Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B007803.495ON1531538121e-113
KAFR0C019903.495ON1511543563e-43
NDAI0G009103.495ON1631563547e-43
TDEL0D056303.495ON1501473363e-40
Suva_7.4213.495ON1651563322e-39
Kpol_480.133.495ON1571543224e-38
NCAS0E007803.495ON1711623227e-38
AFR314W3.495ON1551553172e-37
TBLA0C045003.495ON1651503156e-37
YGR133W (PEX4)3.495ON1831563167e-37
KLTH0F14894g3.495ON1661523141e-36
Kwal_55.212463.495ON1601523122e-36
Smik_6.2293.495ON1651553071e-35
TPHA0D042603.495ON1581483061e-35
Skud_7.4443.495ON1621282973e-34
Ecym_12343.495ON1611552931e-33
KLLA0E04027g3.495ON1581332912e-33
ZYRO0D09878g3.495ON1531492878e-33
CAGL0I10450g3.495ON1621512852e-32
SAKL0F02706g3.495ON1611582819e-32
KLLA0C18656g8.375ON2281392344e-24
Smik_15.5177.54ON1561302279e-24
CAGL0E00671g8.375ON2131392204e-22
NDAI0E038707.54ON1641052156e-22
Skud_15.5047.54ON1561302157e-22
TBLA0H031308.375ON2141272171e-21
NDAI0A011608.375ON2161172171e-21
Skud_4.4418.375ON2151272171e-21
Suva_2.3438.375ON2151272161e-21
Smik_4.4258.375ON2151272161e-21
YDR177W (UBC1)8.375ON2151272162e-21
TDEL0F049908.375ON2171272162e-21
Kpol_461.86.109ON1671372132e-21
SAKL0A00396g8.375ON2151412162e-21
TBLA0F024406.109ON1741362132e-21
TPHA0J017506.109ON1691372132e-21
Suva_8.3897.54ON1561302122e-21
SAKL0A07260g6.109ON1691372122e-21
Ecym_30776.109ON1701372122e-21
AAR156C6.109ON1701372122e-21
ZYRO0C04950g6.109ON1681372122e-21
YGL058W (RAD6)6.109ON1721372122e-21
Smik_7.2226.109ON1711372122e-21
TDEL0G036106.109ON1691372122e-21
Suva_7.2136.109ON1731372122e-21
NCAS0D032206.109ON1711372113e-21
NCAS0B031508.375ON2141392134e-21
KLLA0C05632g6.109ON1641372095e-21
Kpol_1065.127.54ON1591142095e-21
Ecym_60388.375ON2111392126e-21
CAGL0I00352g6.109ON1671372096e-21
Kpol_1075.1b8.230ON1521282079e-21
ADR169C8.375ON2111112101e-20
ZYRO0D04466g7.54ON1591052071e-20
Kpol_1030.108.375ON2151272091e-20
TDEL0H039707.54ON1561062061e-20
KAFR0A047006.109ON1531102052e-20
KLTH0H06732g6.109ON1601102052e-20
KLLA0C17622g8.230ON1591282052e-20
KLTH0G14366g8.230ON1491282042e-20
TDEL0A013408.230ON1571282042e-20
Skud_7.2226.109ON1701372052e-20
YOR339C (UBC11)7.54ON1561302043e-20
Kwal_14.18286.109ON1521102033e-20
AGR121C8.230ON1541282043e-20
KAFR0B060608.375ON213992073e-20
TPHA0L008508.375ON2161062074e-20
Smik_4.2973.308ON1481142025e-20
KNAG0H029808.230ON1521282016e-20
TPHA0B034108.230ON1521282017e-20
Suva_2.2183.308ON1481142017e-20
Skud_4.3143.308ON1481142017e-20
YDR059C (UBC5)3.308ON1481142017e-20
SAKL0H17930g8.230ON1531282008e-20
NDAI0I016506.109ON1761372029e-20
KNAG0F025706.109ON1511101991e-19
KNAG0A048108.375ON2141172031e-19
NCAS0B040108.230ON1531281991e-19
Ecym_55638.230ON1641281992e-19
KLTH0A07546g8.375ON2151392013e-19
ZYRO0B11682g8.230ON1511281964e-19
Kwal_56.234828.230ON149981955e-19
Suva_4.3263.308ON1481021955e-19
Skud_2.2073.308ON1481021946e-19
Smik_2.2193.308ON1481021946e-19
YBR082C (UBC4)3.308ON1481021946e-19
YDR092W (UBC13)8.230ON1531281946e-19
KAFR0C002703.308ON1471021947e-19
KNAG0J023403.308ON1611111941e-18
CAGL0E04752g3.308ON1471021931e-18
KLTH0E14300g3.308ON1471141921e-18
SAKL0B06512g3.308ON1471141921e-18
AER173C3.308ON1471141921e-18
NDAI0A054903.308ON1471021921e-18
NCAS0A108003.308ON1481021921e-18
TPHA0O009201.436ON2261151971e-18
Ecym_74313.308ON1471141921e-18
NDAI0J015408.230ON1541281922e-18
TBLA0F037908.230ON1511281922e-18
Kpol_1052.23.308ON1481141912e-18
CAGL0G08063g8.230ON1491281912e-18
Skud_4.3528.230ON143981902e-18
TPHA0A038503.308ON1481141912e-18
Kwal_23.64858.375ON2151271952e-18
TDEL0B056701.436ON2031151943e-18
Kwal_27.124013.308ON2361141953e-18
KLLA0E12563g3.308ON1481021903e-18
ZYRO0C03784g8.375ON2181271943e-18
TDEL0F021003.308ON1471021893e-18
TBLA0I021303.308ON1481141894e-18
ZYRO0E03806g1.436ON2091151924e-18
ZYRO0G12870g3.308ON1471021885e-18
Suva_2.2538.230ON143981885e-18
Smik_4.3358.230ON143981876e-18
KNAG0H018701.436ON2101141901e-17
KLTH0H13816g1.436ON2331151901e-17
CAGL0M03399g1.436ON2141141891e-17
Smik_5.981.436ON2151141882e-17
Suva_5.531.436ON2151051882e-17
YEL012W (UBC8)1.436ON2181141882e-17
NDAI0D011401.436ON2451091893e-17
KAFR0A024208.230ON147981833e-17
Skud_5.871.436ON2101051855e-17
KAFR0H029601.436ON1871151829e-17
NCAS0G031301.436ON2311141841e-16
Kpol_1030.181.436ON2231051831e-16
TBLA0A012901.436ON2191051821e-16
SAKL0B10582g7.54ON1611051791e-16
AEL045W1.436ON2111201822e-16
Ecym_13481.436ON2111151812e-16
KLLA0A11198g1.436ON2021131802e-16
TDEL0B065702.569ON1651471773e-16
Kwal_34.161741.436ON2131001794e-16
TPHA0B007704.249ON157941764e-16
Smik_4.1714.249ON157941755e-16
KNAG0I029404.49ON1971301775e-16
YDL064W (UBC9)4.249ON157941756e-16
SAKL0D10560g1.436ON2071141786e-16
TBLA0E015704.49ON1941141768e-16
Kpol_483.164.249ON122941711e-15
Suva_4.1864.249ON157941731e-15
CAGL0D00814g4.249ON157941731e-15
KLTH0D01760g7.54ON1611061721e-15
TPHA0I024602.569ON1671431731e-15
ZYRO0E06358g2.569ON1651431731e-15
ABR059W2.569ON1651491712e-15
Kpol_1056.52.569ON1651501703e-15
NDAI0B015202.569ON1651671704e-15
SAKL0H03058g4.249ON1571031677e-15
KNAG0M021502.569ON1701201688e-15
Skud_4.1914.249ON157941678e-15
KLLA0E07745g2.569ON1651611679e-15
Ecym_45782.569ON1651491671e-14
Kwal_23.42274.249ON122941641e-14
KLTH0D14344g4.249ON1571221661e-14
ZYRO0B12386g4.249ON1571151652e-14
KNAG0D043904.249ON157991642e-14
KAFR0A021602.569ON1651681643e-14
TDEL0E012204.249ON157941633e-14
Kwal_26.70097.54ON1611051633e-14
TBLA0I029604.249ON157941634e-14
Ecym_32704.249ON157941624e-14
KAFR0H012303.308ON110921587e-14
AER056C4.249ON157941608e-14
KLLA0E05039g4.249ON157941608e-14
NCAS0A024904.249ON1571001582e-13
TBLA0H026102.569ON1651251582e-13
NCAS0A127402.569ON1651201582e-13
NCAS0A059404.49ON1931231583e-13
CAGL0M07568g2.569ON1651621555e-13
KAFR0G032404.249ON157941555e-13
KAFR0F030404.49ON169841556e-13
Suva_13.1892.569ON1651491547e-13
Smik_13.1862.569ON1651491547e-13
YMR022W (UBC7)2.569ON1651491547e-13
Skud_13.1762.569ON1651491547e-13
Ecym_83714.49ON267971571e-12
SAKL0D13552g2.569ON1651491522e-12
Kwal_26.82242.569ON1651431512e-12
KLTH0D07986g2.569ON1651431503e-12
Smik_12.3894.49ON1871281495e-12
NDAI0D043804.249ON157941485e-12
KLLA0C17248g4.49ON1841061488e-12
ADL035C4.49ON200891462e-11
Suva_10.4014.49ON1871031435e-11
Skud_12.3894.49ON1871261426e-11
NDAI0D029104.49ON1891071401e-10
CAGL0D06468g4.49ON187841401e-10
YLR306W (UBC12)4.49ON1881071392e-10
SAKL0H24112g4.49ON185801373e-10
KLTH0H09504g4.49ON184841364e-10
ZYRO0G19910g4.49ON179821348e-10
Kpol_YGOB_414.24.49ON193931341e-09
Kpol_414.2singletonOFF192931341e-09
TDEL0E055604.49ON187891331e-09
TPHA0F003904.49ON1931831322e-09
KAFR0H012703.301ON2871411342e-09
NDAI0A055303.301ON2731591308e-09
Kpol_1065.453.301ON3231411308e-09
Kwal_27.104443.301ON2781411281e-08
CAGL0E04598g3.301ON2951411281e-08
KLTH0C04818g3.301ON2751411281e-08
TPHA0M012803.301ON4351411282e-08
NCAS0A107703.301ON2731411272e-08
AGL203C3.301ON2701411262e-08
Smik_4.2903.301ON2971441253e-08
Skud_4.3063.301ON2971441253e-08
YDR054C (CDC34)3.301ON2951441254e-08
Suva_2.2113.301ON2971441254e-08
Ecym_26693.301ON2681411244e-08
SAKL0D02530g3.301ON2721411227e-08
KNAG0H010403.301ON2961411227e-08
KLLA0D09196g3.301ON2921381228e-08
TBLA0G032703.301ON3301411228e-08
TDEL0D032603.301ON2891411229e-08
ZYRO0G12650g3.301ON2851411229e-08
NCAS0I014303.301ON2581441164e-07
NDAI0A075703.301ON2391591051e-05
CAGL0H03157g6.187ON139120978e-05
KLTH0H04796g6.187ON138120932e-04
TBLA0D006007.392ON256108953e-04
KNAG0F021306.187ON138119924e-04
Suva_7.1826.187ON137117915e-04
KNAG0J022803.301ON217138936e-04
Smik_7.1966.187ON10088870.001
ZYRO0G08228g6.187ON138119890.001
NDAI0I012306.187ON157119890.001
YGL087C (MMS2)6.187ON137117880.001
Kwal_27.111826.187ON10188870.001
NDAI0A016507.392ON251108890.002
KAFR0C021406.187ON138120850.003
KLLA0E19119g6.187ON139120850.003
AFL064W6.187ON138117840.004
Skud_7.1956.187ON10088810.008
CAGL0I05478g7.392ON246110830.011
KNAG0B023607.392ON25193810.022
TDEL0G015806.187ON138118790.026
KLTH0C06688g7.392ON246143800.027
ZYRO0B03344g7.392ON25042800.030
NCAS0D036606.187ON138118780.030
TBLA0A019006.187ON139120780.036
Ecym_22306.187ON13886780.037
Smik_5.2467.392ON25075790.042
Skud_5.2257.392ON25075790.045
YER100W (UBC6)7.392ON250109790.045
SAKL0A05192g6.187ON140119770.053
KLLA0E20395g7.392ON251107780.060
Kpol_1002.656.187ON10189720.14
Suva_5.2197.392ON249109730.22
KAFR0L017507.392ON25194720.30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00780
         (153 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   317   e-113
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   141   3e-43
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   140   7e-43
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   134   3e-40
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   132   2e-39
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   128   4e-38
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   128   7e-38
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   126   2e-37
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   125   6e-37
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   126   7e-37
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   125   1e-36
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   124   2e-36
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   122   1e-35
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   122   1e-35
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   119   3e-34
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   117   1e-33
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   116   2e-33
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   115   8e-33
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   114   2e-32
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   112   9e-32
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    95   4e-24
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    92   9e-24
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    89   4e-22
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    87   6e-22
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    87   7e-22
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    88   1e-21
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      88   1e-21
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    88   1e-21
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    88   1e-21
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    88   1e-21
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    88   2e-21
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    88   2e-21
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    87   2e-21
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    88   2e-21
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    87   2e-21
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    87   2e-21
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    86   2e-21
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    86   2e-21
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    86   2e-21
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    86   2e-21
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    86   2e-21
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    86   2e-21
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    86   2e-21
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    86   2e-21
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    86   2e-21
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      86   3e-21
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      87   4e-21
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    85   5e-21
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    85   5e-21
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    86   6e-21
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    85   6e-21
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    84   9e-21
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    86   1e-20
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    84   1e-20
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    85   1e-20
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    84   1e-20
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    84   2e-20
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    84   2e-20
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    84   2e-20
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    83   2e-20
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    83   2e-20
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    84   2e-20
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    83   3e-20
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    83   3e-20
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    83   3e-20
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    84   3e-20
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    84   4e-20
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    82   5e-20
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    82   6e-20
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    82   7e-20
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    82   7e-20
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    82   7e-20
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    82   7e-20
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    82   8e-20
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      82   9e-20
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    81   1e-19
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    83   1e-19
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    81   1e-19
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    81   2e-19
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    82   3e-19
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    80   4e-19
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    80   5e-19
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    80   5e-19
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    79   6e-19
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    79   6e-19
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    79   6e-19
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    79   6e-19
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    79   7e-19
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    79   1e-18
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    79   1e-18
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    79   1e-18
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    79   1e-18
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    79   1e-18
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    79   1e-18
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    79   1e-18
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    80   1e-18
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    79   1e-18
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    79   2e-18
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    79   2e-18
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    78   2e-18
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    78   2e-18
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    78   2e-18
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    78   2e-18
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    80   2e-18
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    79   3e-18
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    80   3e-18
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    78   3e-18
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    79   3e-18
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    77   3e-18
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    77   4e-18
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    79   4e-18
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    77   5e-18
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    77   5e-18
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    77   6e-18
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    78   1e-17
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    78   1e-17
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    77   1e-17
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    77   2e-17
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    77   2e-17
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    77   2e-17
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    77   3e-17
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    75   3e-17
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    76   5e-17
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    75   9e-17
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                75   1e-16
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    75   1e-16
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    75   1e-16
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    74   1e-16
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    75   2e-16
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    74   2e-16
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    74   2e-16
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    73   3e-16
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    74   4e-16
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    72   4e-16
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    72   5e-16
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    73   5e-16
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    72   6e-16
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    73   6e-16
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    72   8e-16
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    70   1e-15
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    71   1e-15
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    71   1e-15
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    71   1e-15
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    71   1e-15
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    71   1e-15
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    70   2e-15
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    70   3e-15
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    70   4e-15
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    69   7e-15
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    69   8e-15
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    69   8e-15
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    69   9e-15
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    69   1e-14
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    68   1e-14
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    69   1e-14
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    68   2e-14
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    68   2e-14
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    68   3e-14
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    67   3e-14
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    67   3e-14
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    67   4e-14
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    67   4e-14
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    65   7e-14
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    66   8e-14
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    66   8e-14
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    65   2e-13
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    65   2e-13
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    65   2e-13
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     65   3e-13
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    64   5e-13
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    64   5e-13
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    64   6e-13
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    64   7e-13
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    64   7e-13
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    64   7e-13
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    64   7e-13
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    65   1e-12
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    63   2e-12
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    63   2e-12
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    62   3e-12
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    62   5e-12
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    62   5e-12
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    62   8e-12
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    61   2e-11
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    60   5e-11
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    59   6e-11
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       59   1e-10
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    59   1e-10
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    58   2e-10
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    57   3e-10
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    57   4e-10
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    56   8e-10
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    56   1e-09
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    56   1e-09
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    56   1e-09
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    55   2e-09
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                56   2e-09
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    55   8e-09
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    55   8e-09
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    54   1e-08
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    54   1e-08
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    54   1e-08
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    54   2e-08
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    54   2e-08
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    53   2e-08
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    53   3e-08
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    53   3e-08
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    53   4e-08
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    53   4e-08
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    52   4e-08
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    52   7e-08
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                52   7e-08
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    52   8e-08
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    52   8e-08
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    52   9e-08
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    52   9e-08
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                49   4e-07
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    45   1e-05
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    42   8e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    40   2e-04
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    41   3e-04
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    40   4e-04
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    40   5e-04
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    40   6e-04
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    38   0.001
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    39   0.001
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    39   0.001
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    39   0.001
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    38   0.001
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    39   0.002
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    37   0.003
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    37   0.003
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    37   0.004
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    36   0.008
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    37   0.011
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    36   0.022
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    35   0.026
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    35   0.027
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    35   0.030
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    35   0.030
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    35   0.036
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    35   0.037
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    35   0.042
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    35   0.045
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    35   0.045
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    34   0.053
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    35   0.060
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    32   0.14 
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    33   0.22 
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    32   0.30 
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    32   0.36 
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    32   0.37 
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    32   0.41 
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    32   0.53 
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    32   0.59 
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    32   0.64 
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    32   0.77 
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    31   0.96 
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    31   1.2  
KNAG0D03230 Chr4 (577579..579156) [1578 bp, 525 aa] {ON} Anc_4.6...    30   2.6  
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    30   2.6  
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    30   2.7  
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    30   3.0  
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    28   9.6  

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  317 bits (812), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD
Sbjct: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
           KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE
Sbjct: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120

Query: 121 SPLNLELAALSRLGDHKAYDGIIKYRLAHSSIK 153
           SPLNLELAALSRLGDHKAYDGIIKYRLAHSSIK
Sbjct: 121 SPLNLELAALSRLGDHKAYDGIIKYRLAHSSIK 153

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  141 bits (356), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 93/154 (60%), Gaps = 7/154 (4%)

Query: 1   MSQRVLREY---RRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
           M  R+L+EY   R L +    A    L P    DLTHWE T++GP  +P+  H+F LR+ 
Sbjct: 1   MESRILKEYKDSRSLQSQYILA----LDPISTDDLTHWECTIKGPLHSPFANHTFKLRID 56

Query: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEP 117
           +P  YP   P   F    MPHPNV ++TGE+CLD L   W+PV ++QY V A+  LL EP
Sbjct: 57  IPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILDTNWSPVFNIQYIVEAIVWLLNEP 116

Query: 118 NPESPLNLELAALSRLGDHKAYDGIIKYRLAHSS 151
           N +SPLNL+LA L R  D KAY  +I Y L +S+
Sbjct: 117 NFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSA 150

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  140 bits (354), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 98/156 (62%), Gaps = 12/156 (7%)

Query: 4   RVLREYRRLVAA-----GGAANESN-----LHPTDP-ADLTHWEATLEGPQGTPYEGHSF 52
           R+++EY+ +            +E N     L P DP  DLT WEA ++GPQGTPY G +F
Sbjct: 3   RIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62

Query: 53  PLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG-WTPVMDLQYAVMAVR 111
            L +T+P +YPT+PP   F  R+MPH NV ++TGE+CLD L    WTPV +L   + A+ 
Sbjct: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122

Query: 112 RLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRL 147
            LL +P PESPLN++LA L R GD  AY+G+I Y L
Sbjct: 123 LLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  134 bits (336), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 96/147 (65%), Gaps = 4/147 (2%)

Query: 4   RVLREYRRLVAAGGAANE--SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           R+ REY+ + A  G+ +    +L P D  DL+ W   + GP GTPYEGH+F LR+ + D+
Sbjct: 3   RIAREYKHIQATLGSESSLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTFSLRLVLGDR 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNPE 120
           YPT PP V F +R+MPH NV ++TG +CL+ L    W+P  DL + + A+ +LL++P P+
Sbjct: 62  YPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPD 121

Query: 121 SPLNLELAALSRLGDHKAYDGIIKYRL 147
           SPL+++LA + R  D  AY G++ Y L
Sbjct: 122 SPLDIDLANILRAQDRSAYYGLVNYYL 148

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 96/156 (61%), Gaps = 12/156 (7%)

Query: 4   RVLREYRRLVAAGGAANE----------SNLHPTDPADLTHWEATLEGPQGTPYEGHSFP 53
           R+ +EYR L+    A+++           +L+PTD  DL+ WEAT+ GP+ TPYE + F 
Sbjct: 3   RITKEYR-LIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFR 61

Query: 54  LRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRR 112
           + + VPD YP  PP + F K  + H N+   TGE+CLD L    WTPV DL + V AV R
Sbjct: 62  MLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWR 121

Query: 113 LLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148
           LL EP  +SPL++++  + R GD +AY GI+KY LA
Sbjct: 122 LLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLA 157

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  128 bits (322), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 98/154 (63%), Gaps = 3/154 (1%)

Query: 3   QRVLREYRRLVAAGGAANE--SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           +R+L+EY+ +    G      S+L P D  DLT+W AT+ GP  TPY GHSF LR+ +  
Sbjct: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-AGGWTPVMDLQYAVMAVRRLLAEPNP 119
           +YP  PP V F    MPH N+++ TG++CL+ L    W+PV +L   V+A+ +LL++P  
Sbjct: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123

Query: 120 ESPLNLELAALSRLGDHKAYDGIIKYRLAHSSIK 153
           +SPLN++L+ + ++ D  AY G+I+Y L + S K
Sbjct: 124 DSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  128 bits (322), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 96/162 (59%), Gaps = 15/162 (9%)

Query: 4   RVLREYRRL---VAAGGAANESN-----------LHPTDPADLTHWEATLEGPQGTPYEG 49
           R+L+EY+++   ++     + +N           LHP   +DLTHW+A ++GPQGTPY  
Sbjct: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62

Query: 50  HSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG-WTPVMDLQYAVM 108
           H F L++  P  YP  PP + F   +MPH NV + TG +CLD L    WTP  +L   + 
Sbjct: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122

Query: 109 AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
           A+  LL +P P+SPLN+++A + R+ D  AY+G++ Y L+ S
Sbjct: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSAS 164

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  126 bits (317), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 68/155 (43%), Positives = 91/155 (58%), Gaps = 17/155 (10%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPT---------DPADLTHWEATLEGPQGTPYEGHSFP 53
           +R+LREY++L        +  LHP          +  DL  WEA  +GP+ TPY G +F 
Sbjct: 2   RRILREYKQL------QKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFT 55

Query: 54  LRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRR 112
           LR+ VP+ YP  PP   FP   + HPN+KW TGEVCLD L    W+PV +L   V A+  
Sbjct: 56  LRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAIST 115

Query: 113 LLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRL 147
           LLAEP  +SPL+++L+ L    D  AYDG++ YRL
Sbjct: 116 LLAEPGVDSPLDVDLSRLYT-TDRAAYDGVVNYRL 149

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  125 bits (315), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 5/150 (3%)

Query: 3   QRVLREYRRLVAAGGA-ANESNLHPTDPA--DLTHWEATLEGPQGTPYEGHSFPLRVTVP 59
            R+++EY  +        N + LHP   A  DL++W + + GP+ +PY   SF L + +P
Sbjct: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61

Query: 60  DKYPTLPPSVCFPKRTMP-HPNVKWDTGEVCLDTLAG-GWTPVMDLQYAVMAVRRLLAEP 117
            +YP++PP + F K ++P H NV + TGE+CL+ L    W+PV +L Y+V A+ +LLA P
Sbjct: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121

Query: 118 NPESPLNLELAALSRLGDHKAYDGIIKYRL 147
           +P SPLN++L+ L  L D KAY+ +IKY L
Sbjct: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  126 bits (316), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 91/156 (58%), Gaps = 10/156 (6%)

Query: 3   QRVLREYRRLVAAGGAANE---------SNLHPTDPADLTHWEATLEGPQGTPYEGHSFP 53
            R+++EY+ ++    + +           +L+P D  DL+ WEA + GP  TPYE H F 
Sbjct: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79

Query: 54  LRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRR 112
           + + VP  YP  PP + F +  + H NVK  TGE+CL+ L    WTPV DL + V AV R
Sbjct: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139

Query: 113 LLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148
           LL EP  +SPL++++  + R GD  AY GI+KY LA
Sbjct: 140 LLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  125 bits (314), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 88/152 (57%), Gaps = 5/152 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANES----NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           MSQR+ +EYR L    G   E     +L P    +L  WE+ + GP  TPY GH F L++
Sbjct: 1   MSQRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQI 60

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-AGGWTPVMDLQYAVMAVRRLLA 115
              + YP  PP V F  R MPH NV +D+G +CL  L A  WTP  DL + V A+  LLA
Sbjct: 61  EASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLA 120

Query: 116 EPNPESPLNLELAALSRLGDHKAYDGIIKYRL 147
            P P+SPL+++LA L R GD  A++ +I Y L
Sbjct: 121 SPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  124 bits (312), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 92/152 (60%), Gaps = 5/152 (3%)

Query: 1   MSQRVLREYRRLVAA----GGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           MSQR+ +EY+ L+         ++   L P    +L  WEA + GP  TPY+GH F L +
Sbjct: 1   MSQRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLI 60

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLA 115
           T+P  YP  PP V F  R +PH NV +++G +C++ L    W+P  DL + V A+  LLA
Sbjct: 61  TIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLA 120

Query: 116 EPNPESPLNLELAALSRLGDHKAYDGIIKYRL 147
            P P+SPL+++LA L R GD+ A++G++ Y L
Sbjct: 121 NPEPDSPLDVDLACLRRAGDYSAHNGLVAYYL 152

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  122 bits (307), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 89/155 (57%), Gaps = 10/155 (6%)

Query: 4   RVLREYRRLVAAGGAANE---------SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPL 54
           R+ +EYR ++    + +           +L+P D  DL+ WEA + GP  TPYE + F +
Sbjct: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62

Query: 55  RVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRL 113
            + VP  YP  PP + F +  + H NVK  TGE+CLD L    WTPV DL + V AV RL
Sbjct: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122

Query: 114 LAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148
           L EP  +SPL++++  + R  D  AY GI+KY LA
Sbjct: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLA 157

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  122 bits (306), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 91/148 (61%), Gaps = 3/148 (2%)

Query: 3   QRVLREYRRLVAAGGAANESN--LHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           +R+L+E R +       +ES   L P    +   W A L+GP  TPY  HSF L + +P 
Sbjct: 4   KRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIELPS 63

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNP 119
           +YP +PP++ F   +MPH NV++ TG++CL+ L    W+PV +L Y ++A+ +LL EP  
Sbjct: 64  EYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQEPVV 123

Query: 120 ESPLNLELAALSRLGDHKAYDGIIKYRL 147
           +SPLN++LA + R GD  AY G+I Y L
Sbjct: 124 DSPLNIDLANILRAGDTSAYHGLINYYL 151

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  119 bits (297), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 81/128 (63%), Gaps = 1/128 (0%)

Query: 22  SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNV 81
            +L+P D  DL+ WEA + GP  TPYE + F + + VP  YP  PP++ F +  + H N+
Sbjct: 30  ESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRILIDVPSSYPMAPPNIRFDRNNILHCNI 89

Query: 82  KWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYD 140
           K  TGE+CLD L    WTPV DL + V A+ RLL EP  +SPL++++  + R GD  AY 
Sbjct: 90  KSPTGEICLDILKPEDWTPVWDLLHCVHAIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQ 149

Query: 141 GIIKYRLA 148
           GII+Y LA
Sbjct: 150 GIIRYFLA 157

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  117 bits (293), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 93/155 (60%), Gaps = 6/155 (3%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPT---DPADLTHWEATLEGPQGTPYEGHSFPLRVTV 58
           + R+L EY++ +     ++ES L      D   L+ WEA   GP+ TPY   +F L + +
Sbjct: 9   ASRMLAEYKQ-IREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEI 67

Query: 59  PDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEP 117
           P+ YP  PP+  FP   + HPN+KW TGEVCLD L    W+P+ +L   V A+R LLAEP
Sbjct: 68  PEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127

Query: 118 NPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSI 152
             +SPL+++LA L  + D +AY G++ YRL   ++
Sbjct: 128 GVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSRTL 161

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  116 bits (291), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 83/133 (62%), Gaps = 3/133 (2%)

Query: 22  SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVP-DKYP-TLPPSVCFPKRTMPHP 79
           S L P D  DL+ W    +GP  +P+EG    L +T+  +KYP +  P V F  RT+ HP
Sbjct: 24  SFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHP 83

Query: 80  NVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAY 139
           NVKWDTGE+CLD L   WTP+  L   V A+R LLA+P  +SPL+L++A +    D++AY
Sbjct: 84  NVKWDTGEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYD-ADYEAY 142

Query: 140 DGIIKYRLAHSSI 152
             I++YRL  + +
Sbjct: 143 VQIVRYRLEEARL 155

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  115 bits (287), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 5/149 (3%)

Query: 4   RVLREYR---RLVAAGGAANESNLHPTDPA-DLTHWEATLEGPQGTPYEGHSFPLRVTVP 59
           R  +EY+   +++  G       +   +P  DLT WEA + GP GTPYEG +F L +++P
Sbjct: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLSLP 62

Query: 60  DKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG-WTPVMDLQYAVMAVRRLLAEPN 118
            +YP  PP V F    MPH NV + TGE+CLD L    W+P  DL + V A+ +LL EP 
Sbjct: 63  QEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDEPV 122

Query: 119 PESPLNLELAALSRLGDHKAYDGIIKYRL 147
             SPLN+++A + +  D  AY G++ Y +
Sbjct: 123 SSSPLNVDIANILKANDMNAYYGLVHYYI 151

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  114 bits (285), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 88/151 (58%), Gaps = 7/151 (4%)

Query: 6   LREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTL 65
           L + R+ +  G +    +L P D +DL+ W A ++GP  TPY  + F L + VP  YP +
Sbjct: 8   LLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPASYPMV 67

Query: 66  PPSVCFPK------RTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLLAEPN 118
           PP++ F        R  PH NV   TGE+CLD L   GW+P+ D+ + V A+  LL EP 
Sbjct: 68  PPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHILLQEPV 127

Query: 119 PESPLNLELAALSRLGDHKAYDGIIKYRLAH 149
           P+SPL++++A + +  D  AY+GII+Y L  
Sbjct: 128 PDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  112 bits (281), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 92/158 (58%), Gaps = 8/158 (5%)

Query: 3   QRVLREY---RRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTV 58
           QR+ +E+   R+ +A   + N    L P D  ++ HW A + GP  TPY    F L V +
Sbjct: 4   QRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVEL 63

Query: 59  PDKYPTLPPSVCF---PKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRRLL 114
           P +YP  PP V F    +  + H NV + TGE+CLD L    W+PV DL + + A+  LL
Sbjct: 64  PIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWILL 123

Query: 115 AEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSI 152
            EP PESPLN+++A + + GD +AY+G+IKY +  + +
Sbjct: 124 GEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIGMNGV 161

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 94.7 bits (234), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           S+R+L+E + +     A  E  L   + +D+ H + +  GP GTPYEG  F + + +P +
Sbjct: 4   SKRILKEIQAVKEDPEAQIE--LKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDINIPVE 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPNV   TG +CLD L   WTPV+ L+ A+++++ LL  P P  
Sbjct: 62  YPYKPPQMKFDTKVY-HPNVSSVTGAICLDILKNAWTPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELAALSRLGDHKAYD 140
           P + ++A    L D K++D
Sbjct: 121 PQDAQVAK-HYLTDKKSFD 138

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 92.0 bits (227), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 75/130 (57%), Gaps = 4/130 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           +++R+  E  +L+++  A    +  P D  DLT+W   + GPQGTPY G  F + +  P+
Sbjct: 9   VTKRLQNELLQLLSS--ATQSISAFPVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPE 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP  PP + F    M HPNV   +G +CLD L   W+ V +++  +++++ LL EPN +
Sbjct: 67  NYPFHPPKIKF-VSPMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNK 124

Query: 121 SPLNLELAAL 130
           SPLN   A L
Sbjct: 125 SPLNAVAAEL 134

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 89.4 bits (220), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +  V     AN S L     +D+ H + +  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKELQA-VKDDPEANIS-LEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFDSKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELAALSRLGDHKAYD 140
           P + E+A    L D +++D
Sbjct: 121 PQDAEVAQ-HYLRDRQSFD 138

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 87.4 bits (215), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 60/105 (57%), Gaps = 2/105 (1%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P D  DLTHW A + GP+ TPY+G  F L     D YP  PP V F    M HPNV   +
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF-ISPMWHPNVDM-S 97

Query: 86  GEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           G +CLD L   W+ V +++  +++++ LL EPN  SPLN   A L
Sbjct: 98  GNICLDILKDQWSAVYNVETILLSLQALLEEPNNSSPLNAVAAEL 142

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 87.4 bits (215), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (54%), Gaps = 4/130 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           +++R+  E  +L+++          P D  DLT+W   + GPQGTPY    F + +  P+
Sbjct: 9   VTKRLQNELLQLLSS--TTQSIGAFPVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPE 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP  PP V F    M HPNV   +G +CLD L   W+ V +++  +++++ LL EPN  
Sbjct: 67  NYPFHPPKVKFV-SPMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNR 124

Query: 121 SPLNLELAAL 130
           SPLN   A L
Sbjct: 125 SPLNAVAAEL 134

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +  V    AAN + L   + +D+ H + +  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKEMQA-VKDDPAANIT-LDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 67/117 (57%), Gaps = 2/117 (1%)

Query: 24  LHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKW 83
           L   + +D+ H + +  GP GTPYEG  F + + VP +YP  PP + F  +   HPN+  
Sbjct: 24  LEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPMEYPFKPPKMKFDTKVY-HPNISS 82

Query: 84  DTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYD 140
            TG +CLD L   W+PV+ L+ A+++++ LL  P P  P + E+A    L D  ++D
Sbjct: 83  VTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ-HYLKDRASFD 138

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 88.2 bits (217), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +        A    L     +D+ H + T  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKEIQ--AVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 87.8 bits (216), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +        A    L     +D+ H + T  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKEIQ--AVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 87.8 bits (216), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +        A    L     +D+ H + T  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKEIQ--AVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 87.8 bits (216), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +        A    L     +D+ H + T  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKEIQ--AVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 87.8 bits (216), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 73/127 (57%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E + +      A + NL     +D+ H + +  GP GTPY+G  F + + VP +
Sbjct: 4   AKRIMKEMQAV--KDDPAAKINLEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPNV   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFDTKVY-HPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 86.7 bits (213), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFVSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 87.8 bits (216), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 79/141 (56%), Gaps = 8/141 (5%)

Query: 2   SQRVLREYRRLVAAGGAANESN--LHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVP 59
           ++R+++E    + A     E+N  L     +D+ H + +  GP GTPYEG +F + + VP
Sbjct: 4   AKRIIKE----IQAAKDDPEANITLSFVSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVP 59

Query: 60  DKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNP 119
            +YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P
Sbjct: 60  LEYPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEP 118

Query: 120 ESPLNLELAALSRLGDHKAYD 140
             P + E+A    + D  ++D
Sbjct: 119 NDPQDAEVAQ-HFIRDKSSFD 138

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 86.7 bits (213), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 75/136 (55%), Gaps = 7/136 (5%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           +R++R+++R+ +       ++  P +   +  W A + GP  TPYE  +F L +   ++Y
Sbjct: 7   RRLMRDFKRIKSDSPPGISASPLPDN---VMLWNAMIIGPSDTPYEDGTFRLVLEFDEEY 63

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESP 122
           P  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP SP
Sbjct: 64  PNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVSSILTSIQSLFNDPNPASP 121

Query: 123 LNLELAALSRLGDHKA 138
            N+E A L    DH+A
Sbjct: 122 ANVEAATL--FKDHRA 135

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 86.7 bits (213), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSGSPL----PDNVMIWNAMIIGPSDTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFISE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 4/130 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           +++R+  E  +L+++       +  P D  DLT+W   + GPQGTPY    F + +  P+
Sbjct: 9   VTKRLQNELLQLLSS--TTRSISAFPEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPE 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP  PP V F    M HPNV   +G +CLD L   W+ V +++  +++++ LL EPN  
Sbjct: 67  SYPFHPPKVKF-VSPMWHPNVDM-SGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNR 124

Query: 121 SPLNLELAAL 130
           SPLN   A L
Sbjct: 125 SPLNAVAAEL 134

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 85.9 bits (211), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 76/137 (55%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 86.7 bits (213), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 79/139 (56%), Gaps = 4/139 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E + +     A  E  L   + +D+ H + +  GP GTPYEG  F + + VP +
Sbjct: 4   AKRIMKELQAVKDDPEARIE--LEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPMMKFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELAALSRLGDHKAYD 140
           P + E+A    L D ++++
Sbjct: 121 PQDAEVAQ-HYLKDRESFN 138

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 85.1 bits (209), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 75/137 (54%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVAAGG-AANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+        + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPL----PDNVMIWNAMIIGPADTPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FQDHKS 135

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 85.1 bits (209), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 3/114 (2%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P    +LT W  T+ GP  +PY G  F + +T PD+YP  PP V F    M HPNV   +
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF-VSPMWHPNVDL-S 93

Query: 86  GEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAY 139
           G +CLD L   W+ V ++Q  +++++ LL EPN  SPLN  +AA    GD + Y
Sbjct: 94  GNICLDVLKEKWSAVYNVQTILLSLQALLGEPNNSSPLN-AIAAELWDGDKEEY 146

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 86.3 bits (212), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 77/139 (55%), Gaps = 4/139 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +  V     AN S L     +D+ H + T  GP GTPY G  F + + VP +
Sbjct: 4   AKRLMKEIQS-VKDDPDANIS-LSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPLE 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ ++++++ LL  P P  
Sbjct: 62  YPFKPPKMQFDTKVY-HPNISSVTGAICLDILKNSWSPVLTLKTSLISLQALLQSPEPND 120

Query: 122 PLNLELAALSRLGDHKAYD 140
           P + E+A    L D  ++D
Sbjct: 121 PQDAEVAK-HYLSDRSSFD 138

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 85.1 bits (209), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVAAGG-AANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+        + S L    P ++  W A + GP  TPYE  +F L +   + 
Sbjct: 7   RRLMRDFKRMKEDSPPGVSASPL----PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDED 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 84.3 bits (207), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L ++E T+EGPQ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGITAEPHDDN---LRYFEVTIEGPQQSPYENGVFDLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 85.5 bits (210), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 65/111 (58%), Gaps = 2/111 (1%)

Query: 30  ADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVC 89
           +D+ H + T  GP GTPY G +F + + VP +YP  PP + F  +   HPN+   TG +C
Sbjct: 30  SDIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPFKPPKMQFDTKVY-HPNISSVTGAIC 88

Query: 90  LDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYD 140
           LD L   W+PV+ L+ ++++++ LL  P P  P + E+A    L D  ++D
Sbjct: 89  LDILKNSWSPVLTLKTSLISLQALLQSPEPNDPQDAEVAK-HYLSDRASFD 138

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 84.3 bits (207), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 59/105 (56%), Gaps = 2/105 (1%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P +  DL  W   + GP+GTPYE   F + +  PD YP +PP V F    M HPNV   +
Sbjct: 36  PNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKF-ISPMWHPNVDM-S 93

Query: 86  GEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           G +CLD L   W+ V ++Q  +++++ L  EPN  SPLN   A L
Sbjct: 94  GNICLDILKDQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAEL 138

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 85.1 bits (209), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +  V    AAN  NL     +D+ H + +  GP  TPY+G  F + + VP +
Sbjct: 4   AKRIMKEMQA-VKDDPAAN-INLEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 84.0 bits (206), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 59/106 (55%), Gaps = 2/106 (1%)

Query: 25  HPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWD 84
            P    DLT W   + GP+GTPYE   F L +   D+YP  PP V F    M HPNV   
Sbjct: 32  FPASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTF-VSPMWHPNVDM- 89

Query: 85  TGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           +G +CLD L   W+ V ++Q  +++++ LL EPN  SPLN   A L
Sbjct: 90  SGNICLDILKDQWSAVYNVQTILLSLQALLEEPNNGSPLNAIAAEL 135

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 62/110 (56%), Gaps = 4/110 (3%)

Query: 29  PADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEV 88
           P ++  W A + GP  TPYE  +F L +   + YP  PP V F    M HPNV +  GE+
Sbjct: 15  PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV-YANGEI 72

Query: 89  CLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA 138
           CLD L   WTP  D+   + +++ L  +PNP SP N+E A L +  DHK+
Sbjct: 73  CLDILQNRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK--DHKS 120

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 62/110 (56%), Gaps = 4/110 (3%)

Query: 29  PADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEV 88
           P ++  W A + GP  TPYE  +F L +   ++YP  PP V F    M HPNV +  GE+
Sbjct: 26  PDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSE-MFHPNV-YANGEI 83

Query: 89  CLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA 138
           CLD L   WTP  D+   + +++ L  +PNP SP N+E A L    DHK+
Sbjct: 84  CLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 131

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ T+EGPQ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGITAEPHEDN---LRYFQVTIEGPQQSPYENGVFQLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++V+ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKNNWSPALQIRTVLLSVQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 83.2 bits (204), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ T+EGPQ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGITAQPHEDN---LRYFQVTIEGPQQSPYESGVFQLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++V+ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 83.2 bits (204), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ T+EGPQ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGITAEPHEDN---LRYFQVTIEGPQQSPYENGVFNLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++V+ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-KLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 83.6 bits (205), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 75/137 (54%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  T YE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPADTSYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPNKPPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 83.2 bits (204), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 72/130 (55%), Gaps = 4/130 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           +++R+  E  +L+++   +  +   P D  DLT+W   + GP+ TPY G  F + +  P 
Sbjct: 9   VTKRLQNELLQLLSSTTESISA--FPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQ 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP  PP + F    M HPNV   +G +CLD L   W+ V +++  +++++ LL EPN  
Sbjct: 67  NYPFHPPMIKF-LSPMWHPNVD-KSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNR 124

Query: 121 SPLNLELAAL 130
           SPLN   A L
Sbjct: 125 SPLNAVAAEL 134

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 82.8 bits (203), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 4/110 (3%)

Query: 29  PADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEV 88
           P ++  W A + GP  TPYE  +F L +   ++YP  PP V F      HPNV +  GE+
Sbjct: 15  PDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF-HPNV-YANGEI 72

Query: 89  CLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA 138
           CLD L   WTP  D+   + +++ L  +PNP SP N+E A L +  DHK+
Sbjct: 73  CLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK--DHKS 120

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 83.2 bits (204), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 74/128 (57%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ ++EGPQ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGISAEPHEDN---LRYFDVSIEGPQQSPYEHGVFRLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
           +YP  PP V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  EYPMEPPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 84.3 bits (207), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 30  ADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVC 89
           +D+ H + +  GP GTPYE  +F + + VP +YP  PP + F  +   HPN+   TG +C
Sbjct: 30  SDIHHLKGSFIGPPGTPYENGAFVVDIEVPMEYPFKPPQMKFDTKVY-HPNISSVTGAIC 88

Query: 90  LDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           LD L   W+PV+ L+ A+++++ LL  P P  P + E+A
Sbjct: 89  LDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 84.3 bits (207), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 61/106 (57%), Gaps = 1/106 (0%)

Query: 23  NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVK 82
           +L     AD+ H + +  GP  TPYEG  F + + VP +YP  PP + F  +   HPN+ 
Sbjct: 23  DLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPMEYPFKPPKMKFDTKVY-HPNIS 81

Query: 83  WDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
             TG +CLD L   W+PV+ L+ A+++++ LL  P P  P + E+A
Sbjct: 82  SVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVA 127

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 82.4 bits (202), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP V F  +   HPN+   +G +CL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + L   +++V  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 88  DILKDQWSPALTLSKVLLSVCSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 82.0 bits (201), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RL+        +  H  +   L ++E T+EGP G+PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLITDPVPGITAEPHDDN---LRYFEVTVEGPVGSPYENGIFQLELYLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 82.0 bits (201), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L ++  T+EGP+G+PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGITAEPHDDN---LRYFSVTIEGPEGSPYEHGIFDLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMESPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 82.0 bits (201), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP V F  +   HPN+   +G +CL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 82.0 bits (201), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP V F  +   HPN+   +G +CL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 82.0 bits (201), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP V F  +   HPN+   +G +CL
Sbjct: 30  DLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIY-HPNIN-SSGNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 81.6 bits (200), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ T+EGPQ +PYE   F L + +P+
Sbjct: 4   LPKRIIKETERLVSDPVPGISAEPHDDN---LRYFQVTIEGPQQSPYENGVFELELFLPE 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 82.4 bits (202), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 75/137 (54%), Gaps = 9/137 (6%)

Query: 3   QRVLREYRRLVA-AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           +R++R+++R+   A    + S L    P ++  W A + GP  TPYE  +F L +   ++
Sbjct: 7   RRLMRDFKRMKEDAPPGVSASPL----PDNVMVWNAMIIGPAETPYEDGTFRLLLEFDEE 62

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP   P V F    M HPNV +  GE+CLD L   WTP  D+   + +++ L  +PNP S
Sbjct: 63  YPINRPHVKFLSE-MFHPNV-YANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS 120

Query: 122 PLNLELAALSRLGDHKA 138
           P N+E A L    DHK+
Sbjct: 121 PANVEAATL--FKDHKS 135

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 81.3 bits (199), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 62/110 (56%), Gaps = 4/110 (3%)

Query: 29  PADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEV 88
           P ++  W A + GP  TPYE  +F L +   + YP  PP V F    M HPNV +  GE+
Sbjct: 15  PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSE-MFHPNV-YANGEI 72

Query: 89  CLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKA 138
           CLD L   WTP  D+   + +++ L  +PNP SP N+E A L +  D+K+
Sbjct: 73  CLDILQNRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK--DYKS 120

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 82.8 bits (203), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 67/117 (57%), Gaps = 2/117 (1%)

Query: 24  LHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKW 83
           L   + +D+ H + T +GP  TPY+   F + + VP +YP  PP + F  +   HPNV  
Sbjct: 24  LEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPMEYPFKPPKMKFDTKVY-HPNVSS 82

Query: 84  DTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYD 140
            TG +CLD L   W+PV+ L+ A+++++ LL  P P  P + E+A    L D ++++
Sbjct: 83  VTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQ-HYLKDRESFN 138

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 81.3 bits (199), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RL++       +  H  +   L ++  T+EGP G+PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLISDPVPGITAEPHEDN---LRYFNVTVEGPAGSPYENGIFQLELYLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++V+ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSVQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ ++EGPQ + YE   F L + +PD
Sbjct: 4   LPKRIIKETERLVSDPVPGISAEPHEDN---LRYFDVSIEGPQQSAYENGVFRLELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
           +YP  PP V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  EYPMEPPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLATPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 82.0 bits (201), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++RV++E + +     A  + +L   +  D+   + +  GP GTPYE   F + + VP +
Sbjct: 4   AKRVMKELQAIKDDPEA--KVDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPNV   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFDTKVY-HPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELAALSRLGDHKAYD 140
           P + E+A    L D  ++D
Sbjct: 121 PQDAEVAQ-HFLRDKASFD 138

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 80.1 bits (196), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RL +       +  H  +   L ++  T+EGP+ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLASDPVPGISAEPHEDN---LRYFAVTIEGPEESPYENGVFELELYLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  R   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTRIY-HPNID-RLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 79.7 bits (195), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L +++ T+EGPQ +PYE   F L + +PD YP   P V F  +   HPN+    G +CL
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRICL 88

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           D L   W+P + ++  +++V+ LLA PNP  PL  ++A
Sbjct: 89  DVLKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 79.7 bits (195), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 79.3 bits (194), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 72/128 (56%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  +LV+       +  H  +   L +++ T+EGP+ +PYE   F L + +PD
Sbjct: 4   LPKRIIKETEKLVSDPVPGITAEPHDDN---LRYFQVTIEGPEQSPYEDGIFELELYLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 79.3 bits (194), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 87  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 79.3 bits (194), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (54%), Gaps = 3/111 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 43  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 100

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDG 141
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +  D   Y+ 
Sbjct: 101 DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRSKYEA 150

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 87  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 87  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 87  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 87  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 87  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 88  DILKDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 129

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GP+ TPYEG  + L V +PD YP   PS+ F  +   HPN+   +G +CL
Sbjct: 30  NMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICL 88

Query: 91  DTLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D +   W+P+ DL   +   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 89  DVINSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAGL-QLHDKKIYEEKIK 142

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 78.6 bits (192), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 87  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 139

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RL++       +  H  +   L ++  T+EGP  +PYE   F L + +PD
Sbjct: 4   LPKRIIKETERLISDPVPGITAEPHDDN---LRYFNVTVEGPTQSPYENGIFKLELYLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RL++       +  H  +   L ++  T+EGP+ + YE   F L + +PD
Sbjct: 4   LPKRIIKETERLISDPVPGITAQPHEDN---LRYFSVTIEGPKDSAYENGVFELELFLPD 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKNNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           D+ HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A L +  D   Y+   K
Sbjct: 88  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT-DRAKYEATAK 140

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 71/128 (55%), Gaps = 5/128 (3%)

Query: 1   MSQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           + +R+++E  RLV+       +  H  +   L +++ T+EGP  +PYE   F L + +P+
Sbjct: 4   LPKRIIKETERLVSDPVPGITAEPHEDN---LRYFDVTIEGPSQSPYEKGIFKLELYLPE 60

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPE 120
            YP   P V F  +   HPN+    G +CLD L   W+P + ++  +++++ LLA PNP 
Sbjct: 61  DYPMEAPKVRFLTKIY-HPNID-RLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPN 118

Query: 121 SPLNLELA 128
            PL  ++A
Sbjct: 119 DPLANDVA 126

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 77.8 bits (190), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L +++ T+EGP+ +PYE   F L + +PD YP   P V F  R   HPN+    G +CL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTRIY-HPNID-RLGRICL 78

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           D L   W+P + ++  +++++ LLA PNP  PL  ++A
Sbjct: 79  DVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           D+ HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A L +  D   Y+   K
Sbjct: 88  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYKT-DRPKYEATAK 140

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++RV++E + +     A    +L   +  D+   + +  GP GTPYE   + + + VP +
Sbjct: 4   AKRVMKELQAIKDDPEA--RVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPNV   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFQTKVY-HPNVSSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 3/115 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GP+ TPYE   + L V +PD YP   PS+ F  + + HPN+   +G +CL
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-HPNIDVASGSICL 74

Query: 91  DTLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D +   W+P+ DL+  V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 75  DVINSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIK 128

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 118 DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 175

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 176 DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEATAK 228

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 77.8 bits (190), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           D+ HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + +   ++++  LL + NP+ PL  E+A L +
Sbjct: 88  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHLYK 129

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 72/127 (56%), Gaps = 3/127 (2%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDK 61
           ++R+++E +  V    AAN + L     +D+   + +  GP  TPY+G  F + + VP +
Sbjct: 4   AKRLMKELQA-VRDDPAANIT-LEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPME 61

Query: 62  YPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPES 121
           YP  PP + F  +   HPN+   TG +CLD L   W+PV+ L+ A+++++ LL  P P  
Sbjct: 62  YPFKPPKMKFDTKVY-HPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120

Query: 122 PLNLELA 128
           P + E+A
Sbjct: 121 PQDAEVA 127

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 77.4 bits (189), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           D+ HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +
Sbjct: 87  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 77.4 bits (189), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 3/114 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           D+ HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 30  DIYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICL 87

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +  D   Y+   K
Sbjct: 88  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAK 140

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 78.6 bits (192), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICL 88

Query: 91  DTLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D +   W+P+ DL+  V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 89  DVINSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIK 142

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           D+ HW+A++ GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CL
Sbjct: 29  DVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTKIY-HPNINAN-GNICL 86

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           D L   W+P + +   ++++  LL + NP+ PL  E+A + +
Sbjct: 87  DILKDQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 128

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 77.0 bits (188), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L +++ T+EGP+ +PYE   F L + +PD YP   P V F  +   HPN+    G +CL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTKIY-HPNID-RLGRICL 78

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           D L   W+P + ++  +++++ LLA PNP  PL  ++A
Sbjct: 79  DVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 76.6 bits (187), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L +++ T+EGP+ +PYE   F L + +PD YP   P V F  +   HPN+    G +CL
Sbjct: 21  NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRICL 78

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           D L   W+P + ++  +++++ LLA PNP  PL  ++A
Sbjct: 79  DVLKTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYE   + L V +PD YP   PS+ F  + + HPN+   +G +CLD
Sbjct: 30  MQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGFVNK-IYHPNIDIASGSICLD 88

Query: 92  TLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            +   W+P+ DL   V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 89  VINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKMYEEKIK 141

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GPQGTPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CL
Sbjct: 28  NMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSICL 86

Query: 91  DTLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D +   W+P+ DL   V   +  LL EPN   PLN E A L +L + + Y+  I+
Sbjct: 87  DVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLKNKELYEQKIR 140

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 61/114 (53%), Gaps = 3/114 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYEG  + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 30  MQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLD 88

Query: 92  TLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            +   W+P+ DL   V   +  LL EPN   PLN E A L +L D K Y+  ++
Sbjct: 89  VINSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAANL-QLKDKKVYEEKVR 141

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLD 87

Query: 92  TLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            +   W+P+ DL   V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 88  VINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIK 140

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD +   W+P+
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLDVINSTWSPL 96

Query: 101 MDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            DL   V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 97  YDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIK 140

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 29  MQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLD 87

Query: 92  TLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            +   W+P+ DL   V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 88  VINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIK 140

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 77.4 bits (189), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 59/109 (54%), Gaps = 3/109 (2%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD +   W+P+
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLDVINSTWSPL 114

Query: 101 MDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148
            DL   V   +  LL EPN   PLN E A L  L D K Y+  IK  +A
Sbjct: 115 YDLLNIVEWMIPGLLKEPNGSDPLNNEAATL-ELKDKKLYEERIKEYIA 162

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 75.1 bits (183), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 59/98 (60%), Gaps = 2/98 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L +++ ++EGP+ +PYE   F L + +PD YP   P V F  +   HPN+    G +CL
Sbjct: 27  NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTKIY-HPNID-RLGRICL 84

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           D L   W+P + ++  +++V+ LLA PNP  PL  ++A
Sbjct: 85  DILKTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 75.9 bits (185), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 58/105 (55%), Gaps = 3/105 (2%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD +   W+P+
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLDVINSTWSPL 95

Query: 101 MDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            DL   +   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 96  YDLINILEWMIPGLLKEPNGSDPLNNEAATL-QLRDKKLYEEKIK 139

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 74.7 bits (182), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CL
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDVASGSICL 86

Query: 91  DTLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D +   W+P+ DL   V   +  LL EPN   PLN E A L +L D   Y+  IK
Sbjct: 87  DVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLRDKVLYEQKIK 140

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 75.5 bits (184), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 52  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLD 110

Query: 92  TLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            +   W+P+ DL   V   +  LL EPN   PLN E A L  L D K Y+  I+
Sbjct: 111 VINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATL-ELRDKKLYEEKIR 163

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD +   W+P+
Sbjct: 39  GPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLDVINSTWSPL 97

Query: 101 MDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            DL   V   +  LL EPN   PLN E A L +L D   Y+  IK
Sbjct: 98  YDLLNIVEWMIPGLLKEPNGSDPLNNEAAGL-QLHDKTLYEQKIK 141

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           GP  TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD +   W+P+
Sbjct: 38  GPDETPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDIASGSICLDVINSTWSPL 96

Query: 101 MDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            DL   V   +  LL EPN   PLN E A L +L D K Y+  IK
Sbjct: 97  YDLINIVEWMIPGLLKEPNGTDPLNNEAAGL-QLRDKKLYEEKIK 140

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 73.6 bits (179), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 58/105 (55%), Gaps = 2/105 (1%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P +  DLT W   + GP GTPYEG  F + +  P  YP   P V F    M HPNV   +
Sbjct: 38  PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF-VSPMWHPNVDM-S 95

Query: 86  GEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           G +CLD L   W+ V ++Q  +++++ LL EPN  SPLN   A L
Sbjct: 96  GNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/120 (35%), Positives = 62/120 (51%), Gaps = 6/120 (5%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GP+GTPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CL
Sbjct: 28  NMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSICL 86

Query: 91  DTLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALS----RLGDHKAYDGIIKY 145
           D +   W+P+ DL   V   +  LL EPN   PLN E A L     ++ + K  + I KY
Sbjct: 87  DVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKNPQMYEEKIQEYIDKY 146

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (53%), Gaps = 3/115 (2%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  +     GP+GTPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CL
Sbjct: 28  NMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSICL 86

Query: 91  DTLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
           D +   W+P+ DL   V   +  LL EPN   PLN E A L +L + K Y+  I+
Sbjct: 87  DVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLKNPKMYEEKIQ 140

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 73.9 bits (180), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 30  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSICLD 88

Query: 92  TLAGGWTPVMDLQYAV-MAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGII 143
            +   W+P+ DL   V   +  LL EPN   PLN E A L +L D   Y+  I
Sbjct: 89  VINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATL-QLKDKDMYEQKI 140

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 74/147 (50%), Gaps = 23/147 (15%)

Query: 2   SQRVLREYRRLVAA---GGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTV 58
           S+R+L+EY++L+     G  A      P   ++L  W+  ++GP  TPYEG  F  R+  
Sbjct: 6   SRRLLKEYQQLIRDPPPGILA-----APKSESNLFLWDCLIQGPPDTPYEGGIFNARLDF 60

Query: 59  PDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDLQY 105
           P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  ++ 
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 106 AVMAVRRLLAEPNPESPLNLELAALSR 132
            +++V  +L+EPN ES  N++   L R
Sbjct: 119 ILLSVMSMLSEPNIESGANVDACILWR 145

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 73.6 bits (179), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 53/100 (53%), Gaps = 2/100 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYEG  + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 17  MQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSICLD 75

Query: 92  TLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAAL 130
            +   W+P+ DL   +   +  LL EPN   PLN E A L
Sbjct: 76  VINSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAATL 115

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL HWEA + G  GT +    +P+ +  PD+YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  DLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL  WEA + G +GT + G  +P+ V  P++YP+ PP V FP     HPNV + +G +CL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 67/130 (51%), Gaps = 6/130 (4%)

Query: 25  HPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKW 83
           HP+D          L   +G    GH F  + T+ + YP  PP V C  K  + HPN+  
Sbjct: 65  HPSDITKQPELLLILSIDEGFYNLGH-FRFQFTINENYPIEPPKVVCLTK--IYHPNINR 121

Query: 84  DTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGII 143
            TGE+CL+ L   W+P +DLQ  ++ +  L  EPNP+ PLN + AA + L D   +  I+
Sbjct: 122 -TGEICLNILREDWSPALDLQSVIIGLLFLFIEPNPKDPLNKQ-AADTLLHDPAVFKHIV 179

Query: 144 KYRLAHSSIK 153
           +  +A  SI 
Sbjct: 180 QKSMAGESIN 189

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 72.0 bits (175), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL  WEA + G +GT + G  +P+ V  P++YP+ PP V FP     HPNV + +G +CL
Sbjct: 37  DLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 73.2 bits (178), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +  +     GP+ TPYE   + L V +PD YP   PS+ F  +   HPN+   +G +CLD
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-HPNIDAASGSICLD 75

Query: 92  TLAGGWTPVMDLQYAVM-AVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            +   W+P+ DL   V   +  LL EPN   PLN E A L +L + + Y+  I+
Sbjct: 76  VINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATL-QLKNKELYEEKIQ 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 72.4 bits (176), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (52%), Gaps = 3/114 (2%)

Query: 29  PADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEV 88
           PA+      T+   +G   +G+ FP  +   D YP  PP V F K+   HPN+  + G++
Sbjct: 63  PAESPELLITIHPDEGIYKDGY-FPFSMVFKDSYPIEPPVVKFLKKIY-HPNIDLN-GKI 119

Query: 89  CLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGI 142
           CL+ L   W+PV+DLQ  ++ +  L  EPNP  PLNL+   L +    +  D +
Sbjct: 120 CLNILREDWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELLKENKQEFIDIV 173

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 70.5 bits (171), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL  WEA + G  GT +    +P+ +  PD+YP+ PP V FPK    HPNV + +G +CL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPKGFY-HPNV-YPSGTICL 59

Query: 91  DTL--AGGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL  WEA + G +GT + G  +P+ V  P++YP+ PP V FP     HPNV + +G +CL
Sbjct: 37  DLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT ++   FP+ V  PD+YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 70.9 bits (172), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 57/106 (53%), Gaps = 2/106 (1%)

Query: 25  HPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWD 84
            P D  DLT W   + GP GTPYEG  F + +     YP   P V F    M HPNV   
Sbjct: 37  FPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF-VSPMWHPNVDM- 94

Query: 85  TGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           +G +CLD L   W+ V ++Q  +++++ LL EPN  SPLN   A L
Sbjct: 95  SGNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 71/143 (49%), Gaps = 17/143 (11%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           +R+L+EY++L+        +   P+D  ++  W+  + GP  TPYE   F   +  P  Y
Sbjct: 9   KRLLKEYQQLIRESPPGIVAG--PSDENNMFEWDCLISGPPETPYENGVFNATLLFPKDY 66

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDLQYAVMA 109
           P  PP + F    + HPN+ +  GEVC+  L                W+PV  ++  +++
Sbjct: 67  PLSPPKLTFTPSLL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 124

Query: 110 VRRLLAEPNPESPLNLELAALSR 132
           V  +L+EPN ES  N++ + L R
Sbjct: 125 VMSMLSEPNIESGANIDASILYR 147

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 70/143 (48%), Gaps = 17/143 (11%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           +R+L+E ++L+        +   P    DL  W+  ++GP  TPYEG  F  ++  P  Y
Sbjct: 7   KRLLKELQQLMKDSSTGIVAG--PRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPKDY 64

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDLQYAVMA 109
           P  PP + F    + HPN+ +  GEVC+  L                W+PV  ++  +++
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 110 VRRLLAEPNPESPLNLELAALSR 132
           V  +L+EPN ES  N++   L R
Sbjct: 123 VMSMLSEPNVESGANVDACILWR 145

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 73/149 (48%), Gaps = 26/149 (17%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           Q++LR+    + AG         P    +L  W+  +EGP  +PYEG  F  R+  P  Y
Sbjct: 14  QQLLRDSPDGIVAG---------PVSEDNLFLWDCLIEGPADSPYEGGVFNARLQFPRDY 64

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-------------AGGWTPVMDLQYAVMA 109
           P  PP + F    + HPNV +  GEVC+  L             +  W+PV  ++  +++
Sbjct: 65  PLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKILLS 122

Query: 110 VRRLLAEPNPESPLNLELAALSRLGDHKA 138
           V  +L+EPN ES  N++   L R  D++A
Sbjct: 123 VMSMLSEPNVESGANIDACILWR--DNRA 149

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 73/150 (48%), Gaps = 29/150 (19%)

Query: 2   SQRVLREYRRLV------AAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLR 55
            +R+ +EY++L+         G ANE+        DL  W+  ++GP  TPYE   F  +
Sbjct: 6   QKRLFKEYQQLIRDSPPGIVAGPANEN--------DLFLWDCLIQGPPDTPYEHGVFNAQ 57

Query: 56  VTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMD 102
           +  P  YP  PP++ F    + HPN+ +  GEVC+  L                W+PV  
Sbjct: 58  LRFPRDYPLSPPTLTFTPAIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQS 115

Query: 103 LQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           ++  +++V  +L+EPN ES  N++   L R
Sbjct: 116 VEKILLSVMSMLSEPNVESGANIDACILWR 145

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 70.1 bits (170), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 79/167 (47%), Gaps = 30/167 (17%)

Query: 3   QRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+L+E ++L          G ANE+NL          W+  ++GP  T YEG  F  R+
Sbjct: 7   RRLLKELQQLNKDSPPGIVAGPANENNLF--------VWDCLVQGPPDTAYEGGIFNARL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDL 103
             P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  +
Sbjct: 59  DFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
           +  +++V  +L+EPN ES  N++   L R  + K ++  +K  +  S
Sbjct: 117 EKILLSVMSMLSEPNIESGANIDACILWR-DNRKEFERQVKLSVLKS 162

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 8/103 (7%)

Query: 26  PTDPAD----LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNV 81
           PT  AD    L  WEA + G +GT ++   +P+ +  PD YP+ PP V FP     HPN+
Sbjct: 28  PTRKADGSMNLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPA-GFYHPNI 86

Query: 82  KWDTGEVCLDTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
            + +G VCL  L     W P + L+  V+ V+ LL  PNP+SP
Sbjct: 87  -YPSGTVCLSILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSP 128

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 69.3 bits (168), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (52%), Gaps = 15/120 (12%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P D +DL  W+  ++GP  +PYEG  F  ++  P  YP  PP + F    + HPNV +  
Sbjct: 28  PQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFVPSVL-HPNV-YPN 85

Query: 86  GEVCLDTL-AGG------------WTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           GEVC+  L A G            W+PV  ++  +++V  +L+EPN ES  N++   L R
Sbjct: 86  GEVCISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACVLWR 145

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           DL  WEA + G   T + G  +P+ V  P++YP+ PP V FP     HPNV + +G +CL
Sbjct: 37  DLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 68.9 bits (167), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 78/161 (48%), Gaps = 18/161 (11%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           +R+L+E  +L         ++  P D ++L  W+  + GP  + YEG  F  R+  P  Y
Sbjct: 7   KRLLKELEKLTKDSPEGILAS--PIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDFPKDY 64

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-------------AGGWTPVMDLQYAVMA 109
           P  PP + F + ++ HPN+ +  GEVC+  L                W+PV  ++  +++
Sbjct: 65  PLNPPKLTF-QPSILHPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMILLS 122

Query: 110 VRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
           V  +L+EPN ES  N++   L R  +   ++  +K  L  S
Sbjct: 123 VMSILSEPNIESGANIDACILWR-DNRPEFERQVKLNLLKS 162

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 68.9 bits (167), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 71/149 (47%), Gaps = 29/149 (19%)

Query: 3   QRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+++E ++L+         G  NE N+          W+  + GP  +PYEG  F  R+
Sbjct: 7   KRLMKEMQQLLKDCPEGIVAGPVNEENMF--------LWDCLIAGPPDSPYEGGIFNARL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-------------AGGWTPVMDL 103
             P  YP  PP + F    + HPNV +  GEVC+  L             +  W+PV  +
Sbjct: 59  QFPTDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSR 132
           +  +++V  +L+EPN ES  N++   L R
Sbjct: 117 EKILLSVMSMLSEPNVESGANIDACILWR 145

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 67.8 bits (164), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT ++   FP+ +  PD YP+ PP V FP     HPN+ + +G VCL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFY-HPNI-YPSGTVCL 59

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+   + V+ LL  PNP SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (50%), Gaps = 5/122 (4%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           Q   +++R+    G  A  +   P    +L  WEA + G +GT ++   FP+ +  PD Y
Sbjct: 10  QEERKKWRKDHPFGFFAKPTK-KPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDY 68

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA--GGWTPVMDLQYAVMAVRRLLAEPNPE 120
           P+ PP V FP     HPN+ + +G VCL  L     W P + L+   + V+ LL  PNP 
Sbjct: 69  PSKPPKVKFPA-GFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPN 126

Query: 121 SP 122
           SP
Sbjct: 127 SP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT ++   +P+ +  PD+YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGII 143
             L     W P + L+   + V+ LL  PNP SP   E A  + L +   YD  +
Sbjct: 95  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQ-EPAWRAFLRNRADYDKKV 148

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 67.8 bits (164), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (52%), Gaps = 4/99 (4%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P    DL  WEA + G QGT +    +PL +  PD+YP+ PP V  P     HPNV + +
Sbjct: 32  PDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLPANFY-HPNV-YPS 89

Query: 86  GEVCLDTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
           G +CL  L     W P + L+   + ++ LL  PNP SP
Sbjct: 90  GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 78/168 (46%), Gaps = 30/168 (17%)

Query: 2   SQRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLR 55
            +R+L+E ++L+         G   E N+          W+  ++GP  +PYEG  F  +
Sbjct: 6   QKRLLKELQQLMKDSPPGIVAGPKTEDNIF--------QWDCLVQGPPDSPYEGGVFNAQ 57

Query: 56  VTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMD 102
           +  P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  
Sbjct: 58  LDFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQS 115

Query: 103 LQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
           ++  +++V  +L+EPN ES  N++   L R  + K ++  +K  +  +
Sbjct: 116 VEKILLSVMSMLSEPNIESGANIDACILWR-DNRKEFERQVKLNILKT 162

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT ++   +P+ +  PD+YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPA-GFYHPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSP 128

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 67.4 bits (163), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 56/105 (53%), Gaps = 2/105 (1%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P    DLT W   + GP GTPYEG  F + +     YP   P V F    M HPNV   +
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF-VSPMWHPNVDM-S 95

Query: 86  GEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           G +CLD L   W+ V ++Q  +++++ LL EPN  SPLN   A L
Sbjct: 96  GNICLDILKDQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 67.4 bits (163), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G + T + G  +P+ +  PD+YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  NLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  V+ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 67.0 bits (162), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT ++   +P+ +  PD YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  NLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + ++  ++ V+ LL  PNP+SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPDSP 128

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 65.5 bits (158), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           GP  +PY G  F L +  P  YP  PP + F  +   HPN+  + G +CLD L   W+P 
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIY-HPNINAN-GNICLDILKDQWSPA 59

Query: 101 MDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           + L   ++++  LL + NP+ PL  E+A + +
Sbjct: 60  LTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 91

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 66.2 bits (160), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT ++   +P+ +  PD YP+ PP V FP     HPN+ + +G VCL
Sbjct: 37  NLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPA-GFYHPNI-YPSGTVCL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + ++  ++ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 66.2 bits (160), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 52/94 (55%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G  GT ++   +PL +  PD YP+ PP V FP     HPNV + +G +CL
Sbjct: 37  NLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPA-GFYHPNV-YPSGTICL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+  ++ V+ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 4/100 (4%)

Query: 25  HPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWD 84
           HP    +L  WEA + G +GT +    +P+ +  P++YP+ PP V  P     HPNV + 
Sbjct: 31  HPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPANFY-HPNV-YP 88

Query: 85  TGEVCLDTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
           +G +CL  L     W P + L+   + ++ LL  PNP SP
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 64/125 (51%), Gaps = 17/125 (13%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P   +DL  W+  + GP  TPY G  F  ++  P  YP  PP++ F    + HPNV +  
Sbjct: 28  PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPTDYPLSPPTLTFTPSIL-HPNV-YPN 85

Query: 86  GEVCLDTL-AGG------------WTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           GEVC+  L A G            W+PV  ++  +++V  +L+EPN ES  N++   L R
Sbjct: 86  GEVCISILHAPGSDPNMYELPEERWSPVQSVEKILLSVVSMLSEPNVESGANIDACILWR 145

Query: 133 LGDHK 137
             DH+
Sbjct: 146 --DHR 148

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 26  PTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDT 85
           P +  +L  W+  ++GP  T YEG  F  R+  P  YP  PP + F    + HPN+ +  
Sbjct: 28  PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPKDYPLSPPKLTFTPSIL-HPNI-YPN 85

Query: 86  GEVCLDTLAG-------------GWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSR 132
           GEVC+  L                W+PV  ++  +++V  +L+EPN ES  N++   L R
Sbjct: 86  GEVCISILHSPGDDPNMYELAEERWSPVQSIEKILLSVMSMLSEPNIESGANIDACILWR 145

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 61/123 (49%), Gaps = 6/123 (4%)

Query: 24  LHPTDPADLTH--WEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNV 81
           + PTDP+ L +   +  +   +G    GH F   +   D YP  PP V    R   HPN+
Sbjct: 58  ISPTDPSSLDNPLLDVIISPDEGYYKNGH-FRFSLEFNDNYPMEPPKVVCRNRIY-HPNI 115

Query: 82  KWDTGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDG 141
               G+VCL+ L   W+P +DLQ  ++ +  L  EPN + PLN + AA+    D  A+  
Sbjct: 116 DV-QGKVCLNILREDWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFS-KDSNAFAK 173

Query: 142 IIK 144
            ++
Sbjct: 174 FVR 176

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 20/162 (12%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           +R+ +E ++L+        +   P    +L  W+  ++GP  TPY G  F  ++  P  Y
Sbjct: 7   KRLYKELQQLIKDSPPGIVAG--PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDY 64

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDLQYAVMA 109
           P  PP + F    + HPN+ +  GEVC+  L                W+PV  ++  +++
Sbjct: 65  PLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLS 122

Query: 110 VRRLLAEPNPESPLNLELAALSRLGDHKA-YDGIIKYRLAHS 150
           V  +L+EPN ES  N++   L R  D++A ++  +K  +  S
Sbjct: 123 VMSMLSEPNIESGANIDACILWR--DNRAEFEKQVKLSILKS 162

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 64.3 bits (155), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT +    +PL +  PD+YP+ PP V  P     HPNV + +G +CL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPA-GFYHPNV-YPSGTICL 94

Query: 91  DTLA--GGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+   + ++ LL  PNP SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 64.3 bits (155), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQY 105
           Y G  F   +T  + YP  PPSV C  K  + HPN+  + G++CL+ L   W+P +D+Q 
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVVCLQK--IYHPNIDLN-GKICLNILREDWSPALDIQS 114

Query: 106 AVMAVRRLLAEPNPESPLNLELAA 129
            ++ +  L  EPNP  PLN + A+
Sbjct: 115 VIVGLLFLFLEPNPRDPLNKDAAS 138

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 70/149 (46%), Gaps = 29/149 (19%)

Query: 3   QRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+L+E ++L+         G  +E+N+          W+  ++GP  TPY    F  ++
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIF--------VWDCLIQGPPDTPYADGVFNTKL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDL 103
             P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  +
Sbjct: 59  EFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSR 132
           +  +++V  +L+EPN ES  N++   L R
Sbjct: 117 EKILLSVMSMLSEPNIESGANIDACILWR 145

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 70/149 (46%), Gaps = 29/149 (19%)

Query: 3   QRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+L+E ++L+         G  +E+N+          W+  ++GP  TPY    F  ++
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIF--------VWDCLIQGPPDTPYADGVFNAKL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDL 103
             P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  +
Sbjct: 59  EFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSR 132
           +  +++V  +L+EPN ES  N++   L R
Sbjct: 117 EKILLSVMSMLSEPNIESGANIDACILWR 145

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 70/149 (46%), Gaps = 29/149 (19%)

Query: 3   QRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+L+E ++L+         G  +E+N+          W+  ++GP  TPY    F  ++
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIF--------IWDCLIQGPPDTPYADGVFNAKL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDL 103
             P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  +
Sbjct: 59  EFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSR 132
           +  +++V  +L+EPN ES  N++   L R
Sbjct: 117 EKILLSVMSMLSEPNIESGANIDACILWR 145

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 63.9 bits (154), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 70/149 (46%), Gaps = 29/149 (19%)

Query: 3   QRVLREYRRLVA------AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+L+E ++L+         G  +E+N+          W+  ++GP  TPY    F  ++
Sbjct: 7   KRLLKELQQLIKDSPPGIVAGPKSENNIF--------VWDCLIQGPPDTPYADGIFNAKL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDL 103
             P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  +
Sbjct: 59  EFPKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSR 132
           +  +++V  +L+EPN ES  N++   L R
Sbjct: 117 EKILLSVMSMLSEPNIESGANIDACILWR 145

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 52/97 (53%), Gaps = 7/97 (7%)

Query: 36  EATLE---GPQGTPYEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLD 91
           EATL     P    Y+   F   V+  D YP  PP V C    T+ HPN+ ++ G +CL+
Sbjct: 141 EATLYLRISPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCL--TTIYHPNIDYN-GNICLN 197

Query: 92  TLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELA 128
            L   WTPV+DLQ  V+ +  L  EPNP+ PLN   A
Sbjct: 198 VLREDWTPVLDLQTIVIGLLFLFLEPNPKDPLNKHAA 234

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 68/149 (45%), Gaps = 29/149 (19%)

Query: 3   QRVLREYRRLV------AAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           +R+L+E ++L          G  +E NL          W+  + GP  +PYEG  F   +
Sbjct: 7   KRLLKELQQLARDSPEGIVAGPKSEDNLF--------LWDCLITGPPDSPYEGGVFNAML 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDL 103
             P  YP  PP + F    + HPN+ +  GEVC+  L                W+PV  +
Sbjct: 59  EFPKDYPLSPPRLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSV 116

Query: 104 QYAVMAVRRLLAEPNPESPLNLELAALSR 132
           +  +++V  +L+EPN ES  N++   L R
Sbjct: 117 EKILLSVTSMLSEPNVESGANIDACILWR 145

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 24/143 (16%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           Q++L++    + AG         P    +L  W+  + GP  +PY+G  F   +  P  Y
Sbjct: 14  QQLLKDSPEGIVAG---------PKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPKDY 64

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDLQYAVMA 109
           P  PP + F    + HPN+ +  GEVC+  L                W+PV  ++  +++
Sbjct: 65  PLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 110 VRRLLAEPNPESPLNLELAALSR 132
           V  +L+EPN ES  N++   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 62.4 bits (150), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 24/143 (16%)

Query: 3   QRVLREYRRLVAAGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           Q++L++    + AG         P    +L  W+  + GP  +PY+G  F   +  P  Y
Sbjct: 14  QQLLKDSPEGIVAG---------PRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPKDY 64

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG-------------GWTPVMDLQYAVMA 109
           P  PP + F    + HPN+ +  GEVC+  L                W+PV  ++  +++
Sbjct: 65  PLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122

Query: 110 VRRLLAEPNPESPLNLELAALSR 132
           V  +L+EPN ES  N++   L R
Sbjct: 123 VMSMLSEPNVESGANIDACILWR 145

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 60/128 (46%), Gaps = 7/128 (5%)

Query: 28  DPADLTH---WEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWD 84
           D  + TH    E T+   +G  Y   S    +   + YP  PP V   KR   HPN+ + 
Sbjct: 53  DSTNRTHSPKLEITVNPDEGY-YTHGSINFSLDFNEVYPIEPPKVACLKRIF-HPNIDF- 109

Query: 85  TGEVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIK 144
            G VCL+ L   W+P +DLQ  V  +  L  EPNP  PLN + A L    D K +   ++
Sbjct: 110 KGNVCLNILREDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKL-LCQDEKEFAEAVR 168

Query: 145 YRLAHSSI 152
             ++  SI
Sbjct: 169 STMSGGSI 176

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 4/94 (4%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           +L  WEA + G +GT +    +P+ +  P++YP+ PP V  P     HPNV + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPA-GFYHPNV-YPSGTICL 94

Query: 91  DTL--AGGWTPVMDLQYAVMAVRRLLAEPNPESP 122
             L     W P + L+   + ++ LL  PNP SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 61.6 bits (148), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 3/106 (2%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYA 106
           Y G ++   V + D YP  PP V    R   HPN+  D G VCL+ L   WTP +D+Q  
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMHRIY-HPNIDID-GNVCLNLLREDWTPALDIQSI 129

Query: 107 VMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSI 152
           ++ +  L  EPN   PLN + AA + + D   ++  + + L  ++I
Sbjct: 130 IIGILFLFHEPNGRDPLNKD-AAKTLIEDPLRFENKVNHSLRGNNI 174

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 41  GPQGTPYEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLDTLAGGWTP 99
            P+   Y G  F   V   D YP  PP+V C    T+ HPN+ + +G +CL+ L   W+P
Sbjct: 82  SPEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL--NTIYHPNIDY-SGNICLNVLREDWSP 138

Query: 100 VMDLQYAVMAVRRLLAEPNPESPLNLELA 128
           VMDLQ  V+ +  L  EPN   PLN + A
Sbjct: 139 VMDLQTVVLGLLFLFLEPNGSDPLNRQAA 167

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 45  TPYEGH----SFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           +P EG+    S    +   + YP  PP V   K+   HPN+  + G VCL+ L   W+P 
Sbjct: 68  SPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKKIF-HPNIDLN-GNVCLNILREDWSPA 125

Query: 101 MDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGII 143
           +DLQ  ++ +  L  EPNP  PLN + A L      K  + +I
Sbjct: 126 LDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKFAETVI 168

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 59.3 bits (142), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 58/126 (46%), Gaps = 4/126 (3%)

Query: 27  TDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTG 86
           TD       E T+   +G  Y   S    +   + YP  PP V   K+   HPN+    G
Sbjct: 55  TDRMQSPKLEVTVSPDEGY-YNHGSINFGLDFNEVYPIEPPKVACLKKIF-HPNIDL-KG 111

Query: 87  EVCLDTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYR 146
            VCL+ L   W+P +DLQ  +  +  L  EPNP  PLN + A L    + K +  I++  
Sbjct: 112 NVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF-CQNEKKFAEIVRST 170

Query: 147 LAHSSI 152
           ++  S+
Sbjct: 171 MSGGSV 176

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 59/107 (55%), Gaps = 5/107 (4%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQY 105
           Y+G  F  ++   D YP  PP+V C  K  + HPN+  D G+VCL+ L   W+P +D+Q 
Sbjct: 78  YKGGHFTFKLEFNDAYPIEPPTVICTSK--LYHPNIDID-GKVCLNILREDWSPALDVQS 134

Query: 106 AVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSI 152
            ++ +  LL EPN + PLN + AA+    D   +  ++   +A  SI
Sbjct: 135 IIIGLLFLLLEPNAKDPLNKD-AAMMLSTDTARFASLVNRSMAGYSI 180

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYA 106
           Y+G  F    T  + YP  PP V    +   HPN+    G++CL+ L   W+P +DLQ  
Sbjct: 76  YKGGKFRFTATFLETYPIDPPKVICNNKIF-HPNID-PHGKICLNILREDWSPALDLQCI 133

Query: 107 VMAVRRLLAEPNPESPLNLELAAL 130
           V+ +  L  EPN   PLN E A +
Sbjct: 134 VLGLLSLFQEPNGNDPLNKEAAEV 157

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYA 106
           Y   S    +   + YP  PP V   K+   HPN+    G VCL+ L   W+P +DLQ  
Sbjct: 75  YNYGSINFNLDFNEVYPIEPPKVVCLKKIF-HPNIDL-KGNVCLNILREDWSPALDLQSI 132

Query: 107 VMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHSSIK 153
           +  +  L  EPNP  PLN + A L   G+ K +   ++  ++  SI+
Sbjct: 133 ITGLLFLFLEPNPNDPLNKDAAKLLCEGE-KEFAEAVRLTMSGGSIE 178

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 57.4 bits (137), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 6/80 (7%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDT-GEVCLDTLAGGWTPVMDLQ 104
           Y+   F   +   D YP  PP+V C  K  + HPN+  DT G VCL+ L   W+PV+DLQ
Sbjct: 73  YKPGYFRFSLFFKDTYPIEPPAVKCVNK--IYHPNI--DTQGNVCLNILREDWSPVLDLQ 128

Query: 105 YAVMAVRRLLAEPNPESPLN 124
             V+ +  L  EPN + PLN
Sbjct: 129 SVVIGLLFLFLEPNDKDPLN 148

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 6/84 (7%)

Query: 45  TPYEGH----SFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPV 100
           TP EG+     F    T  D YP  PP V    +   HPN+    G VCL+ L   W+PV
Sbjct: 67  TPDEGYYKCGHFKFCATFKDTYPIEPPKVTLLSKIF-HPNIDLQ-GNVCLNILREDWSPV 124

Query: 101 MDLQYAVMAVRRLLAEPNPESPLN 124
           +D+Q  ++ +  L  EPN   PLN
Sbjct: 125 LDVQSILIGLLMLFLEPNATDPLN 148

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 47  YEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVMDLQYA 106
           Y+G +F   +   ++YP  PP V    R + HPN+  D G VCL+ L   WTP +DLQ  
Sbjct: 66  YKGGNFTFELLFNEQYPMEPPKVKCLNR-IYHPNIDTD-GRVCLNILRQDWTPALDLQSV 123

Query: 107 VMAVRRLLAEPNPESPLNLELA 128
           ++ +  L  E +   PLN + A
Sbjct: 124 IIGLLFLFLEISGVDPLNKQAA 145

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 39  LEGPQGTPYEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLDTLAGGW 97
           L  P    Y+   F   +   + YP  PP V C  K  + HPN+  D G++CL+ L   W
Sbjct: 74  LISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNK--IFHPNIDLD-GKICLNILREDW 130

Query: 98  TPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           +P +DL   ++ +  L  E N + PLN E A +
Sbjct: 131 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANI 163

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 39  LEGPQGTPYEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLDTLAGGW 97
           L  P    Y+   F   +   + YP  PP V C  K  + HPN+  D G++CL+ L   W
Sbjct: 73  LISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNK--IFHPNIDLD-GKICLNILREDW 129

Query: 98  TPVMDLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           +P +DL   ++ +  L  E N + PLN E A +
Sbjct: 130 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANI 162

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 5/89 (5%)

Query: 43  QGTPYEGHSFPLRVTVPDKYPTLPPSV-CFPKRTMPHPNVKWDTGEVCLDTLAGGWTPVM 101
           +G   +GH F   +T  +KYP  PP V C  +  + HPN+    G++CL+ L   W+P +
Sbjct: 72  EGFYRKGH-FTFEMTFTEKYPIEPPQVRCMNQ--IFHPNIDLQ-GKICLNILREDWSPAL 127

Query: 102 DLQYAVMAVRRLLAEPNPESPLNLELAAL 130
           DLQ  ++ +  L  E +   PLN + A+L
Sbjct: 128 DLQSVIIGILFLFLEVSGRDPLNKQAASL 156

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 76/183 (41%), Gaps = 34/183 (18%)

Query: 1   MSQRVLREYRRLVAAGGAAN-ESNLHPTDPA------DLTHW----EATLE--------- 40
           + +R  RE + L   GGA   E NL    P       DL H     + TLE         
Sbjct: 7   LKERKKRETQFLEKTGGATTGEPNLISLSPGRIRLQNDLDHLNLPPQCTLELQSSLSDMN 66

Query: 41  ---------GPQGTPYEGHSFPLRVTVPDKYPTLPPS-VCFPKRTMPHPNVKWDTGEVCL 90
                     P+  PY G +F   +   + YP  PPS +C  K  + HPN+  + G++CL
Sbjct: 67  EQPLITLCISPREGPYLGGAFKFNLKFNEMYPIEPPSAICLNK--IFHPNIDLN-GKICL 123

Query: 91  DTLAGGWTPVMDLQYAVMAVRRLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
           + L   W+P +DL   V+ +  L  +     PLN + AA     D   +  +++  +  S
Sbjct: 124 NILREDWSPALDLTSIVIGLLYLFLDFTSTDPLN-QQAAEVLANDRNRFCELVQRAMLGS 182

Query: 151 SIK 153
            I 
Sbjct: 183 EIN 185

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    N+   D +++  W    +   + + Y G  F  ++  PD +P
Sbjct: 12  LLRQYRELTDPKKAIPSFNIELDDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 72/159 (45%), Gaps = 16/159 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D ++L  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG------------WTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L  G            W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
            LL +PN  SP N++ AA+    + + Y   +K  +  S
Sbjct: 130 SLLEDPNISSPANVD-AAVDYRKNQEQYKQRVKMEVERS 167

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    +++  D +++  W    +   + + Y G  F  ++  PD +P
Sbjct: 12  LLRQYRELTNPKKAIPSFHINLEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDELDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 66/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L  A  A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDAKKAIPSFHIELDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP+  F    + HPNV  D G +C+  L            +  W+PV  ++  ++++ 
Sbjct: 72  FSPPTFRFTP-AIYHPNVYRD-GRLCISILHTSGDPTSEEPDSETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  PD +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFPDDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDFR 150

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 66/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L  A  A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDAKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP+  F    + HPNV  D G +C+  L            +  W+PV  ++  ++++ 
Sbjct: 72  FSPPTFRFTP-AIYHPNVYRD-GRLCISILHTSGDPTSEEPDSETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     +    +++  D +++  W    +   + + Y G  F  ++  PD +P
Sbjct: 12  LLRQYRELTDPKKSIPSFHINLEDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPDDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDELDAETWSPVQSVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D ++L  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG------------WTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L  G            W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PPS  F    + HPNV  D G +C+  L            +  W+PV  ++  ++++ 
Sbjct: 72  FSPPSFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPD 60
           S  +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+
Sbjct: 9   SSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVM 108
            +P  PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++
Sbjct: 69  DFPFSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 109 AVRRLLAEPNPESPLNLELAALSR 132
           ++  LL +PN  SP N++ A   R
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYR 150

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPD 60
           S  +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+
Sbjct: 9   SSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVM 108
            +P  PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++
Sbjct: 69  DFPFSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 109 AVRRLLAEPNPESPLNLELAALSR 132
           ++  LL +PN  SP N++ A   R
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYR 150

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPD 60
           S  +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+
Sbjct: 9   SSLLLRQYRELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVM 108
            +P  PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++
Sbjct: 69  DFPFSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 109 AVRRLLAEPNPESPLNLELAALSR 132
           ++  LL +PN  SP N++ A   R
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYR 150

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 52.8 bits (125), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 15/144 (10%)

Query: 2   SQRVLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPD 60
           S  +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+
Sbjct: 9   SSLLLRQYRELTDPKKAIPSFHIELEDDSNIFIWNIGVMVLNEDSIYHGGFFKAQMRFPE 68

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVM 108
            +P  PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++
Sbjct: 69  DFPFSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLI 126

Query: 109 AVRRLLAEPNPESPLNLELAALSR 132
           ++  LL +PN  SP N++ A   R
Sbjct: 127 SIVSLLEDPNINSPANVDAAVDYR 150

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PPS  F    + HPNV  D G +C+  L            +  W+PV  ++  ++++ 
Sbjct: 72  FSPPSFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 65/141 (46%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP+  F    + HPNV  D G +C+  L            +  W+PV  ++  ++++ 
Sbjct: 72  FSPPNFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L          N+   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPRKCIPSFNIELEDDSNIFVWNVGVMVLNEDSLYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 51.6 bits (122), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 65/138 (47%), Gaps = 15/138 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  PD +P
Sbjct: 11  LLRQYRELTDPKKAIPSFHIALEDDSNIFLWNIGVMVLNEESIYHGGYFKAQMKFPDDFP 70

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL--AGG----------WTPVMDLQYAVMAVR 111
             PP+  F    + HPNV  D G +C+  L  +G           W+PV  ++  ++++ 
Sbjct: 71  FSPPTFRFTP-AIYHPNVYRD-GRLCISILHQSGNPTSDEPDEETWSPVQTVESVLISIV 128

Query: 112 RLLAEPNPESPLNLELAA 129
            LL +PN  SP N++ A 
Sbjct: 129 SLLEDPNISSPANVDAAV 146

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 51.6 bits (122), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D ++L  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPRKAIPSFHIELEDESNLFIWNIGVMVLNEDSIYHGGYFKSQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPTTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 51.6 bits (122), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 64/141 (45%), Gaps = 15/141 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P+ +P
Sbjct: 12  LLRQYRELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGFFKAQMRFPEDFP 71

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G +C+  L            A  W+PV  ++  ++++ 
Sbjct: 72  FSPPQFRFTP-AIYHPNVYRD-GRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIV 129

Query: 112 RLLAEPNPESPLNLELAALSR 132
            LL +PN  SP N++ A   R
Sbjct: 130 SLLEDPNISSPANVDAAVDYR 150

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 64/144 (44%), Gaps = 21/144 (14%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   D +++  W    +   + + Y G  F  ++  P  +P
Sbjct: 19  LLRQYRELTDPKRAIPSFHIELEDDSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFP 78

Query: 64  TLPPSVCFPKRTMP---HPNVKWDTGEVCLDTLAGG------------WTPVMDLQYAVM 108
             PP   F    +P   HPNV  D G++C+  L               W+PV  ++  ++
Sbjct: 79  FSPPQFKF----IPPIYHPNVYRD-GKLCISILHQSGDAMTSEPDNETWSPVQSVESVLI 133

Query: 109 AVRRLLAEPNPESPLNLELAALSR 132
           ++  LL +PN  SP N++ A   R
Sbjct: 134 SIVSLLEDPNVSSPANVDAAVEYR 157

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 71/159 (44%), Gaps = 16/159 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWE-ATLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR+YR L     A    ++   + +++  W    +   + + Y G  F   +  P  +P
Sbjct: 13  LLRQYRELTDPKRAIPSFHIELENDSNIFVWHIGFIILNEDSIYNGGYFKSEMKFPSNFP 72

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAGG------------WTPVMDLQYAVMAVR 111
             PP   F    + HPNV  D G++C+  L               W+PV  ++  ++++ 
Sbjct: 73  YSPPHFKFVP-PIYHPNVYKD-GKLCISILHQSGDSMTSEPDNETWSPVQSVESVLISII 130

Query: 112 RLLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLAHS 150
            LL +PN  SP N++ A++    + + Y   ++ ++  S
Sbjct: 131 SLLEDPNISSPANVD-ASVEYRKNFQEYKRKVRLQVERS 168

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 42.0 bits (97), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 6/120 (5%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L   D   +T W  T+ GP  + +E   + + +    
Sbjct: 7   SFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRIYSVSIECGP 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVC---LDTLAGGWTPVMDLQYAVMAVRRLLAEP 117
           KYP  PP++ F  + +  P V   TGEV     +TL   W  + +++  ++ +R+ +A P
Sbjct: 67  KYPDEPPTITFISK-INLPCVDQSTGEVNKEKFNTLK-DWKRLYNMETILLDLRKEMASP 124

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L  +D   +THW  T+ GP  + +E   + + +   +
Sbjct: 7   SFRLLEELEKGEKGMGPESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIYSVAIECGE 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG--GWTPVMDLQYAVMAVRRLLAEPN 118
            YP  PP + F  + +  P V  +TGEV  +  +    W     ++  ++ +R+ +A P+
Sbjct: 67  AYPDQPPKIRFLSK-VNLPCVDQNTGEVKKEQFSTLRDWKRSYTMETLLLDLRKEMALPS 125

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 24/108 (22%)

Query: 3   QRVLREYRRLVAA-----GGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
           +R+ +EY+ +V           NESN+          W   + GPQ TPY+G  +   +T
Sbjct: 8   KRLTKEYKMMVETPPPYITARPNESNI--------LEWHYIIIGPQDTPYDGGQYHGTLT 59

Query: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL-------DTLAGGWT 98
            P  YP  PP++   +   P+   K +T  +CL       DT   GW+
Sbjct: 60  FPSDYPYKPPAI---RMITPNGRFKENT-RLCLSMSDYHPDTWNPGWS 103

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 40.0 bits (92), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 4/119 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L  +D   +T W  T+ GP  + +E   + L +   D
Sbjct: 7   SFRLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLEIVCGD 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG--GWTPVMDLQYAVMAVRRLLAEP 117
           +YP  PP V F  + +  P V   TG V  +       W     +Q  ++ +R+ +  P
Sbjct: 67  RYPDEPPLVKFISK-VNLPCVDQTTGVVSAEKFHTLRDWKRSYTMQTVLLDLRKEMGTP 124

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 39.7 bits (91), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 5/117 (4%)

Query: 4   RVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           R+L E  +     G  + S  L  +D   +T W  T+ GP  + +E   + L +     Y
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIECGPNY 68

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLD--TLAGGWTPVMDLQYAVMAVRRLLAEP 117
           P  PP V F  + +  P V   TGE+  D  TL   W     ++  ++ +R+ +A P
Sbjct: 69  PDSPPKVTFISK-INLPCVNQTTGEIQTDFHTLR-DWKRAYTMETLLLDLRKEMATP 123

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 40.4 bits (93), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 61/138 (44%), Gaps = 15/138 (10%)

Query: 5   VLREYRRLVAAGGAANESNLHPTDPADLTHWEA-TLEGPQGTPYEGHSFPLRVTVPDKYP 63
           +LR++R L          ++   + +++  WE   +   + + Y G      +  P  +P
Sbjct: 13  LLRQFRELRDPRRRMPCFHIELVEKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFPRNFP 72

Query: 64  TLPPSVCFPKRTMPHPNVKWDTGEVCLDTL------------AGGWTPVMDLQYAVMAVR 111
             PP+  F    + HPNV +  G +C+  L            +  W+PV  ++  ++++ 
Sbjct: 73  FSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETVLISII 130

Query: 112 RLLAEPNPESPLNLELAA 129
            LL +PN  SP N++ A 
Sbjct: 131 SLLDDPNVSSPANVDAAV 148

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +T W  T+ GP  + +E   + L +     YP  PP V F  + +  P V   TGEV  D
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISK-INLPCVNPTTGEVQTD 59

Query: 92  --TLAGGWTPVMDLQYAVMAVRRLLAEP 117
             TL  GW     ++  ++ +R+ +A P
Sbjct: 60  FHTLR-GWKRAYTMETLLLDLRKEMATP 86

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 4/119 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L  +D   +T W  T+ GP  + +E   + L +    
Sbjct: 7   SFRLLEELEKGEKGLGPESCSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIECGP 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG--GWTPVMDLQYAVMAVRRLLAEP 117
            YP  PP++ F  + +  P V   TG+V   T      W    +++  ++ +R+ +A P
Sbjct: 67  NYPDHPPTIKFISK-INLPCVDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMATP 124

>NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa]
           {ON} Anc_6.187 YGL087C
          Length = 157

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 54/119 (45%), Gaps = 4/119 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L   D   +T+W  T+ GP  + +E   + + +T   
Sbjct: 26  SFRLLEELEKGEKGKGPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAITCGP 85

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG--GWTPVMDLQYAVMAVRRLLAEP 117
            YP +PP++ F  + +  P V   TGEV   +      W     ++  ++ +R+ +A P
Sbjct: 86  NYPDVPPTIKFISK-INLPCVDDVTGEVKASSFHTLRDWKRSFTMENLLLDLRKEMATP 143

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 38.5 bits (88), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 5/117 (4%)

Query: 4   RVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           R+L E  +     G  + S  L  +D   +T W  T+ GP  + +E   + L +     Y
Sbjct: 9   RLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCGPNY 68

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEVCLD--TLAGGWTPVMDLQYAVMAVRRLLAEP 117
           P  PP V F  + +  P V   TGEV  D  TL   W     ++  ++ +R+ +A P
Sbjct: 69  PDSPPKVTFISK-INLPCVNPTTGEVQTDFHTLR-DWKRAYTMETLLLDLRKEMATP 123

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +T+W  T+ GP  + +E   + + +   + YP  PP + F  + +  P V   TGEV  D
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISK-INLPCVNQTTGEVKRD 59

Query: 92  TLAG--GWTPVMDLQYAVMAVRRLLAEP 117
             +    W    +++  ++ +R+ +A P
Sbjct: 60  QFSTLRDWKRSYNMETLLLDLRKEMALP 87

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 24/108 (22%)

Query: 3   QRVLREYRRLVAAG-----GAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
           +R+ +EY+ LV +         NE N+          W   + GP  TPY+G  +   +T
Sbjct: 8   KRLTKEYKLLVESSPPFILARPNEDNI--------LEWHYIITGPPDTPYDGGQYHGTLT 59

Query: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL-------DTLAGGWT 98
            P+ YP  PP++   +   P+   K +T  +CL       DT   GW+
Sbjct: 60  FPNDYPYKPPAI---RMITPNGRFKENT-RLCLSMSDYHPDTWNPGWS 103

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L  +D   +T+W  T+ GP  + +E   + L +    
Sbjct: 7   SFRLLEELEKGEKGFGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSLEIVCGP 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVC---LDTLAGGWTPVMDLQYAVMAVRRLLAEP 117
            YP  PP V F  + +  P +   TGE+      TL   W     +Q  ++ +R+ +A P
Sbjct: 67  NYPDEPPKVKFVSK-VNLPCIDDKTGEIKEKEFHTLR-DWKRSYTMQTVLLELRKEMALP 124

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L  +D   +T W  T+ GP  + +E   + + +    
Sbjct: 7   SFRLLEELEKGEKGLGPESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIECGP 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL--AGGWTPVMDLQYAVMAVRRLLAEPN 118
            YP  PP V F  + +  P V   TGEV  +       W     ++  ++ +R+ +A P+
Sbjct: 67  SYPDEPPKVKFVSK-INLPCVNSTTGEVVKEKFHTLKEWKRSYTMETVLLELRKEMATPS 125

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL087C
           (MMS2); 1-intron
          Length = 138

 Score = 37.0 bits (84), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 4/117 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L   D   +THW  T+ GP  + +E   + + +    
Sbjct: 7   SFRLLEELEKGEKGMGPESCSYGLADGDDISMTHWNGTILGPPHSSHENRIYSVVIECGA 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG--GWTPVMDLQYAVMAVRRLLA 115
           +YP  PP V F  R +  P V   TGEV  +       W    +++  +  +R+ +A
Sbjct: 67  EYPDRPPKVRFISR-INLPCVDPSTGEVRPEAFHALRDWKRSSNMETLLQDLRKEMA 122

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 35.8 bits (81), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +T W  T+ GP  + +E   + L +     YP  PP+V F  + +  P V   TGEV  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISK-INLPCVSQTTGEVQTN 59

Query: 92  --TLAGGWTPVMDLQYAVMAVRRLLAEP 117
             TL   W     ++  ++ +R+ +A P
Sbjct: 60  FHTLR-DWKRAYTMETLLLDLRKEMATP 86

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 36.6 bits (83), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 26/110 (23%)

Query: 2   SQRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
            +R+ +EY+ +V           NE N+          W   + GP  TPY+G  +   +
Sbjct: 7   QKRLTKEYKMMVENPPPFIIARPNEENI--------LEWHYVISGPPDTPYDGGQYHGTL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKW-DTGEVCL-------DTLAGGWT 98
           T P  YP  PP++      M  PN ++ +   +CL       DT   GW+
Sbjct: 59  TFPSDYPYKPPAI-----RMITPNGRFKENTRLCLSMSDYHPDTWNPGWS 103

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
          Anc_7.392 YER100W
          Length = 251

 Score = 35.8 bits (81), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 17/93 (18%)

Query: 3  QRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
          +R+ +EY+ +V           NE N+          W   + GP  TPYEG  +   +T
Sbjct: 8  KRLTKEYKLIVENPPPYVTARPNEDNI--------LEWHYVITGPPETPYEGGQYHGTLT 59

Query: 58 VPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           P  YP  PP++   +   P+   K +T  +CL
Sbjct: 60 FPSDYPYKPPAI---RMVTPNGRFKENT-RLCL 88

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 35.0 bits (79), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 6/118 (5%)

Query: 4   RVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           R+L E  +     G  + S  L  +D   +T+W  T+ GP  + +E   + + +     Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECGPNY 68

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEV---CLDTLAGGWTPVMDLQYAVMAVRRLLAEP 117
           P  PP + F  + +  P V   TGEV      TL   W     ++  ++ +R+ +A P
Sbjct: 69  PDEPPKIKFVSK-VNVPCVDSTTGEVKSSVFHTLR-DWKRAYTMETLLLDLRKEMATP 124

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 35.4 bits (80), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 53/143 (37%), Gaps = 26/143 (18%)

Query: 3   QRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
           +R+ +EY+ +V           NE N+          W   + GP  TPYEG  +   + 
Sbjct: 8   KRLTKEYKSMVENPPPFIIAQPNEDNI--------LEWHYVITGPPDTPYEGGQYHGTLV 59

Query: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL---DTLAGGWTPVMDLQYAVMAVRRLL 114
            P  YP  PP++   +   P    K DT  +CL   D     W P   +   +  +   +
Sbjct: 60  FPSDYPFKPPAI---RMVTPSGRFKEDT-RLCLSMSDYHPDTWNPSWSVSTILTGLLSFM 115

Query: 115 AEPNPESPLNLELAALSRLGDHK 137
                 +       A++   DHK
Sbjct: 116 TSDESTT------GAITTTSDHK 132

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar
          to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
          Ubiquitin-conjugating enzyme involved in ER- associated
          protein degradation located at the cytosolic side of
          the ER membrane tail region contains a transmembrane
          segment at the C-terminus substrate of the
          ubiquitin-proteasome pathway
          Length = 250

 Score = 35.4 bits (80), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 28 DPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSV 69
          + +++  W   + GP GTPYE   +   +T P  YP  PP++
Sbjct: 30 NESNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAI 71

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 34.7 bits (78), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 6/118 (5%)

Query: 4   RVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPDKY 62
           R+L E  +     G  + S  L  +D   +T W  T+ GP  + +E   + + +     Y
Sbjct: 9   RLLEELEKGEKGLGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRIYSVAIHCGPHY 68

Query: 63  PTLPPSVCFPKRTMPHPNVKWDTGEV---CLDTLAGGWTPVMDLQYAVMAVRRLLAEP 117
           P  PP++ F  + +  P V   TGEV      TL   W     ++  ++ +R+ +A P
Sbjct: 69  PDAPPTIKFVSK-INLPCVDEKTGEVKQASFHTLR-DWKRSYTMETLLLDLRKEMASP 124

>TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 bp,
           139 aa] {ON} Anc_6.187 YGL087C
          Length = 139

 Score = 34.7 bits (78), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 4/120 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L   D   +T W  T+ GP  + +E   + L +    
Sbjct: 7   SFRLLEELEKGEKGMGPESCSYGLADGDDITMTRWNGTILGPPHSNHENRIYSLSIECGP 66

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDT--LAGGWTPVMDLQYAVMAVRRLLAEPN 118
            YP  PP + F  + +  P V   TG+V      L   W     ++  ++ +R+ +A P+
Sbjct: 67  NYPDAPPVLFFISK-INLPCVSPKTGQVMPSEFHLLRDWKRSCTMEKILLELRKEMASPS 125

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 34.7 bits (78), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLD 91
           +T W  T+ GP  + +E   + + +   D+YP  PP+V F  + +  P V   TGEV  +
Sbjct: 38  MTTWNGTILGPPHSNHENRIYSVVIKCGDEYPDKPPTVKFISK-INLPCVDQATGEVETN 96

Query: 92  TLAG--GWTPVMDLQYAVMAVRRLLA 115
                  W     ++  ++ +R+ +A
Sbjct: 97  MFHTLRDWKRSYTMETLLLDLRKEMA 122

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 35.0 bits (79), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  W   + GP  TPY+G  +   +T P  YP  PP++   +   P+   K +T  +CL
Sbjct: 33  NILEWHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAI---RMVTPNGRFKPNT-RLCL 88

Query: 91  -------DTLAGGWT 98
                  DT   GW+
Sbjct: 89  SMSDYHPDTWNPGWS 103

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 31  DLTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCL 90
           ++  W   + GP  TPY+G  +   +T P  YP  PP++   +   P+   K +T  +CL
Sbjct: 33  NILEWHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAI---RMVTPNGRFKPNT-RLCL 88

Query: 91  -------DTLAGGWT 98
                  DT   GW+
Sbjct: 89  SMSDYHPDTWNPGWS 103

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 35.0 bits (79), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 26/109 (23%)

Query: 3   QRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
           +R+ +EY+ +V           NE N+          W   + GP  TPY+G  +   +T
Sbjct: 8   KRLTKEYKLMVENPPPYILARPNEDNI--------LEWHYIITGPADTPYKGGQYHGTLT 59

Query: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWD-TGEVCL-------DTLAGGWT 98
            P  YP  PP++      M  PN ++     +CL       DT   GW+
Sbjct: 60  FPSDYPYKPPAI-----RMITPNGRFKPNTRLCLSMSDYHPDTWNPGWS 103

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 34.3 bits (77), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 50/119 (42%), Gaps = 4/119 (3%)

Query: 2   SQRVLREYRRLVAAGGAANES-NLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60
           S R+L E  +     G  + S  L   D   +T+W  T+ GP  + +E   + + +    
Sbjct: 9   SFRLLEELEKGEKGLGPESCSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAIECGA 68

Query: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLAG--GWTPVMDLQYAVMAVRRLLAEP 117
            YP  PP + F  + +  P V   TGEV  D       W     ++  ++ +R+ +  P
Sbjct: 69  NYPDEPPLIKFVSK-INLPCVDQTTGEVKHDQFHTLRDWKRSYTMETLLLDLRKEMGTP 126

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 34.7 bits (78), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 22/107 (20%)

Query: 2   SQRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRV 56
           ++R+ +EY+ +V         A +E N+          W   + GP  TPYE   +   +
Sbjct: 7   NKRLTKEYKNIVNNPPPFIIAAPHEDNI--------LEWHYVITGPPSTPYENGQYHGTL 58

Query: 57  TVPDKYPTLPPSVCFPKRTMPHPNVKW-DTGEVCL---DTLAGGWTP 99
           T P  YP  PP++      M  PN ++ +   +CL   D     W P
Sbjct: 59  TFPSDYPFNPPAI-----RMITPNGRFKENTRLCLSMSDYHPEAWNP 100

>Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON}
           (176569..176874) [306 nt, 102 aa]
          Length = 101

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 32  LTHWEATLEGPQGTPYEGHSFPLRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVC-- 89
           +T+W  T+ GP  + +    + L +     YP  PP + F  R +  P V  +TGEV   
Sbjct: 1   MTYWNGTILGPPHSNHANRIYSLSIECGPNYPDEPPKIKFISR-VNLPCVDVNTGEVKPT 59

Query: 90  -LDTLAGGWTPVMDLQYAVMAVRRLLAEP 117
              TL   W     ++  ++ +R+ +A P
Sbjct: 60  EFHTLR-DWKRSYTMETILLELRKEMALP 87

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 44/109 (40%), Gaps = 26/109 (23%)

Query: 3   QRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
           +R+ +EY+ +V           NE N+          W   + GP  TPY+   +   +T
Sbjct: 8   KRLTKEYKLMVENPPPYILARPNEDNI--------LEWHYIITGPADTPYKAGQYHGTLT 59

Query: 58  VPDKYPTLPPSVCFPKRTMPHPNVKWD-TGEVCL-------DTLAGGWT 98
            P  YP  PP++      M  PN ++     +CL       DT   GW+
Sbjct: 60  FPSDYPYKPPAI-----RMITPNGRFKPNTRLCLSMSDYHPDTWNPGWS 103

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON}
          Anc_7.392 YER100W
          Length = 251

 Score = 32.3 bits (72), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 19/94 (20%)

Query: 3  QRVLREYRRLVA-----AGGAANESNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVT 57
          +R+ +EY+ +V           NE N+          W   + GP  TPY    +   +T
Sbjct: 8  KRLTKEYKLIVENPPPYIVARPNEDNI--------LEWHYVITGPSDTPYSSGQYHGTLT 59

Query: 58 VPDKYPTLPPSVCFPKRTMPHPNVKW-DTGEVCL 90
           P  YP  PP++      M  PN ++ +   +CL
Sbjct: 60 FPSDYPYKPPAI-----RMITPNGRFKENTRLCL 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,763,137
Number of extensions: 667062
Number of successful extensions: 1642
Number of sequences better than 10.0: 264
Number of HSP's gapped: 1412
Number of HSP's successfully gapped: 264
Length of query: 153
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 53
Effective length of database: 42,014,799
Effective search space: 2226784347
Effective search space used: 2226784347
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)