+V +LP IY++LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 117 QMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 176

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 177 VSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 236

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ +++IA+ L+ S N
Sbjct: 237 EKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPN 286

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  253 bits (647), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 123/233 (52%), Positives = 168/233 (72%), Gaps = 1/233 (0%)

Query: 23  DYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTK 82
           + A+++V GG R +++ R++GV  R+  EGTHF+ PW+   IIYDVR+KP+++A+ TGTK
Sbjct: 55  NNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGTK 114

Query: 83  DLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 142
           DLQMV++T RVL RP+V +LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQR
Sbjct: 115 DLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQR 174

Query: 143 EVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKA 202
           E VS+ IR  L  RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA
Sbjct: 175 EKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKA 234

Query: 203 EQMRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            Q +Q  V++                   D + L +RL+ +++IA+ L+ S N
Sbjct: 235 RQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPN 286

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  253 bits (647), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 125/251 (49%), Positives = 177/251 (70%), Gaps = 15/251 (5%)

Query: 11  MAIPAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRS 70
           + + AG L    + A+++V GG R +++ R+ GV Q++  EGTH ++PW++  I+YDVR+
Sbjct: 47  LVLGAGALFF--NNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRA 104

Query: 71  KPKSIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIV 130
           KP+++A+ TGTKDLQMV++T RVL RP V +LP IY++LG DYDERVLPSI NEVLK++V
Sbjct: 105 KPRNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVV 164

Query: 131 AQFDAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQ 190
           AQF+A++LITQRE VS+ IR  L  RA  F I L+DVSIT+MTF  EFT+AVE KQIAQQ
Sbjct: 165 AQFNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQ 224

Query: 191 DAERAKFLVEKAEQMRQASVIRXXXXXXXXXXXXXXXXXVGDGL------LLIRRLEASK 244
           DA+RA F+V+KA Q +Q  V++                 +GD +      + ++RL+ +K
Sbjct: 225 DAQRAAFIVDKARQEKQGMVVK-------AQGEAKSAELIGDAIKKSRDYVELKRLDTAK 277

Query: 245 EIARTLSRSSN 255
           +IA+ L+ S N
Sbjct: 278 DIAKILANSPN 288

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  253 bits (646), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 121/231 (52%), Positives = 168/231 (72%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  ++  EGTHF++PW++  +IYDVR+KP+++A+ TGTKDL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP V +LP IY++LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA +F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ +K+IA  L++S N
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPN 287

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  252 bits (643), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 122/231 (52%), Positives = 166/231 (71%), Gaps = 1/231 (0%)

Query: 25  AMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPKSIATNTGTKDL 84
           A+++V GG R +++ R+ GV  R+  EGTH ++PWL+  ++YDVR+KP+++A+ TGTKDL
Sbjct: 59  ALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTGTKDL 118

Query: 85  QMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREV 144
           QMV++T RVL RP V +LP IY++LG DY ERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLITQREK 178

Query: 145 VSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAERAKFLVEKAEQ 204
           VS+ IR  L  RA  F I L+DVSIT+MTF  EFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 205 MRQASVIRXXXXXXXXXXXXXXXXXVGDGLLLIRRLEASKEIARTLSRSSN 255
            +Q  V++                   D + L +RL+ ++EIA+ L+RS N
Sbjct: 239 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPN 288

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,047,387
Number of extensions: 807868
Number of successful extensions: 2283
Number of sequences better than 10.0: 42
Number of HSP's gapped: 2292
Number of HSP's successfully gapped: 42
Length of query: 284
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 176
Effective length of database: 41,097,471
Effective search space: 7233154896
Effective search space used: 7233154896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)