Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B007703.497ON1038103852020.0
KAFR0C020003.497ON1066107220390.0
Suva_7.4223.497ON1127110519150.0
TDEL0D056503.497ON1077107818760.0
YGR134W (CAF130)3.497ON1122110318640.0
Skud_7.4453.497ON1123109618640.0
ZYRO0D09790g3.497ON1180112418570.0
NCAS0E007703.497ON1150113018470.0
Smik_6.2303.497ON1124111118120.0
SAKL0F02596g3.497ON1132111517220.0
Kwal_47.188863.497ON1105110116680.0
KLTH0G02442g3.497ON1113110216590.0
AFR316W3.497ON1191117216510.0
NDAI0G009003.497ON127988616080.0
Kpol_480.123.497ON1114111515850.0
TBLA0C045103.497ON1307109415430.0
Ecym_12323.497ON1204103815330.0
CAGL0I10428g3.497ON1163110814440.0
TPHA0A056803.497ON107498413191e-164
KLLA0E03961g3.497ON113211399371e-108
NDAI0A032904.99ON337121781.0
YGR048W (UFD1)1.89ON36197762.3
Skud_11.1792.590ON92056753.7
Kpol_1028.755.31ON198285735.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00770
         (1038 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...  2008   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   790   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   742   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   727   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   722   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   722   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   719   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   716   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   702   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   667   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   647   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   643   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   640   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   624   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   615   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   598   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   595   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   560   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   512   e-164
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   365   e-108
NDAI0A03290 Chr1 complement(745888..746901) [1014 bp, 337 aa] {O...    35   1.0  
YGR048W Chr7 (589826..590911) [1086 bp, 361 aa] {ON}  UFD1Substr...    34   2.3  
Skud_11.179 Chr11 complement(322462..325224) [2763 bp, 920 aa] {...    33   3.7  
Kpol_1028.75 s1028 complement(168225..174173) [5949 bp, 1982 aa]...    33   5.9  

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score = 2008 bits (5202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 976/1038 (94%), Positives = 976/1038 (94%)

Query: 1    MDSRVPQFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEE 60
            MDSRVPQFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEE
Sbjct: 1    MDSRVPQFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEE 60

Query: 61   ALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDF 120
            ALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDF
Sbjct: 61   ALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDF 120

Query: 121  VNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLILNKGT 180
            VNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLILNKGT
Sbjct: 121  VNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLILNKGT 180

Query: 181  PDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVYEFDLDEETHNGS 240
            PDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVYEFDLDEETHNGS
Sbjct: 181  PDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVYEFDLDEETHNGS 240

Query: 241  GNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVS 300
            GNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVS
Sbjct: 241  GNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVS 300

Query: 301  XXXXXXXXXXXXPKNQDTEQNDTFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGD 360
                        PKNQDTEQNDTFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGD
Sbjct: 301  LDLLYKLFLAFLPKNQDTEQNDTFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGD 360

Query: 361  NSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWK 420
            NSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWK
Sbjct: 361  NSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWK 420

Query: 421  NLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHE 480
            NLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHE
Sbjct: 421  NLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHE 480

Query: 481  PLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMF 540
            PLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMF
Sbjct: 481  PLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMF 540

Query: 541  EYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDDKIIQS 600
            EYEYEDYNLVDFEDEDED                  NEGTGASQKRRCNCIFTDDKIIQS
Sbjct: 541  EYEYEDYNLVDFEDEDEDAAAAATTATASAAAITAANEGTGASQKRRCNCIFTDDKIIQS 600

Query: 601  DESKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRN 660
            DESKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRN
Sbjct: 601  DESKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRN 660

Query: 661  VSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDDGLLTPDNIYD 720
            VSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDDGLLTPDNIYD
Sbjct: 661  VSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDDGLLTPDNIYD 720

Query: 721  AWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGL 780
            AWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGL
Sbjct: 721  AWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGL 780

Query: 781  RGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAA 840
            RGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAA
Sbjct: 781  RGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAA 840

Query: 841  IFLXXXXXXXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNW 900
            IFL             DVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNW
Sbjct: 841  IFLSASESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNW 900

Query: 901  LGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFPTLTXXXXXXXXVAENLSE 960
            LGIVPDAQELFFLLKKNISD           SALGAPGDIFPTLT        VAENLSE
Sbjct: 901  LGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDIFPTLTDADDDNNAVAENLSE 960

Query: 961  FNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATP 1020
            FNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATP
Sbjct: 961  FNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATP 1020

Query: 1021 ERTVTLREYLGSYDGAVL 1038
            ERTVTLREYLGSYDGAVL
Sbjct: 1021 ERTVTLREYLGSYDGAVL 1038

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/1072 (42%), Positives = 644/1072 (60%), Gaps = 132/1072 (12%)

Query: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEEALSKYIHLFF 70
            LLE  V++LFTT  G  +  +L   D          S + Q+   +W E +     + + 
Sbjct: 53   LLEGLVISLFTTKSGHSILSVLNNPDAN--------SELFQRY-NSWLESSSGDLNYKYL 103

Query: 71   QH-VWRDAGDR----------------FAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTD 113
            +H +W+   +                 F +  Y+   +KL++  L  SE +   L+LN+D
Sbjct: 104  KHELWQSNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSD 163

Query: 114  -YDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRD 172
             Y++LLDF+   +P +  LI   V+G+    I+ KY R+YE + +  W+ L+     +  
Sbjct: 164  NYNLLLDFIMFFQPYMNDLISYIVEGNKFFEIIAKYNRIYELNGFHTWYTLTIASNTSIA 223

Query: 173  VLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKY------------QQ 220
            V  LN                    DV  + P + + F  N   K             QQ
Sbjct: 224  VRYLN--------------------DVLSIDPMITDQFTSNYRDKAFQESEETLLMSQQQ 263

Query: 221  LGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKC 280
               ++ ++ FDL+E     +G+     +L++ S  RH+I+  +LNL +IDSP L +QF  
Sbjct: 264  TAKDDIIFSFDLNE-----TGDLP---NLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLL 315

Query: 281  MISLVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDTE------QNDTFLLCFNMQKII 334
            +  LVDPLTQP P++ +++S             K  + E      +   F +CFNMQKII
Sbjct: 316  ICGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKII 375

Query: 335  TRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAV 394
            +R+L  L C DY  L++I       ++   +Y+  L +W+P+G+NTQDLEL+YM++I+A+
Sbjct: 376  SRSLVLLNCNDYDTLSTIL------NDFPNDYKTALNKWLPHGINTQDLELIYMINIIAI 429

Query: 395  YTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRG 454
            YTIY  YS+LPIQLNPFL  L+SLWK LS ++L+ LE+DR EE+N+T+DTP++VRATIRG
Sbjct: 430  YTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRG 489

Query: 455  ASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLG- 513
            A+ALRAV+A +LN HV   EHDFKHE  NTFMSPHGRKLC G+L ADLRSHAAA+L+LG 
Sbjct: 490  AAALRAVIATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGD 549

Query: 514  VDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXX 573
             +L DVTELL+DLQ GDRFDED++Y+FEYEY+DYN +  EDE  +               
Sbjct: 550  GELHDVTELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQTNELEELEKR------- 602

Query: 574  XXXNEGTGASQKRRCNCIFTDDKIIQ-------SDESK---VSLGGGKNR--PYSVRTKS 621
                    + +KRRCNCIF DDK+++        +ES+   ++L   K+R  PYSVR  S
Sbjct: 603  --------SVKKRRCNCIFEDDKMLEDYEYYEVGNESRREDMNLESDKSRTNPYSVRVNS 654

Query: 622  SFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLNPMESQQLLKL 681
             FEFDYSG DWRDVPRG NLY+ PSYEF+  P L    + + KA   KL+  +S  LL+ 
Sbjct: 655  IFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQS 714

Query: 682  VASAIKIEQECIIMGTVYPQTEGIAVGD--DGLLTPDNIYDAWFQDKVFDRILFMNQELA 739
            VAS +K+EQE +I+   Y  T+  +  +  D  +TPD++Y+ W ++  F+R++++N+E+A
Sbjct: 715  VASCVKLEQEKMILEN-YSNTKNCSTEEDLDREVTPDDVYEIWCEESAFERMIYLNKEVA 773

Query: 740  WKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQAL 799
            W+LMDE+LMC+GYRRVL+WF+THME+NHS++HYIFELVMGLRGQ   +    +++ K  L
Sbjct: 774  WRLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLL 833

Query: 800  HNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIFLXXX-XXXXXXXXXXDV 858
               M  D      + FSRQG++ LSEIE KMLLQEFFTNAAIF               +V
Sbjct: 834  LQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSENV 893

Query: 859  SLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNI 918
            SLY+IGLVKLICFMVKTL+ N KF+FSKSECTFELQTLLMNW+GI+P+AQELFF LK N+
Sbjct: 894  SLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANV 953

Query: 919  SDXXXXXXXXXXXSALGAPGDIFPTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGK 978
             +            ++    D   T +            LS +N KL+ LLP  T S  +
Sbjct: 954  GE-----------PSMEGKSDSDGTDSNEGE--------LSWYNSKLLALLPSPTNSGLE 994

Query: 979  GSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYL 1030
                AI+ LR+F++K+S ++++PV+GR+++ +  +ILP     + + LRE +
Sbjct: 995  NP--AIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELI 1044

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1105 (38%), Positives = 628/1105 (56%), Gaps = 137/1105 (12%)

Query: 7    QFDSLLEECVVTLFTTYRGQHVCQMLE-----QLDLGVFSLSKTPSRIVQQVRTAWTEEA 61
            +F  L E   VTLFTT  G+ + Q ++     +      S     S     +R +W E+ 
Sbjct: 68   RFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR-SWKEDD 126

Query: 62   LSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDFV 121
            +   +  F + +  +      I +YN P +KL +S L  S+ +   ++LN  Y++L D++
Sbjct: 127  V--LLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNMLKDYL 184

Query: 122  NTVRPQLKGLI---------RQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFA--- 169
              +  +++GLI          +  +G+L     ++Y R+ EF +++ W++ S +K A   
Sbjct: 185  YAISGRMEGLIWCNSTFDQSARIFKGTL-----QQYDRMIEFRNFYFWYSFSAEKNATPK 239

Query: 170  -NRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVY 228
             N ++ +L     D     ++S       D H   P         + + ++ +   E +Y
Sbjct: 240  LNHNINLLMDSYEDNLDG-VSSVDDAGKSDNHQKQP--------KDTIIHRTVNDQEQIY 290

Query: 229  EFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPL 288
             F+L+++     G   +  ++M+ S  RHE+L ++LNL  + +P L +QF  +  LVDPL
Sbjct: 291  SFELNQD-----GTLQIP-NVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPL 344

Query: 289  TQPPPSDTYVVSXXXXXXXXXXXXPKNQDTEQNDT------FLLCFNMQKIITRTLWRLK 342
            TQP P+D +++S              +  T Q         F +CFNMQKII  T+ RL 
Sbjct: 345  TQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLN 404

Query: 343  CWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYS 402
            C+ + KL SI+       +   ++R  L  W+P+GLNTQDLELLYM+DI+AVYTIY  Y 
Sbjct: 405  CFGFEKLNSINNT-----DDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYE 459

Query: 403  HLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVV 462
             +PIQLNPFL  L+SLWKNLS V+LL+LE+DR EE   T++TPL+VRATIRGA+ALR+V+
Sbjct: 460  EIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVI 519

Query: 463  ACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTEL 522
            A VLNG V+ N+HDFKHE LNTFMSP+GRKLC G+LYADLRSH A++L+LG  +EDVT+L
Sbjct: 520  AAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDL 579

Query: 523  LSDLQPGDRFDEDIRYMFEYEYEDYN--LVDFEDEDEDXXXXXXXXXXXXXXXXXXNEGT 580
             +DLQ GDRFDEDIRYMF+YE EDYN    D  DE+                     EG 
Sbjct: 580  FADLQSGDRFDEDIRYMFDYECEDYNESFSDCGDEE-------------------LGEGV 620

Query: 581  GASQK-----------RRCNCIFTDDKIIQSDESKVSL-------------GGGKN---- 612
             + +K           RRCNCIF DDK++  D +  S                G N    
Sbjct: 621  NSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGANASTNNDSIKNEIRSDGNAGSNTAIT 680

Query: 613  ---------RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSS 663
                      PYSVR++S+FEFDYSG DWRDVP+  N+Y+ PSY F+  P L    N++ 
Sbjct: 681  NANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTL 740

Query: 664  KAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQ----TEGIAVGDDGL------- 712
            + A  KL+  ES  L++ VAS +K EQ+ +I+  +        E    GD G+       
Sbjct: 741  RGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTND 800

Query: 713  -----LTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNH 767
                  TPD+IY+ W ++  F+R+L++N ++AW+LMDE+LMC GYRR+L+WF+TH+EL H
Sbjct: 801  EELRRTTPDDIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKH 860

Query: 768  SVIHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGT--LMFSRQGNLALSE 825
            S+I+Y+FEL+MGLRG   S + + ++++   ++ +++    N  T  L FSRQG + LS+
Sbjct: 861  SLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSD 920

Query: 826  IEVKMLLQEFFTNAAIFLXXXXXXXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFS 885
            IE KMLLQEFF NAAIFL              VSLYS+GLVKLIC+MV+TLI N KF F+
Sbjct: 921  IETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVSLYSLGLVKLICYMVQTLIANDKFFFT 980

Query: 886  KSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFPTLT 945
            KSECTFELQTLLM W+GI+P+A++LFF +K  ++                   D+     
Sbjct: 981  KSECTFELQTLLMTWIGILPEAKDLFFQIKSRLAMEEDGITDNTVQHKDKTDLDL----- 1035

Query: 946  XXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGR 1005
                      +++S+ N K++ L P +  +E   +S AI  LR+F+  +S  +++   GR
Sbjct: 1036 --DSGKKPNTKSISKLNMKILSLFP-SNPTENDDNS-AISTLRSFITDYSFDTQVVAPGR 1091

Query: 1006 RIVRRGSQILPQATPERTVTLREYL 1030
            R+V    +ILP    ++ + L EY+
Sbjct: 1092 RVVFHDDKILPLPKADKPIPLHEYI 1116

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1078 (41%), Positives = 607/1078 (56%), Gaps = 116/1078 (10%)

Query: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEEALSKYIHLFF 70
            + E  ++ LFTT  G  +        L +FS S    R+  +V     +E L   +  FF
Sbjct: 50   ICETLIIALFTTRAGISL--------LPLFSESAKRKRVGPRVLEWHNDEEL---MLRFF 98

Query: 71   QHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDFVNTVRPQLKG 130
             ++  +   R     + +  +KL +  L  S+F  A +VL+ +Y++LLD+V+T+ P +K 
Sbjct: 99   SYILENRSSRIEPRLFEKARWKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTITPMIKR 158

Query: 131  LIRQA-VQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLIL------NKGTPDL 183
             + +A  QG+     V  Y RVYE  D   W++   KK       I       ++   D 
Sbjct: 159  WVHRAFTQGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLRENSEQVLDT 218

Query: 184  FHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVYEFDLDEETHNGSGNR 243
            +H  +     +A  D    H                ++  +E+VY FD+     N  G+ 
Sbjct: 219  YHEMVRPSNERAINDTASYH---------------HRISQHENVYSFDI-----NQDGSL 258

Query: 244  TVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVSXXX 303
             +  ++M  ++ RH+IL  ++ L   DSP L  QFK M  LVDPLTQPPP+D +++S   
Sbjct: 259  EIP-NIMSHASVRHDILQNLMRLPLCDSPLLQWQFKLMAGLVDPLTQPPPNDKHIISLDL 317

Query: 304  XXXXXX-XXXPKNQDTEQND----TFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTE 358
                      P   +T  +D     F LCFNMQKII  +L RL   D+  L SI+     
Sbjct: 318  LYQMLLGLMEPAISNTLGSDGCDWKFHLCFNMQKIIQASLKRLNLQDFDTLNSIN----- 372

Query: 359  GDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISL 418
              +   ++RD+L  W+P+GLNTQ+LEL+YM+DI+AVYTIY  Y  LP+QLNPFLS +ISL
Sbjct: 373  NSDEDVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPVQLNPFLSPMISL 432

Query: 419  WKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFK 478
            WKNL+ V+LL LE+DR EE ++TF+TP+LVRATIRGA+ALRAVVA +LNGHV   +HDF 
Sbjct: 433  WKNLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATILNGHVDTYKHDFM 492

Query: 479  HEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRY 538
            HEPLNTFMSPHGRKLCQG+LYADLRSHAAA+L+LG +LEDVT LL+DLQ GDRFDED+RY
Sbjct: 493  HEPLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADLQAGDRFDEDVRY 552

Query: 539  MFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXXXXXNEGTGASQKRRCNCI------- 591
            MFEYE ++YN  D E E +                           +RRCNCI       
Sbjct: 553  MFEYECDNYNEGDSESEKDGKLAVEQPKIL----------------QRRCNCIFDDDEMA 596

Query: 592  -------------FTDDKIIQSDESKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRG 638
                         F+   I+Q +           +P +VR+  +FEFDYSG DWRD+PRG
Sbjct: 597  EDEDFDGENDEAFFSKHLILQQNAQTSLSMSSSGKPRAVRSGGAFEFDYSGKDWRDIPRG 656

Query: 639  LNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTV 698
             N Y+ P +EF+  P L+    ++ KA+  KL   ES  LL+ VAS +K EQ+ I +G +
Sbjct: 657  SNFYYSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGNL 716

Query: 699  YPQTEGIAVGDDGL----LTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRR 754
                +     ++      + PD+IY+ W ++  F++I++ N  LAWKLMDE+L+C GYRR
Sbjct: 717  IDPHQDSQADEESRNADKIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRR 776

Query: 755  VLLWFVTHMELNHSVIHYIFELVMGLRGQ--ELSADVTLEEQRKQALHNLMEIDTPNGG- 811
            VL+WF+THMELNHS+IHYIFELVMGLRG   E   DV L      A   L ++D   G  
Sbjct: 777  VLIWFITHMELNHSLIHYIFELVMGLRGNSDENDRDVDL------AGPPLQDVDKVKGEL 830

Query: 812  TLMFSRQGNLALSEIEVKMLLQEFFTNAAIFLXXXXXXXXXXX--------------XXD 857
            ++ FSRQG L LS IE KMLLQEFFTNAAIF+                           +
Sbjct: 831  SVGFSRQGALQLSTIETKMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSEN 890

Query: 858  VSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKN 917
            VSLY++GL+KLICFMV+T I   KF+FS+SEC FELQ LLMNW+GI+P+A+ LFF LK  
Sbjct: 891  VSLYAMGLMKLICFMVRTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSL 950

Query: 918  ISDXXXXXXXXXXXSALGAPGDIFPTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEG 977
            I+            +A     D    +               EFN+KL+ LLP   ++  
Sbjct: 951  IAGFSTATSVQEQKNA-EVKNDTQEDVPKEQSPVRVSNTAGFEFNRKLMTLLPPLVKN-- 1007

Query: 978  KGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYLGSYDG 1035
            K  + A+  LR+F++  S  + +PV+GR+IV    +ILP    +  + L EY+  YDG
Sbjct: 1008 KEENAAMQTLRSFIKTSSFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI-DYDG 1064

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1103 (38%), Positives = 622/1103 (56%), Gaps = 144/1103 (13%)

Query: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWT---EEALSKYIH 67
            LLE  ++TLFTT  G+   ++++   L              + R +W    E   S Y  
Sbjct: 70   LLEALIITLFTTISGKSALRLIQTSSL--------------KERKSWAQSFENNSSSYAS 115

Query: 68   LFFQHVWRD------------AGDRFAIMQ---YNEPAFKLQVSDLFPSEFSKARLVLNT 112
            +     W+D              ++ A +Q   YN P +KL +S L  S+ +   ++LN 
Sbjct: 116  IVLS--WKDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNE 173

Query: 113  DYDVLLDFVNTVRPQLKGLIRQAVQ----GSLVDPIVRKYGRVYEFHDYFHWFNLSKKK- 167
             Y++L D++ ++  +++ LI  +        +V  I++ Y R+ E  +++ W++ + +  
Sbjct: 174  TYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENR 233

Query: 168  ----FANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGT 223
                F++   L++     +      +S   +  +   P    +G           + +  
Sbjct: 234  VNLTFSDNISLLMENDEGNAGSGLDDS---RFDHQKQPREAIMG-----------RTIND 279

Query: 224  NEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMIS 283
             E +Y F+L+++     G   +  ++M+ S  RHE+L ++LNL  + +P L  QF  +  
Sbjct: 280  QEQIYSFELNQD-----GTLEIP-NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCG 333

Query: 284  LVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDT--EQND----TFLLCFNMQKIITRT 337
            LVDPL QP P+D +++S             ++  T  E ND     F +CFNMQKII  T
Sbjct: 334  LVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDAT 393

Query: 338  LWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTI 397
            + RL C+D+  L S++      DN+ + ++  L  W+P+GLNTQDLELLYM+DI+AVYTI
Sbjct: 394  MLRLNCFDFDILNSVNNT----DNAVH-WKTQLHRWLPHGLNTQDLELLYMIDILAVYTI 448

Query: 398  YNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASA 457
            Y  Y  +PIQLNPFL  LISLWKNLS V+LL+LE+DR EE N T++TPL+VRATIRGA+A
Sbjct: 449  YKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAA 508

Query: 458  LRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLE 517
            LR+V+A VLNG V+ N+HDFKHE LNTFMSP+GRKLC G+LYADLRSH A++L+LG  +E
Sbjct: 509  LRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIE 568

Query: 518  DVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXXXXXN 577
            DVT+L +DLQ GDRFDEDIRYMF+YE EDY        DE                    
Sbjct: 569  DVTDLFADLQSGDRFDEDIRYMFDYECEDY--------DESFSESDHGGLDESVVNPTEK 620

Query: 578  EGTGASQ---KRRCNCIFTDDKIIQSDESKVSLGGG----------KNR----------- 613
              +G++    +RRCNCIF DDK++  D +  + G             NR           
Sbjct: 621  IASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATS 680

Query: 614  --------PYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKA 665
                    P SVR++S+FEFDYSG DWRDVPR  N+Y+ PSY F+  P L    +++ + 
Sbjct: 681  DHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRG 740

Query: 666  AGGKLNPMESQQLLKLVASAIKIEQECIIM--------GTVYPQTEG--------IAVGD 709
            A  KLN  ES  L++ VAS ++ EQ+ +I+         ++    EG        I   D
Sbjct: 741  ATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNED 800

Query: 710  DGLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSV 769
                TPD+IY+ W ++  F+R+L +N ++AW+LMDE+LMC GYRR+L+WF+TH+EL HS+
Sbjct: 801  LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSL 860

Query: 770  IHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPN--GGTLMFSRQGNLALSEIE 827
            I+Y+FEL+MGLRG+  S + + ++++   ++ +++    N     L FSRQG + LS+IE
Sbjct: 861  IYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIE 920

Query: 828  VKMLLQEFFTNAAIFLXXXXXXXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKS 887
             KMLLQEFF NAAIFL              +SLYS+GLV+LIC+MV+TLI N KF F+KS
Sbjct: 921  TKMLLQEFFMNAAIFLSSKNNEEENEDGEKISLYSLGLVRLICYMVQTLIANDKFFFTKS 980

Query: 888  ECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFPTLTXX 947
            ECTFELQTLLM W+GI+P+A++LFF +K  ++                   DI   L   
Sbjct: 981  ECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSADTMQHEG-RKNSDIEKKLN-- 1037

Query: 948  XXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRI 1007
                   A+  SE N KL+ L P  ++   K  S  I+ LR+F+  +S  +++   GRR+
Sbjct: 1038 -------AKPASELNLKLLNLFP--SKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRV 1088

Query: 1008 VRRGSQILPQATPERTVTLREYL 1030
            V    +ILP    ++ + L EY+
Sbjct: 1089 VFYDGKILPLPKADKPIPLHEYI 1111

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1096 (38%), Positives = 622/1096 (56%), Gaps = 109/1096 (9%)

Query: 1    MDSRVPQFDSLLEECVVTLFTTYRGQHVCQ-----MLEQLDLGVFSLSKTPSRIVQQVRT 55
            +D +  +   L E   + LFTT  G+ + Q      L++  L   SL    S     V+ 
Sbjct: 60   LDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQ- 118

Query: 56   AWTEEALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYD 115
             W +  +     L F    +       I +YN P +KL +S L  S+ +   ++LN  ++
Sbjct: 119  GWKDNDVLFLKFLRFLLANKTTS--LQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHN 176

Query: 116  VLLDFVNTVRPQLKGLIR----QAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKK----- 166
            +L D++ ++  ++  LIR     +    +V  I++ Y R+ EFH+ + W++ + +     
Sbjct: 177  MLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNF 236

Query: 167  KFANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEH 226
            +F++   L++N          I+  C       H             N +  + +   E 
Sbjct: 237  EFSDNFDLLMNSPEDHADGGVIDDRCKSDNPQKH-----------AKNTIIKRTINDQEQ 285

Query: 227  VYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMISLVD 286
            +Y F+LD++     G   +  ++M+ S  RHE+L ++LNL  + +P L  QF  +  LVD
Sbjct: 286  IYSFELDQD-----GTLQIP-NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVD 339

Query: 287  PLTQPPPSDTYVVSXXXXXXX-XXXXXPKNQDT-EQND----TFLLCFNMQKIITRTLWR 340
            PL QP P+D  V+S             P  + + E ND     F  CFNMQKII  T+ R
Sbjct: 340  PLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLR 399

Query: 341  LKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNA 400
            L C D+ +L S++       +S  ++R  L +W+P+GLNTQDLELLYM+DI+A+YTIY  
Sbjct: 400  LNCSDFERLNSVNNT-----DSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKL 454

Query: 401  YSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRA 460
            Y  +PIQLNPFL  L+SLWKNLS V+LL+LE+DR EE N T++TPL+VRATIRGA+ALR+
Sbjct: 455  YEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRS 514

Query: 461  VVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVT 520
            V+A VLNG V+ N+HDFKHE LNTFMSP+GRKLC G+LYADLRSH A++L+LG  +EDVT
Sbjct: 515  VIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVT 574

Query: 521  ELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXXXXXNEGT 580
            +L +DLQ GDRFDEDIRYMF+YE EDYN    E +DE                   +  +
Sbjct: 575  DLFADLQSGDRFDEDIRYMFDYECEDYNEPFSESDDE------QLNEDANSRGKIKSSSS 628

Query: 581  GASQKRRCNCIFTDDKIIQSDESKVS--LGGGKN-------------------------- 612
                +RRCNCIF DDK++  D +  +  + G  N                          
Sbjct: 629  NGFYQRRCNCIFNDDKLVAEDGTNEAFEISGNSNMENEMPNNVNVIPSTATTNSNRFASS 688

Query: 613  -RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLN 671
              P SVR++S+FEFDYSG DWRDVP+  N+Y+ PSY F+  P L    N++ + A  KLN
Sbjct: 689  INPLSVRSRSTFEFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLN 748

Query: 672  PMESQQLLKLVASAIKIEQECII---MGTVYPQ---------TEGIAVGDDGLL---TPD 716
              +S  L+  VAS +K EQ+ +I   +G+ + +         +  I   ++  L   TPD
Sbjct: 749  RDDSIVLVCSVASCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPD 808

Query: 717  NIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFEL 776
            +IY+ W ++  F+R+L +N ++AW+LMDE+LMC GYRR+L+WF+TH+EL HS+I+Y+FEL
Sbjct: 809  DIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFEL 868

Query: 777  VMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGT--LMFSRQGNLALSEIEVKMLLQE 834
            VMGLRG+  S + + ++++   ++ +++    N     L FSRQG + LS+IE KMLLQE
Sbjct: 869  VMGLRGKPFSGEASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQE 928

Query: 835  FFTNAAIFLXXXXXXXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQ 894
            FF NAAIFL              +SLYS+GLVKLIC+MV+TLI N KF F+KSECTFELQ
Sbjct: 929  FFMNAAIFLSSKNDEEENEDGEKISLYSLGLVKLICYMVQTLIANDKFLFTKSECTFELQ 988

Query: 895  TLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFPTLTXXXXXXXXV 954
            TLLM W+G++P+A++LFF +K  ++               G   D    L          
Sbjct: 989  TLLMTWIGVLPEAKDLFFQIKTRLA-------MEEDSDKDGQQNDDNKDLEVERRPH--- 1038

Query: 955  AENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQI 1014
             ++ SE N KL+ L P  +   G   + AI  LR+F+  +   ++I   GR++V    +I
Sbjct: 1039 TKSNSELNVKLLNLFP--SNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKI 1096

Query: 1015 LPQATPERTVTLREYL 1030
            LP +  ++ + L EY+
Sbjct: 1097 LPLSKADKPIPLHEYI 1112

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  719 bits (1857), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1124 (40%), Positives = 626/1124 (55%), Gaps = 139/1124 (12%)

Query: 7    QFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVR------------ 54
            ++  LLE  +V L TT  G  V  +L+       S    P  I  Q +            
Sbjct: 84   KYSLLLEMVIVALLTTRAGLSVLALLKPSG----SNPSIPKCISNQRKWLAQVERKGKLH 139

Query: 55   ----TAWT--EEALSKYIHLFFQH--VWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKA 106
                + W   ++   K++H   ++  VW            N+  +K+ +S L  S++  A
Sbjct: 140  SDLISQWQSDDDIFLKFLHFLLKNEDVW------LPCENVNQCEWKVPLSFLIQSKYRAA 193

Query: 107  RLVLNTDYDVLLDFVNTVRPQLKGLIRQAV---QGSLVDPIVRKYGRVYEFHDYFHWFNL 163
             L+L+  Y++L+D+   V P  +  +R+A+    G  +   V  Y RVY+F  YF W+ L
Sbjct: 194  ELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTL 253

Query: 164  ----SKKKFANRDVLILNKGTPDLFHYYINSFCSK--------------APYDVHPLH-- 203
                S   F ++ +L     + D     ++   S               A  D+      
Sbjct: 254  QTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLN 313

Query: 204  -PFLGE----LFEGNNNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHE 258
              F G+      E  ++  + Q+  NE V+ FDL     N  G+  +  +LM  +  RHE
Sbjct: 314  SGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDL-----NQDGSLELP-NLMSHAAVRHE 367

Query: 259  ILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVSXXXXXXXXXX-XXPKNQD 317
            IL ++L L    SP L  QFK +  LVDPLTQP P+D +V+S             P+ Q 
Sbjct: 368  ILMKVLKLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQ 427

Query: 318  TEQNDT-----FLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKE 372
            T + +      F +CFNMQKII  +L RL   D+ +L SI+      D     +R  L +
Sbjct: 428  TLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVD-----WRSQLDK 482

Query: 373  WVPNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEV 432
            W+P+G NTQDLEL+ MVDI+AVYTIY  Y HLPIQLNPFLS LISLWKNL+ V+LL LE+
Sbjct: 483  WLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEI 542

Query: 433  DRCEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRK 492
            DR EE  +TFDTPL+VRATIRGA+ALRA+VA VLNGHV   +HD KHE LNTFMSPHGRK
Sbjct: 543  DRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRK 602

Query: 493  LCQGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDF 552
            LCQG+LYA+LRSHAAA+L+LG +LEDVT L SDLQPGDRFDED+RYMFEYE+EDYN  D 
Sbjct: 603  LCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYN--DL 660

Query: 553  EDEDEDXXXXXXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDDKIIQSDESKVSLGGGK- 611
               +ED                   +G G    RRCNCIF DD++++ ++ +    G K 
Sbjct: 661  SSREEDYSGFDKYDDYTDSSKTHARKGFG----RRCNCIFDDDEMLEDEDYENEYEGHKA 716

Query: 612  -------------------NRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLAR 652
                                +P+++R+  SFEFDYSG DWRD+PR  NLY+ P+Y F+  
Sbjct: 717  PKQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVED 776

Query: 653  PGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYP-----QTEGIAV 707
                   ++++KA    L+ +ES  LL  VA+ +K EQ+ I++G +        + G  V
Sbjct: 777  LDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQV 836

Query: 708  GDD-GLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELN 766
             D    ++PD+IY+ W +D  F+++++ N E+AW+LMDE+LMC G+RRVL+WF+THMELN
Sbjct: 837  IDKLKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELN 896

Query: 767  HSVIHYIFELVMGLR------GQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGN 820
            HS+IHYIFELVMGLR       +  + D ++ E  K+A     E+ T    +L FSRQG+
Sbjct: 897  HSLIHYIFELVMGLRKSFDENNENDNGDESISEMTKEA----PEVRT----SLPFSRQGS 948

Query: 821  LALSEIEVKMLLQEFFTNAAIFLXXXX------------XXXXXXXXXDVSLYSIGLVKL 868
            + LS IE KMLLQEFFTNAAIFL                         +VSLY++GL+KL
Sbjct: 949  IQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKL 1008

Query: 869  ICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXX 928
            IC MV+  I   KF+F +SEC FELQTLLMNW+ I+P+A++LFF LK  +++        
Sbjct: 1009 ICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDD 1068

Query: 929  XXXSALGAPGDIFPTLTXXXXXXXXVAENL--SEFNKKLVMLLPRATQSEGKGSSQAIDA 986
               S    P D    L+               SE+N+KL+ LL        K  + A+ A
Sbjct: 1069 EELS--NNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISLLSPVMHR--KEENAAVVA 1124

Query: 987  LRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYL 1030
            LRNF++K+S  + +P++GR++V  G++ILP    E  ++L +YL
Sbjct: 1125 LRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYL 1168

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1130 (39%), Positives = 612/1130 (54%), Gaps = 157/1130 (13%)

Query: 7    QFDSLLEECVVTLFTTYRGQHVCQML-----EQLD----------LGVFSLSKTPSRIVQ 51
            Q  SLL ECV+  F + R   + Q        Q D          L    +SKT     Q
Sbjct: 67   QEHSLLVECVIIGFLSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAH---Q 123

Query: 52   QVRTAWTEEALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFS-KARLVL 110
             +R  W+   L  Y   F + +  +A     + +Y EP +KL ++ LF    +     +L
Sbjct: 124  YLRKKWSSNKL--YFLKFTKFLLVNADGNINVDKYTEPIYKLPLNFLFDDNTNLMPTFIL 181

Query: 111  NTDYDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFAN 170
            +  Y++L D++    P LK +++  ++  +   +   Y    +    + W++L       
Sbjct: 182  DNKYNLLQDYIYACGPLLKCVMKDTLENGICLDLPGIYKLDIDLQFPYPWYDL------- 234

Query: 171  RDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGTNEHVYEF 230
                      P +   ++N+       +  PL      +              N+ VY F
Sbjct: 235  ---------LPPMHEGHLNATKQNNNSNNIPL-----TMQPSIKTNNNGANNNNQTVYSF 280

Query: 231  DLDEETHNGSGNRTVAVD-LMQQSNQRHEILTRMLNLKEIDS-PHLYEQFKCMISLVDPL 288
            DL+ +       +T  +D ++  + +RH +L +++N  ++ + P L  QF  M  LVDPL
Sbjct: 281  DLNTD-------KTFELDNVVSHTAKRHRVLNQLINNNDLKTTPLLTLQFTFMAGLVDPL 333

Query: 289  TQPPPSDTYVVSXXXXXXX-XXXXXPK-----NQDTEQNDTFLLCFNMQKIITRTLWRLK 342
            +QPPP++  V+S             P      N +   N  F +CFNM K+I  ++  LK
Sbjct: 334  SQPPPNNKQVISLHLLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILK 393

Query: 343  CWDYAKLTSISK------KQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYT 396
            C ++ KL  I        + TE D+    ++  L EW+P+G+NTQDLEL+YM++IMAVYT
Sbjct: 394  CDNFNKLNDIINSNNDNDEGTENDDDDA-WKLKLNEWIPHGINTQDLELIYMINIMAVYT 452

Query: 397  IYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGAS 456
            IY  YS LPIQ+NPFLS LI+LWKNLSA++LL L++DR EEA  TF TPLLVRATIRGA+
Sbjct: 453  IYQLYSDLPIQMNPFLSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAA 512

Query: 457  ALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDL 516
            +LRAVVA +LN HV  NEHDFKHEPLNTFMSPHGRKLCQG+LYAD+RSHAAA+L+LG +L
Sbjct: 513  SLRAVVATILNNHVDVNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALGAEL 572

Query: 517  EDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXXXXX 576
            EDVT+LL+DLQ GDRFDEDIRYMF+YEY+DYN  DF+D+ E+                  
Sbjct: 573  EDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYN--DFKDDVEEQEEMEIM----------- 619

Query: 577  NEGTGASQKRRCNCIF----------------------------------TDDKIIQSDE 602
                  S  RRCNCIF                                  T D    +  
Sbjct: 620  -----GSFPRRCNCIFEDDNIINDDTDNINENDEDDDDEQEEYVDAIEGVTKDTPHNNLN 674

Query: 603  SKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVS 662
               ++    + P S R+KSSFEFDY G DWRD+PRG NLY+ PSY F+  P +     ++
Sbjct: 675  PHDAIRTRNSHPNSKRSKSSFEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLT 734

Query: 663  SKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTV-------YPQ-TEGIAVGDDGLLT 714
            SKA   KL   +S  L+  VAS IK+EQ+ +I   +       +P   E     D  + T
Sbjct: 735  SKATNEKLTTEDSTLLITAVASCIKLEQDKMISKELLKHNTVKHPHAAENEDDADFKIAT 794

Query: 715  PDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIF 774
            PD+IYD W ++  F+R+L++NQ++AW+LMDE+LMC+GYRRVL+WF+THMELNHS+I YIF
Sbjct: 795  PDDIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIF 854

Query: 775  ELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGT------LMFSRQGNLALSEIEV 828
            ELVMGLRG   S +    + +   LH +M     N         L FSRQG L LSEIE 
Sbjct: 855  ELVMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIEN 914

Query: 829  KMLLQEFFTNAAIFLXXXXXXXXXXX----------XXDVSLYSIGLVKLICFMVKTLIV 878
            KMLLQEFFTNAAI+                        + S+YS GLVKLICFMV++L+ 
Sbjct: 915  KMLLQEFFTNAAIYFSSKSNNEGTTNNDNGEGIDEEAVNFSVYSTGLVKLICFMVQSLME 974

Query: 879  NHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNIS-----------DXXXXXXX 927
            N+KF+F+KSECTFELQTLLMNW+GI+P+A++LFF LK  +S           D       
Sbjct: 975  NNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTHAD 1034

Query: 928  XXXXSALGAPGDIFPTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDAL 987
                S  G  G   P ++          E++  FNK+LV LLP+      K  + A+  L
Sbjct: 1035 NLSFSDDGDTG--HPGISRFDTDDSPPNESI--FNKRLVSLLPKRIND--KDENAAVSTL 1088

Query: 988  RNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYLGSYDGAV 1037
            R+F+ ++S   E PV GR++V     +LP    ++ ++  EYL   D  +
Sbjct: 1089 RHFIERYSFDEEAPVYGRKVVYSDEIVLPLPAADQPISFHEYLTELDDEI 1138

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1111 (38%), Positives = 614/1111 (55%), Gaps = 150/1111 (13%)

Query: 7    QFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWT---EEALS 63
            +F  L E   +TLFTT  G+ + Q ++                  + R  W    E   S
Sbjct: 66   RFSLLFEALAITLFTTNSGKSILQSIQTF--------------TSKKRKLWAQSFENNNS 111

Query: 64   KYIHLFFQHVWRDAGD------RF---------AIMQYNEPAFKLQVSDLFPSEFSKARL 108
             Y  + F   W+D         RF          I +YN P  KL +S L  S+ +   +
Sbjct: 112  NYASIVFS--WKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSI 169

Query: 109  VLNTDYDVLLDFVNTVRPQLKGLIRQAVQ----GSLVDPIVRKYGRVYEFHDYFHWF--- 161
            +LN  Y++L D++ ++  +++ L+  + +      +V   ++ Y R+ E  + + W+   
Sbjct: 170  LLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFN 229

Query: 162  --NLSKKKFANRDVLIL---NKGTPDLFHYYINSF-CSKAPYDVHPLHPFLGELFEGNNN 215
              N +  KF +    ++   N     L    +N+    K P DV                
Sbjct: 230  AENSAHLKFDDNIACLMGSENNTENGLGDSRVNNNNYHKQPKDV---------------- 273

Query: 216  VKYQQLGTNEHVYEFDLDEETHNGSGNRTVAV-DLMQQSNQRHEILTRMLNLKEIDSPHL 274
            V  + +   E +Y F+L+   H+G    T+ + ++M+ S  RHE+L ++LNL  + +P L
Sbjct: 274  VMSRTINDQEQIYSFELN---HDG----TLEIPNVMKHSLLRHELLFKILNLTPVSTPLL 326

Query: 275  YEQFKCMISLVDPLTQPPPSDTYVVSXXXXXXX-XXXXXPKNQDTE-QND----TFLLCF 328
              QF  +  LVDPL QP P+D +++S             P  + ++  ND     F  CF
Sbjct: 327  ELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGHNDHYDWKFYTCF 386

Query: 329  NMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYM 388
            NMQKII  T+ RL C+D+  L S++       +S  ++R  L  W+P+GLNTQDLELLYM
Sbjct: 387  NMQKIIDATMSRLNCFDFNILNSVNNT-----DSSVHWRTQLHRWLPHGLNTQDLELLYM 441

Query: 389  VDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLV 448
            +DI+AVYTIY  Y  LPIQLNPFL  LISLWKNLS V+LL+LE+DR EE N T++TPL+V
Sbjct: 442  IDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMV 501

Query: 449  RATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAA 508
            RATIRGA+ALR+V+A +LNG V+ NEHDFKHE LNTFMSP+GRKL  G+LYADLRSH+A+
Sbjct: 502  RATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYADLRSHSAS 561

Query: 509  MLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXX 568
            +L+ G  +EDVT+L +DLQ GDRFDEDIRYMF+YE  DY+    E +DE           
Sbjct: 562  LLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYDESFSESDDEGLEEGIVNARE 621

Query: 569  XXXXXXXXNEGTGASQKRRCNCIFTDDKIIQSD------ESKVSLGGGKN---------- 612
                    N       +RRCNCIF DDK++  D      ES  +  G +           
Sbjct: 622  KIKSSNDNN----VFCQRRCNCIFNDDKLVAEDGLNEVFESTCNRNGERRVRNNIDVVSN 677

Query: 613  -------------RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFR 659
                          P+SVR +S+FEFDYSG DWRDVPR  N+Y+ PSY F+  P L    
Sbjct: 678  TAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYPFIHDPKLDVIF 737

Query: 660  NVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDDG-------- 711
            N++ + A  KLN  ES  L++ VAS +K EQ+ +++  +     GI+   +G        
Sbjct: 738  NLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKHAEGENSTSISK 797

Query: 712  -------LLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHME 764
                     TPD+IY+ W ++  F+R+L +N ++AW+LMDE+LMC GYRR+L+WF TH+E
Sbjct: 798  TDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFFTHLE 857

Query: 765  LNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPN--GGTLMFSRQGNLA 822
            L HS+I+Y+FEL+MGLRG+  S   + ++++   ++ +++    N    +L FSRQG + 
Sbjct: 858  LKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDASSLPFSRQGPII 917

Query: 823  LSEIEVKMLLQEFFTNAAIFLXXXXXXXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKF 882
            LS+IE KMLLQEFF NAAIFL              +SLYS+GLV+LIC+MV+TLI N KF
Sbjct: 918  LSDIETKMLLQEFFMNAAIFLSSNNSEEENEDGEKISLYSLGLVRLICYMVQTLITNDKF 977

Query: 883  EFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFP 942
             F+KSECTFELQTLLM W+GI+P+A++LFF +K  +              A+    D   
Sbjct: 978  FFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRL--------------AMEEDNDT-G 1022

Query: 943  TLTXXXXXXXXVAENLS---EFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSE 999
            T+         + + L+        L +L    + S   G + AI+ LRNF+  +S  ++
Sbjct: 1023 TMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYSFDTQ 1082

Query: 1000 IPVLGRRIVRRGSQILPQATPERTVTLREYL 1030
            +   GR++V    +ILP    ++ + L EY+
Sbjct: 1083 VNPPGRKVVFYDGKILPLTKADKPIPLHEYI 1113

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1115 (36%), Positives = 609/1115 (54%), Gaps = 137/1115 (12%)

Query: 9    DSLLEE-CVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTA---------WT 58
            D++++E  +++LF T  G  + ++   L  G   LS        QVR+          W+
Sbjct: 46   DAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVKRWS 105

Query: 59   EEALS--KYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDV 116
               L   ++  L  Q    +        ++N   +KL +  +F  +     L+L+ DY++
Sbjct: 106  TSTLVLLRFTDLLLQ----NKNVPLEYTKHNTAEYKLSL--IFLLDKQNEFLILDPDYNL 159

Query: 117  LLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVL-- 174
            LLD++   +P ++ ++   + G L+  +V +Y ++ EF+    W+         +++   
Sbjct: 160  LLDYLLHAKPMIESILLGNIPG-LLKALVYQYNKLPEFNGCHTWYTFRTHYHGTQEIFHK 218

Query: 175  ----ILNKGT------PDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNV-------- 216
                + +K T      P+L  +++    S+   D   + P  G+ +  +  +        
Sbjct: 219  FFIALTDKFTASKEIMPELEGWFVEGPVSR---DSGCIKPITGDDYTSSAAIDDFNEDYW 275

Query: 217  KYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYE 276
              Q+  T E VY F+L+E+     G   +  ++   + +RH+ L ++L L +  +P L  
Sbjct: 276  TQQKTNTQEQVYSFELNED-----GTLEIP-NVFAHTKRRHDALYKVLGLNDDPTPLLKS 329

Query: 277  QFKCMISLVDPLTQPPPSDTYVVSXXXXX----------XXXXXXXPKNQDTEQNDTFLL 326
             F     L DP+TQPPP+D ++VS                      P N+DT    T  +
Sbjct: 330  CFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTW---TLHI 386

Query: 327  CFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELL 386
            CFN+QKII  TL RL C D+ +L  I+      D     +R +L +W+P GLNTQDLEL+
Sbjct: 387  CFNLQKIINATLSRLNCDDFTRLNEINNSDDSVD-----WRKNLYKWLPQGLNTQDLELI 441

Query: 387  YMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPL 446
            YMVDI+A YTIY  YS+ PIQ+NPFL  +ISLWKNL+ V+LL LE+DR EE  +TF+TP+
Sbjct: 442  YMVDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPV 501

Query: 447  LVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHA 506
            +VRATIRGASALR+V+A ++NGH R   HDFKHEP+N FMSPHGRKLC G+LYADLRSHA
Sbjct: 502  MVRATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHA 561

Query: 507  AAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFE----DEDEDXXXX 562
            A ML+LG++LE +T+LLSDLQPGDRFDED++YMF+YE++DYN VD E    DE ED    
Sbjct: 562  ATMLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELED---- 617

Query: 563  XXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDDKIIQS-------------------DES 603
                           E  G    +RC+C+F DD ++                     D  
Sbjct: 618  -------IESRERIKEVRGYY--KRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDSH 668

Query: 604  KVSLGGGKN-------RPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLA 656
            +  L   +N       +P +VR++ + EFD++G DWRD+PRGLN Y+  +Y F+ +    
Sbjct: 669  EDQLPPQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHAD 728

Query: 657  EFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEG------IAVGDD 710
                +  +A   KL    +  +L+ +A+ +K+EQE  I+       +G        +  +
Sbjct: 729  VVHYLMKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIKTE 788

Query: 711  GLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVI 770
              LT D IY+ W +D +F+++++ N +L W++MDE+LMC GYRRVL+WF+TH+E+NHSVI
Sbjct: 789  NELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVI 848

Query: 771  HYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKM 830
            HYIFELVMGLRG     D   + +   AL  L +  + +  TL FSRQG + LS IEV M
Sbjct: 849  HYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNM 908

Query: 831  LLQEFFTNAAIFLXXXXXXXXXXXXXD------------VSLYSIGLVKLICFMVKTLIV 878
            LLQEFFTNAAIF              +            V  + IGL+KL+CFMV TL+ 
Sbjct: 909  LLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPHVIGLMKLVCFMVDTLMQ 968

Query: 879  NHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPG 938
              KF+F+ SE  FELQTLLMNW+GIVP+A++LFF LK  I                    
Sbjct: 969  KKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESEKD 1028

Query: 939  DIFPTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSS 998
            DI    T        + + +SE NKKL+ML+P  T +E      A+ ALR F+ K+SL++
Sbjct: 1029 DIDAPDT------LEMNDTMSEHNKKLMMLIPPGTTNE----RNALTALRGFIGKYSLTN 1078

Query: 999  EIPVLGRRIVRRGSQILPQATPERTVTLREYLGSY 1033
            +  V GR+I+ +  +I+     ++ +  RE+L  +
Sbjct: 1079 KTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEF 1113

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1101 (35%), Positives = 603/1101 (54%), Gaps = 134/1101 (12%)

Query: 10   SLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSK-----------TPSRIVQQVRTAWT 58
            S+ E+ V+ LFTT  G  + ++  +L  G  +L +            P  + +++   WT
Sbjct: 45   SIQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWT 104

Query: 59   EEALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLL 118
                S YI    +++ R+       + +    +KL ++ L   +     L+++ +Y++LL
Sbjct: 105  --GSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQD--TELLIIDDEYNLLL 160

Query: 119  DFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLILNK 178
            DF+   R  ++ L+ QA   SL+      + R+++    + W+  S ++FA         
Sbjct: 161  DFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSGRYVWYTFSDERFAE-------- 212

Query: 179  GTPDLFHYYINSFCSK--APYDVHP-LHPF--------LGELFEGN-------------- 213
               D+ + Y++    K  A  D+ P + P         L  L +G+              
Sbjct: 213  -AQDICYKYLSVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSD 271

Query: 214  -NNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDS- 271
             ++   ++L  +E +Y FDL ++    S N      +  ++ +RH+ L ++L L++ +S 
Sbjct: 272  SDHWPQKKLSAHERIYSFDLKDDGTLESPN------VFGRTRRRHQALYQVLRLQQQNSS 325

Query: 272  PHLYEQFKCMISLVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDTEQ---NDTFLLCF 328
            P L  QF  + +LVDP+TQP P+D++++S              + + +Q   N  F +CF
Sbjct: 326  PCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLL--HSEIKQLPFNWRFHICF 383

Query: 329  NMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYM 388
            N+QKI+  TL RL C D+ +L S++      D     +R +L +W+P GLNTQDLEL+YM
Sbjct: 384  NLQKILQSTLPRLNCHDFQQLNSVNNSDDSID-----WRRNLHKWLPQGLNTQDLELVYM 438

Query: 389  VDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLV 448
            +DI+A+Y I+  Y   P+Q+NPFL+ +ISLWKNL+ V+LL LE+DR EE  +TF TP+LV
Sbjct: 439  IDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLV 498

Query: 449  RATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAA 508
            RA IRG+SALR+VVA VLNGHV    HDF+HEP+N FMSPHGRKLC G+LY D+RSHAAA
Sbjct: 499  RAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAA 558

Query: 509  MLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXX 568
            ML+LG++LEDVT LLSDLQPGDRFDED++YMF+YEY++YN V  ED DE+          
Sbjct: 559  MLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELEDVESRER 618

Query: 569  XXXXXXXXNEGTGASQKRRCNCIFTDDKI---------IQSDESKVSLG---------GG 610
                          +  +RC+C F DD++         I    +++S             
Sbjct: 619  IKEMR---------AYYKRCHCQFDDDELLPEEEEESGIPISHTRISKELPPDTNVKLSN 669

Query: 611  KNRPYSVRTKS-SFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGK 669
              +P ++R K  + EFD++G DWRD+PRGLN YF  +Y+F           + + AA  +
Sbjct: 670  TAKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQ 729

Query: 670  LNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVG------DDGLLTPDNIYDAWF 723
            L+  E+  LL+LV++ +  EQE  ++ + +   +  A+        DG LT D IY+ W 
Sbjct: 730  LSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLTTDYIYENWC 789

Query: 724  QDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQ 783
            QD +FD++LF N+ L W++MDE+LMC GYRRVL+WF+TH+E+  S+I YI+ LVMG RG+
Sbjct: 790  QDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGNRGE 849

Query: 784  ELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIFL 843
            +L+ +                 +TP  G L FSRQG++ LSEIE+KMLLQEFFTNAAIF 
Sbjct: 850  KLANE-----------------ETP-FGKLPFSRQGDIVLSEIEIKMLLQEFFTNAAIFF 891

Query: 844  XXXXXXX------XXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLL 897
                                +S Y +GL++L+CFMVK+LI    F+F   +  FEL+TLL
Sbjct: 892  SKQLRESLGDEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLL 951

Query: 898  MNWLGIVPDAQELFFLLKKNISDXXXXXX-----XXXXXSALGAPGDIFPTLTXXXXXXX 952
            M+W+ I+P+A++LFF L+  +                  S +    D   T         
Sbjct: 952  MSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDENDGSSDS 1011

Query: 953  XVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGS 1012
                ++S +NKKL+ LLP    +E      A+ ALR+F+ KHSL+    V GRR++    
Sbjct: 1012 EETNSVSIYNKKLISLLPPVVGTENT----AVTALRSFISKHSLTMGTAVFGRRVINHDD 1067

Query: 1013 QILPQATPERTVTLREYLGSY 1033
            +I+     ++ +  R +L  +
Sbjct: 1068 RIMSMYMSDKDIDNRNFLAEF 1088

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1102 (36%), Positives = 604/1102 (54%), Gaps = 139/1102 (12%)

Query: 13   EECVVTLFTTYRGQHVCQMLEQLDLGVFSLSK-------TPSRI----VQQVRTAWTEEA 61
            E+ V+ LFTT  G    ++  +L  G  +L +        P R+     +++   WT   
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSS- 109

Query: 62   LSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDFV 121
             ++++ L   H  R+         +  PA KL V+ L   E     LV++ +Y++LLDF 
Sbjct: 110  -TEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPE--TEVLVIDDEYNLLLDFA 166

Query: 122  NTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVLILNKGTP 181
               R  ++ L+ Q    SL+      +GR+++    + W+  S ++F             
Sbjct: 167  LQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDE---------AQ 217

Query: 182  DLFHYYINSFCSK--APYD----VHPL----------HPFLGE-LFEGN---------NN 215
            D+ + Y++    K  A  D    + PL          H   G+ LF  N         ++
Sbjct: 218  DICYKYLSVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDH 277

Query: 216  VKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNL-KEIDSPHL 274
               ++L   E VY FDL ++    + N      +  ++ +RH+ L ++LNL K+  +P L
Sbjct: 278  WPQKRLSAQERVYSFDLKDDGTLEASN------VFNRTRRRHQALYQVLNLQKQNTAPLL 331

Query: 275  YEQFKCMISLVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDTEQND-TFLLCFNMQKI 333
              QF  + +LVDP+TQP P+D+++VS                +    D  F +CFN+QKI
Sbjct: 332  SSQFFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINELHIDWRFHVCFNLQKI 391

Query: 334  ITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMA 393
            +  TL RL C D+ +L S++      D     +R +L +W+P GLNTQDLEL+YM+DI+A
Sbjct: 392  VQATLPRLNCHDFQRLNSVNNSDDSID-----WRRNLHKWLPQGLNTQDLELIYMIDILA 446

Query: 394  VYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIR 453
            +Y I+  Y  LP Q+NPFL+ +ISLWKNL+ V+LL LE+DR EE  +TF TP+LVRA IR
Sbjct: 447  IYIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIR 506

Query: 454  GASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLG 513
            G+SALR+VVA +LNGHV    HDF+HEP+N FMSPHGRKLC G+LY D+RSHAAAML+LG
Sbjct: 507  GSSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALG 566

Query: 514  VDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXX 573
            ++LEDVT LLSDLQPGDRFDED++YMF+YEY++YN VD E+ DED               
Sbjct: 567  IELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKEMR 626

Query: 574  XXXNEGTGASQKRRCNCIFTDDKIIQSDE-------------------SKVSLGGGKNRP 614
                     +  +RC+C F DD+++  DE                   + V L    ++P
Sbjct: 627  ---------AYYKRCHCQFDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKL-SNTSKP 676

Query: 615  YSVRT-KSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKAAGGKLNPM 673
             ++R+ K S EFD++G DWR +PRGLN YF  +YEF       +  ++   AA  KL   
Sbjct: 677  MALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLE 736

Query: 674  ESQQLLKLVASAIKIEQECIIMGTVY-----PQTEGIA-VGDDGLLTPDNIYDAWFQDKV 727
            E  QLL+++A+ +  EQE  ++ +       P++E  + +  DG LT D +Y+ W ++ +
Sbjct: 737  EGTQLLRVIATCVAKEQELTVLRSALLLGETPESENHSTLVADGDLTTDFVYEKWCENSM 796

Query: 728  FDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQELSA 787
            F++ILF N+ L W++MDE+LMC GYRRVL+WF+TH+E+++S+I YI+ LV+G RG++ ++
Sbjct: 797  FEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRGEKAAS 856

Query: 788  DVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIFLXXXX 847
            D                    +   + FSRQG + LS+IE+KMLLQEFFTNAAIF     
Sbjct: 857  D-------------------GDYAKVPFSRQGAIVLSDIEIKMLLQEFFTNAAIFFSKQL 897

Query: 848  XXX-----------XXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTL 896
                                 +S + +GL+KL+C+MVK+L+    F+F   +  FELQTL
Sbjct: 898  RESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQKEMFDFKDPDYIFELQTL 957

Query: 897  LMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDI-----FPTLTXXXXXX 951
            LM+W+ I+P+A++LFF L+  + +            A     D       P  T      
Sbjct: 958  LMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASACEPDSQSEPQLPQGT-HAELE 1016

Query: 952  XXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRG 1011
                  +S +NKKL+ LLP A  +E    + AI ALR+F+ KHSL+++  + GRR++ + 
Sbjct: 1017 PEATHAVSIYNKKLMSLLPPAAGTE----NSAITALRSFISKHSLTTKTALFGRRVISQD 1072

Query: 1012 SQILPQATPERTVTLREYLGSY 1033
              I+P    +R +  R++L  +
Sbjct: 1073 DTIMPMYMSDREMDNRQFLAEF 1094

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1172 (34%), Positives = 611/1172 (52%), Gaps = 184/1172 (15%)

Query: 6    PQFD-SLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRI-----VQQVRTAWTE 59
            P F+  ++E+ VVTLF T  G  +  +L  L  G   LS+    +     V Q +T + E
Sbjct: 42   PHFELMIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLSEYRQSLKVRSNVHQWKTCYKE 101

Query: 60   -----EALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDY 114
                 + LS+    F     R+        +Y     KL +  L P+       VL+  Y
Sbjct: 102  WGSRRDTLSR----FLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGLHA--YVLDEGY 155

Query: 115  DVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWF------------- 161
            ++LLD++   R   + L+ Q +   L+  ++  Y RV+EF+ Y+ W+             
Sbjct: 156  NLLLDYIINSRLMWEELLIQGIP-RLLPELIEDYNRVFEFNGYYTWYGGAPSGAGAANST 214

Query: 162  ---------------NLSKKKFANRDVLILNKGTPDLFHYY-INSFCSKAPYDVHPLHPF 205
                            ++K+     +  + +   P ++H + IN F ++       L+ F
Sbjct: 215  RELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHKHGINEFSNEE----EDLYDF 270

Query: 206  LGELFEGNNNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLN 265
              EL EG++  +++     E VY F+L     N  G+     ++   + +RHE L R+L 
Sbjct: 271  DSEL-EGDSWPQHKS-SAKEQVYTFEL-----NRDGSLEFP-NVFLHTRRRHETLYRILG 322

Query: 266  LKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDTE---QND 322
            L   + P L  QF  + +LVDP+TQPPP++ +++S                ++    Q+ 
Sbjct: 323  LPNRECPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESSLRGQDW 382

Query: 323  TFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQD 382
             F +C N+QKII  T+ RL C D   L SI+       +   ++  ++ +W P GLNTQD
Sbjct: 383  RFHVCHNLQKIILATMKRLNCHDSEVLNSINNS-----DETVHWNVNIGKWTPRGLNTQD 437

Query: 383  LELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTF 442
            LELLYMVD++ +YTIY  YS LP+Q+NPFL +   LWKNL+ VLLL LE+DR EE  +TF
Sbjct: 438  LELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRETF 497

Query: 443  DTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADL 502
             TP++VRATIRG++ALR+VVA ++N H    EHDFKHEP+N FMSPHGRKLCQG+LYAD+
Sbjct: 498  STPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYADV 557

Query: 503  RSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFE---DEDEDX 559
            RSHAAAML+LG++L DVT+LLSDLQPGDRFD+D++YMF+YEY+DYN +D E   DE+E+ 
Sbjct: 558  RSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEED 617

Query: 560  XXXXXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDDKIIQSDE----------------- 602
                                      +RC+C+F DD+++  +E                 
Sbjct: 618  LERLEEIQQRERIKDMR------GYYKRCHCVFDDDELLSDEEGTDTGEHTDNHITETVQ 671

Query: 603  -------SKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGL 655
                   + VS  G +    +VR++   EFD++G DWRD+PRG+N Y+   Y F+ +   
Sbjct: 672  SAPLNLVTGVSTSGPQK--VAVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKLHA 729

Query: 656  AEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQE-CIIMGTVY------PQTEGIAVG 708
                 +  +A   KL   +S  +L+ VA+ IK+EQE  ++   ++      P +   + G
Sbjct: 730  DVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHDAIFKSKDKSPLSASGSEG 789

Query: 709  DDGLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHS 768
             +G LT D IY+ W +D +F+++++ N +L W++MDE+LMC GYRRVL+WF+TH+EL+HS
Sbjct: 790  SNG-LTSDFIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELSHS 848

Query: 769  VIHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGG------TLMFSRQGNLA 822
            VIHYIFELVMG+RG     D+   E+      NL  +D+ + G      ++ FSRQG + 
Sbjct: 849  VIHYIFELVMGMRGNVAYKDL---EEEYIINRNLDLLDSFSLGSSCIPASIPFSRQGPIV 905

Query: 823  LSEIEVKMLLQEFFTNAAIFLXXXXXXXXXXXXXDV------------------------ 858
            LS IEV MLLQEFF NAAI+              DV                        
Sbjct: 906  LSTIEVNMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLT 965

Query: 859  -SLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKN 917
             S + +GL+KL+CFMV  LI   K +F+ SE  FELQTLLMNW+G+VP+A+ LFF LK  
Sbjct: 966  ASSHVLGLMKLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKST 1025

Query: 918  I--------------------SDXXXXXXXXXXXSA----------------LGAPGDIF 941
            +                    +D            A                +GA  +  
Sbjct: 1026 LLNSSALNGSALSHLEGELASNDNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQ 1085

Query: 942  PTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIP 1001
            PT             N+S  N+ L+ LLP  +  E    + A+ ALR+F+ KH L+++  
Sbjct: 1086 PTSAANSAPNGMSESNISYCNQMLIKLLPPHSADE----NAAVTALRSFIAKHPLTTKTA 1141

Query: 1002 VLGRRIVRRGSQILPQATPERTVTLREYLGSY 1033
            + GRR++ + + I+     ++ +  RE+L  +
Sbjct: 1142 IFGRRVIYQDNAIMGLYMADKELQQREFLAEF 1173

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/886 (41%), Positives = 503/886 (56%), Gaps = 115/886 (12%)

Query: 225  EHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYE-QFKCMIS 283
            E VY FDL     N  G+ T+  +LM  + +RH+IL ++LN    DS  L E QFK M+ 
Sbjct: 395  EKVYSFDL-----NNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLG 449

Query: 284  LVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDTEQNDTFL-----LCFNMQKIITRTL 338
            LVDPL+QPPP+D +++S              N +  QN+        +CF M KII   +
Sbjct: 450  LVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQNNLGFNWKTHVCFQMVKIINNCM 509

Query: 339  WRLKCWDYAKLTSISKKQTEGDNSQY--------------------NYRDHLKEWVPNGL 378
             +L C D  KL  ++  Q E +  +                     N+R  L++W+P+GL
Sbjct: 510  EKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGL 569

Query: 379  NTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEA 438
            NTQDLELLYMV I+A YT+      +PIQLNPFL  LI+LWK L+ +L+L L++DR EEA
Sbjct: 570  NTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEA 629

Query: 439  NDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSL 498
            ++T+ TPLLV+ATIRGASALR+VVA +LN ++  N+HDFKHE LNTFMSPHGRKLC G+L
Sbjct: 630  HETYKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGAL 689

Query: 499  YADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDED 558
            Y D++  AA++ +LG+DL ++  LLS L+PGDRFDEDI YMFEYEY+DYN      E+ +
Sbjct: 690  YCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAA--LKENHE 747

Query: 559  XXXXXXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDD----------------------- 595
                              NE      +RRCNCIF DD                       
Sbjct: 748  DLGKTLKSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNGDEQQGEQEEQEG 807

Query: 596  --KIIQSDESKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARP 653
              K + S +  +   G +N  Y+VR+K++FEFDYSG DWRD+PRG N+Y+  SY F+   
Sbjct: 808  TPKNVASFQDPL---GKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDS 864

Query: 654  GLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVG----- 708
             L    N++SKA+  KLN  +S QLL+L+AS+IK EQ  +IM  +    + +        
Sbjct: 865  SLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNIINPL 924

Query: 709  ---------DDGLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWF 759
                        + TPD+I+D WF   VF  +L  N+EL+W+LMDE+LMC+GYRRVL+W+
Sbjct: 925  VNSKEEKERSTVVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWY 984

Query: 760  VTHMELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHNLM-EIDTPNGGTLMFSRQ 818
            +THM+LNHS+I YIFEL+MGLRG   + +    E + + LH LM      +  T  FSRQ
Sbjct: 985  ITHMKLNHSLIQYIFELLMGLRGSPFANN---NECKNELLHELMLGKKIVDNHTYPFSRQ 1041

Query: 819  GNLALSEIEVKMLLQEFFTNAAIF--------------------LXXXXXXXXXXXXXDV 858
            G L LS+IE KMLLQEFF+NAAI+                    +              V
Sbjct: 1042 GPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENNENHGV 1101

Query: 859  SLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNI 918
            S+YS+GL+KLIC MV +LI N KF+F+KS+C FELQTLLMNW+GI+ +A+ELFF LK +I
Sbjct: 1102 SMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFFKLKSDI 1161

Query: 919  SDXXXXXXXXXXXSALGAPGDIFPTLTXXXXXXX------XVAENLSEFNKKLVMLL-PR 971
             +           S  G   D F ++                   +++FNK+L+ LL P 
Sbjct: 1162 EE--------TSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPI 1213

Query: 972  ATQSEGKGSSQAIDALRNFMRKHSLSSE-IPVLGRRIVRRGSQILP 1016
             +      S       R  ++ +S +S+   V GR++V    +ILP
Sbjct: 1214 HSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILP 1259

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 78/166 (46%), Gaps = 18/166 (10%)

Query: 4   RVPQFDSLLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQV-RTAWTEEAL 62
           +V +F  +LE  V+  FTT  GQ +   L       F   + P  +  ++ R  W    +
Sbjct: 110 KVKKFSIMLETLVIAYFTTKSGQSILNYL-------FDTKRKPPTVQNKILRKTW---EV 159

Query: 63  SKYIHL-FFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFP----SEFSKARLVLNTDYDVL 117
           +++++  F   + R+  +   I ++NEP  KL +  L      S      ++L+++Y++L
Sbjct: 160 NEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNML 219

Query: 118 LDFVNTVRPQLKGLIRQAV--QGSLVDPIVRKYGRVYEFHDYFHWF 161
            D+++     L  LI+  +   G      + +Y R+ +F+ +F W+
Sbjct: 220 TDYLDATSNWLILLIKMTILNVGPFFYNTIIRYNRIPQFNGHFQWY 265

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1115 (35%), Positives = 589/1115 (52%), Gaps = 140/1115 (12%)

Query: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSK--TPSRIVQ---QVRTAWTEEALSKY 65
            + E  V+ LFTT  G  +   L   + G+   +K   P+ ++    Q+   W  + L   
Sbjct: 52   ITEVTVIALFTTRPGISLLNCLTD-NFGIDEDNKDFNPNSLLPRMPQLALKWMHDEL--I 108

Query: 66   IHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSK--ARLVLNTDYDVLLDFVNT 123
            +  F + +  +          N+   KLQ+  L  +E S   +  +L  + DV+ +++  
Sbjct: 109  LIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTA 168

Query: 124  VRPQLKGLIRQAVQG---------SLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVL 174
            + P+LK +I+ ++ G         S     +  Y R+YE   +F +++ S  K    D+ 
Sbjct: 169  IWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIY 228

Query: 175  I--LNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQ-------LGTNE 225
            +  L K    L ++   SF          L    G  +   +N  Y         L  + 
Sbjct: 229  VKALMKHLTGLSNF---SF---------QLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDP 276

Query: 226  HVYEFDLDEETHNGSGNRTVAV-DLMQQSNQRHEILTRMLNLKEID-----SPHLYEQFK 279
               E + ++ET N      +   DLM ++ +RH  L++++   +++     SP L  Q+K
Sbjct: 277  DDGEVEENQETDNILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYK 336

Query: 280  CMISLVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQDTEQNDT------FLLCFNMQKI 333
             +++L+DPLTQP P+DT+V+S                D + N+       F +CFNMQ+I
Sbjct: 337  TLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQI 396

Query: 334  ITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMA 393
            I  +L+ L C D+ +L ++ + +        ++R  L  W+P GLNTQ+LEL+YM  I+A
Sbjct: 397  IIASLFVLNCNDFERLGTVDESK--------DWRSQLHLWLPRGLNTQNLELVYMSCILA 448

Query: 394  VYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIR 453
            VYTIY  YS  P+  NPFLS LISLWK+L+ V+L  L++DR EE+N +FDTP++VRATIR
Sbjct: 449  VYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIR 508

Query: 454  GASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLG 513
            GA+ALR++VA VLN  +    HDF HE LNTFMSPHGRKLC G+LYADL+++ A++L+LG
Sbjct: 509  GAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALG 568

Query: 514  VDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXX 573
             + ++VT+L+S LQ GD+FDED++YMFEYEYEDYN + +ED   +               
Sbjct: 569  AEFQEVTDLVSYLQAGDQFDEDVKYMFEYEYEDYNEI-YEDSSNENEENEEIDY------ 621

Query: 574  XXXNEGTGASQKRRCNCIFT-----------------------DDKII--------QSDE 602
                    A  KRRCNCIF+                       D +I         ++ E
Sbjct: 622  --------AFNKRRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIATKSKEHTEKTIE 673

Query: 603  SKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVS 662
            S   L    ++P++VR+KS+FEFDYSG DWRD+PR  NLY+ P Y F+ RP L     ++
Sbjct: 674  SDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLT 733

Query: 663  SKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGD----DGLLTPDNI 718
             KA   KL   E+  LL  VAS +K EQ+ +I G +  Q +     +        TPD+I
Sbjct: 734  LKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEATPDDI 793

Query: 719  YDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVM 778
            Y+ W ++  F+RIL  N +LAWKLMDE+LMC GYRRVL+WF+THMEL+HS+I YIF+L+M
Sbjct: 794  YEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMM 853

Query: 779  GLRGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTN 838
            G RG     + T   +  ++      I   N  +L FSR G+L LSE+E +M+LQE FTN
Sbjct: 854  GSRG----INKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQELFTN 909

Query: 839  AAIFLXXXXXXXXXXXXX----------------DVSLYSIGLVKLICFMVKTLIVNHKF 882
            AAI+                                S+YS+GL+KLIC MV  LI N KF
Sbjct: 910  AAIYFSDKARKSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMVSKLIENSKF 969

Query: 883  EFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFP 942
              ++S+C FELQTLLM W+ I+P+A+EL F +  ++S+           S  GA      
Sbjct: 970  NVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSE-FSHVENSELASIEGASTKSHK 1028

Query: 943  TLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPV 1002
             L               ++N+ L+ L+P      GK  +   +  R++++ +S  SE+  
Sbjct: 1029 QLVDKNSESY-------KYNEILLKLIPPTFG--GKEENIIFNTFRDYIKDYSFDSEVST 1079

Query: 1003 LGRRIVRRGSQILPQATPERTVTLREYLGSYDGAV 1037
            + R+I+ +  +ILP    E+  +  +YL  Y  AV
Sbjct: 1080 MCRKIIHQSDEILPLQDSEKPFSFHDYLTEYGKAV 1114

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1094 (35%), Positives = 560/1094 (51%), Gaps = 199/1094 (18%)

Query: 108  LVLNTDYDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEF--HDYFHWFNLSK 165
            L+++ +Y++LLD+++   P L  L+   +   L + I+  Y + +E    +   W++   
Sbjct: 198  LLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFID 257

Query: 166  KKFANRDVLILN-----KGTPDLF----HYYINSFCSKAPYDVHPLHPFLGELFEGNN-- 214
             K       I N         ++F    ++ +N+  S + +++         +   N   
Sbjct: 258  SKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNISSSSTTKSNMHNENEGA 317

Query: 215  --NVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEID-- 270
              N+   +    EH   F+L E   N   +  +  DLM   ++RH+IL ++LN+ + D  
Sbjct: 318  DLNLLMDENSMGEHTLSFNLFE---NNINHGILHPDLMAHISKRHDILAKILNVGDNDKY 374

Query: 271  --SPHLYEQFKCMISLVDPLTQPPPSDTYVVSXXXXXXXXXXXXPKNQD---TEQNDT-- 323
              SP L+ QFK + +LVDPLTQP P+   ++S                D   + ++ T  
Sbjct: 375  YNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNW 434

Query: 324  -FLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQD 382
             FL+CFNM+KII   + +L C D+  L SI+       +   ++R  L +W+P G NTQD
Sbjct: 435  KFLVCFNMEKIINSVMKKLNCVDFNTLNSIN-----NSDESVHWRTQLHKWLPRGFNTQD 489

Query: 383  LELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTF 442
            LELLYMV+I+A YTIY     LPIQLNPFLS ++S WKNLS  +LL LE+DR EE N+TF
Sbjct: 490  LELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETF 549

Query: 443  DTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADL 502
            DTPL+VRAT+R ++ALR+++A +LN HV    HDFKHE LNTFMSP+GRKLC G+LY D 
Sbjct: 550  DTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDF 609

Query: 503  RSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLV-------DFEDE 555
            RSHA+ +L+L  DLE VT+L+SDLQPGDRFDED++YMF  E+EDYN +       D E  
Sbjct: 610  RSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTLPNVLGGEDDETS 667

Query: 556  DEDXXXXXXXXXXXXXXXXXXNEGTGASQ--------------KRRCNCIFTDDKIIQSD 601
             +                   NE     +               RRCNCIF+DD+I  + 
Sbjct: 668  TDTLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKDTS 727

Query: 602  ---------------ESKVSL---------GG---------------------------- 609
                           ES+++L         GG                            
Sbjct: 728  ISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTE 787

Query: 610  -------GKNRPYSVRT---------------KSSFEFDYSGNDWRDVPRGLNLYFWPSY 647
                   G N+P++VRT               ++ F+FDY+G DWRD PRG+NLY+  +Y
Sbjct: 788  MESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNLNY 847

Query: 648  EFLARPGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAV 707
            EF+ +P L     ++ KA   KL+  +S  LL+LVAS++K EQ+ II        E   +
Sbjct: 848  EFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEI 907

Query: 708  ---GDDGL-----------------------LTPDNIYDAWFQDKVFDRILFMNQELAWK 741
                +DG+                       +TPD+IY+ W ++  F+R++ +N E+ ++
Sbjct: 908  MEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFR 967

Query: 742  LMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHN 801
            LMDE+LMC+GYRRVL+WF+TH+EL+HSVIHYIFELVMG RG       T E++      N
Sbjct: 968  LMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGAT-EDKHTNTKGN 1026

Query: 802  LMEIDTPNGGT----------------LMFSRQGNLALSEIEVKMLLQEFFTNAAIFLXX 845
            + E++  N                   L FSRQGN+ LSEIE KML+QEF TNAAI    
Sbjct: 1027 VNELENKNENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNE 1086

Query: 846  XXX-----------------XXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSE 888
                                        ++SLYSIGL++LICFM++  + N+K +    +
Sbjct: 1087 RNNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIEVDD 1146

Query: 889  CTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGD-------IF 941
              FELQTLLMNW+ I+P+A++LFF +K  IS+             L    D         
Sbjct: 1147 SIFELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIENQTS 1206

Query: 942  PTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIP 1001
                        V  N S FNKKL+ L P+ + +  K  + AID L+N+++K     E+P
Sbjct: 1207 KDNNDKMDESSKVDSN-SSFNKKLIELFPKMSHT-NKEENTAIDTLKNYLKKFRFHQEVP 1264

Query: 1002 VLGRRIVRRGSQIL 1015
            ++GR+++    +IL
Sbjct: 1265 IIGRKVIYEDGKIL 1278

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/1038 (35%), Positives = 548/1038 (52%), Gaps = 173/1038 (16%)

Query: 7    QFDSLL-EECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWTEEALSKY 65
             FD+L+ E+ VVTLF T  G  +  ML  L  G   L++    +  +VR+          
Sbjct: 43   HFDALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSL--KVRSN--------- 91

Query: 66   IHLFFQHVWRDAGDRFAIM------------------QYNEPAFKLQVSDLFPSEFSKAR 107
             H +++  ++D G R  I+                  +Y     KL +  L P       
Sbjct: 92   -HSYWKSCYKDWGSRRDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRP-- 148

Query: 108  LVLNTDYDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFN----- 162
             +++ +Y++LLD++   RP  + L+ Q +   L + +V +Y R YEF+ Y+ W+      
Sbjct: 149  YLIDDEYNLLLDYMIQSRPMWEMLLTQGIPKFLPE-LVDEYNRSYEFNGYYVWYGNVTCS 207

Query: 163  -----LSKKKFANR------DVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELF- 210
                  S K+   +      D L + K      +  + S    A Y    L     +   
Sbjct: 208  QVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTLLDLSNDDDD 267

Query: 211  -------EGNNNVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRM 263
                     N++   Q+L + E V+ FDL     N  G      ++   + +RHEIL R+
Sbjct: 268  HYDQDVDSENDHWPQQKLSSREQVFTFDL-----NRDGTLEFP-NVFLHAKKRHEILYRV 321

Query: 264  LNLKEIDSPHLYEQFKCMISLVDPLTQPPPSDTYVVSX---------XXXXXXXXXXXPK 314
            L L + + P L  QF  + +LVDP+TQPPP++ +++S                      +
Sbjct: 322  LGLPDAEGPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISR 381

Query: 315  NQDTEQNDTFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWV 374
             +D      F +C+NMQKI+  T+ RL C D   L +++       +   ++  +L +W 
Sbjct: 382  GRDWR----FHVCYNMQKIVLATMKRLNCHDGDVLNTVNNS-----DESVHWNVNLDKWT 432

Query: 375  PNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDR 434
            P GLNTQDLELLYMVD++++Y +Y  YS+LP+Q+NPFL + + LWKNL+ VLL  LE+DR
Sbjct: 433  PRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDR 492

Query: 435  CEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLC 494
             EE  +TF+TP++VRA IRG +ALR+VVA ++N H    EHDFKHEP+N FMSPHGRKLC
Sbjct: 493  FEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLC 552

Query: 495  QGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFE- 553
             G+LYAD+RSHAAAMLSLG+DL DVT+LLSDLQPGDRFD+D++YMF+YEY+DYN +D E 
Sbjct: 553  HGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQ 612

Query: 554  --DEDEDXXXXXXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDDKIIQSDESKVSLGGGK 611
              DE+E+                           +RC+C+F DD+++  +E   +     
Sbjct: 613  LYDENEEDLERLEEIQQRERIKDM------RGYYKRCHCVFDDDELLSDEEEGETASSNI 666

Query: 612  NRP-------------------------YSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPS 646
            +RP                         +++R++   +FD++G DWRD+PRGLN Y+   
Sbjct: 667  DRPKYSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEH 726

Query: 647  YEFLARPGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQE-CIIMGTVYPQTEGI 705
            Y F+ +        +  +A   K+ P  +  +L+ +A+ IK+EQE  ++   +  +T+  
Sbjct: 727  YVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKG 786

Query: 706  AVGDDGL-----LTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFV 760
            +  +        LT D IY+ W ++ +F ++++ N +L W++MDE+LMC GYRRVL+WF+
Sbjct: 787  SSSNSNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFI 846

Query: 761  THMELNHSVIHYIFELVMGLRGQELSADVTLEEQRKQALHN--------------LMEID 806
            TH+E++HS+IHYIFELVMG+RG     +V  +E+ +  + N               + I 
Sbjct: 847  THLEISHSLIHYIFELVMGMRG-----NVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIK 901

Query: 807  TPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIF------------------------ 842
             P      FSRQG + LS IE+ MLL EFF NA I+                        
Sbjct: 902  IP------FSRQGPIILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGS 955

Query: 843  --LXXXXXXXXXXXXXDVSLYSIGLVKLICFMVKTLIVNHKFEFSKSECTFELQTLLMNW 900
              L              VS + IGL+KL+CFMV  L+   KF+F+ SE  FELQTLLMNW
Sbjct: 956  DDLEYGLCEDGDKDTLGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNW 1015

Query: 901  LGIVPDAQELFFLLKKNI 918
            +GI+P+A+ LFF LK +I
Sbjct: 1016 IGIIPEARNLFFKLKSSI 1033

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 4/77 (5%)

Query: 957  NLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRIVRRGSQILP 1016
            NLS++NK L+ LLP    +E    + A+ ALR+F+ KHSL+++  V GRR++ +   I+ 
Sbjct: 1115 NLSKYNKMLIELLPLHVDNE----NTAVTALRSFITKHSLTNKTAVFGRRVIYQDHAIMG 1170

Query: 1017 QATPERTVTLREYLGSY 1033
                ++ +  RE+L  +
Sbjct: 1171 LYMADKEMRQREFLAEF 1187

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1108 (34%), Positives = 567/1108 (51%), Gaps = 155/1108 (13%)

Query: 6    PQFDS--LLEECVVTLFTTYRGQHVCQMLEQLDLGVF--------SLSKTPSRIVQQVRT 55
            P+F+     E   + LFTT  G  +    +   L           +L  +P+   + ++ 
Sbjct: 109  PRFEDNFFYELLTIALFTTKPGNKILHFFKNTGLDSAIEHNDSDDTLFHSPA--YEHLKM 166

Query: 56   AWTEEALSKYIHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLF--PSEFSKARLVLNTD 113
             W  E   +Y+H   Q + ++      +  Y + ++K  ++ L   P+   K R +L+ +
Sbjct: 167  LWKWE--DEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHRFLLSEE 224

Query: 114  YDVLLDFVNTVRPQLKGLIRQAVQGSLVDPI------VRKYGRVYEFHDYFHWFNLSKKK 167
            +++L +++   +  +K  I  A+Q ++   +      +  Y RV E++  +  + ++  +
Sbjct: 225  FNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSYLRYEITDDE 284

Query: 168  FANRDVLILNKGTPDL---FHYYINSFCSKA----PYDVHPLHPFLGELFEGNNNVKYQQ 220
             A   +   ++   D+   F  Y+ +   +A       ++ +      +  G+   K++Q
Sbjct: 285  NA---LCQFDESLLDVLLEFERYVTTDDIEAILLQSGRINKVKDISSAIERGD--YKWEQ 339

Query: 221  -----LGTNEH--------VYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLK 267
                 L  N H        +  FD++E     +G + V  ++M+ S  RH IL   L L 
Sbjct: 340  GTLRSLTPNNHKADNEEEVILSFDINE-----NGLQEVP-NIMKDSMLRHSILFEFLGLS 393

Query: 268  EIDS--PHLYEQFKCMISLVDPLTQPPPSDTYVVSXXXX----XXXXXXXXPKNQDTEQN 321
            + ++  P+L  QFK +  LVDPLTQP P+DT+++S                 K+      
Sbjct: 394  QRNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARNY 453

Query: 322  DTFLLC-FNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNT 380
            D   LC FN+ KI+ ++L +L C  Y  L +I   +   D     +R  L+ W+P  LNT
Sbjct: 454  DWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGND-----WRQTLEYWIPKNLNT 508

Query: 381  QDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEAND 440
            QDLELLYM+DI++VY IY  Y   PIQ NPFL  L S+WK ++ ++ L L+VDR EE ND
Sbjct: 509  QDLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQND 568

Query: 441  TFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYA 500
            + +TPL++RAT+RGASA RA +  +LN  +  NEHDFKHEP+NTFMSPHGRKLC GSLYA
Sbjct: 569  SEETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYA 628

Query: 501  DLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLV-DFEDEDEDX 559
            D+R      +  GV+L+D+T LL+DLQPGDRFDED+ YMF+YEYEDYNLV D ED DE  
Sbjct: 629  DMRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSEDMDE-- 686

Query: 560  XXXXXXXXXXXXXXXXXNEGTG---ASQKRRCNCIFTDDKIIQSDESKVSLGG------- 609
                             NE  G   A   RRCNC+F DDKI+  DES +           
Sbjct: 687  --------------KADNESDGVRPAPIFRRCNCVFEDDKIM--DESTIDHQSLITDMEL 730

Query: 610  -----------------GKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLAR 652
                              +  P++VR +S F+F+Y G DWRD+PRG NLY+   + F+  
Sbjct: 731  ENNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQE 790

Query: 653  PGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGD--D 710
               +EF +  SKA    L+  ES +L++LVAS I+ EQ+ +++     Q   +A GD   
Sbjct: 791  CSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQL-PLANGDVNK 849

Query: 711  GLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVI 770
              LT D IYD       F ++L+ + ELA  LMDELLM  GYRRVL+WF+TH+ +   +I
Sbjct: 850  SKLTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFPLI 909

Query: 771  HYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKM 830
            HYIFELVMG R      D   +  +K +            G   FSR G +ALS IE +M
Sbjct: 910  HYIFELVMGYRVGFSDGDANGDNNKKSS-----------TGKCGFSRLGTVALSSIEKQM 958

Query: 831  LLQEFFTNAAIFLXXXXXXXXXXXXXD-----------VSLYSIGLVKLICFMVKTLIVN 879
            LLQEFF NA + L             +           +S Y++G+V LIC MVKTL+  
Sbjct: 959  LLQEFFLNATVSLSAKSFESNGTEIDNYDDNADEDNEYISSYAVGIVTLICNMVKTLVRA 1018

Query: 880  HKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXX-XXXSALGAPG 938
             + + SKSE T ELQTLL+NW+ ++P+A+ELFF LK+   +            S L   G
Sbjct: 1019 GQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQEAHEFDIQDSLEPINESELQTSG 1078

Query: 939  DIF-PTLTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRK-HSL 996
            +I  P  T        +  +L+   K                +S A DAL  F+      
Sbjct: 1079 NINEPAATDSIPLDDTINTSLTSSTK----------------NSNATDALSTFLETVEET 1122

Query: 997  SSEIPVLGRRIVRRGSQILPQATPERTV 1024
            S + P +GR+++ +G++ILP    ER +
Sbjct: 1123 SVQPPQIGRKVIYKGTKILPLPEQERPI 1150

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  512 bits (1319), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 344/984 (34%), Positives = 518/984 (52%), Gaps = 135/984 (13%)

Query: 106  ARLVLNTDYDVLLDFVNTVRPQLKGLIR---------QAVQGSLVDPIVRKYGRVYEFH- 155
            A +V +  +D L  + + + P++K ++          Q V  S    I++ Y R Y    
Sbjct: 150  AAIVKSEQFDYLEAYCSIIWPKIKNILLESLNIDKQFQDVTNSFFHKIIKLYKREYLVSA 209

Query: 156  DYFHWFNLSKKKFANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNN 215
            ++    N+         +++L++G       YI+S      Y   P +           N
Sbjct: 210  EFLTLINVLTNSVLFSYIVMLSEG-------YISSNYDGLLYKSPPTY-----------N 251

Query: 216  VKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRML---NLKEIDSP 272
            VK ++   N    EF       N   N   ++DLM+ + +R  IL ++L    LK+I+ P
Sbjct: 252  VKQRENMMNSFG-EFQSSAMLTNDENN---SIDLMKLTERRQNILYKVLIFSKLKQIE-P 306

Query: 273  HLYEQ----FKCMISLVDPLTQPPPSDTYVVSXXXXXXX-XXXXXPKNQDTEQNDT---- 323
              ++     F  + +LVDPLTQP P+D +V+S             P  Q   + ++    
Sbjct: 307  ESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYKIFLAMMLPHVQVLIERESSYDW 366

Query: 324  -FLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQD 382
             + +  N+QKI+      L C+D  KL  + + +        ++++ L  W+P+GLN Q+
Sbjct: 367  RYEISNNLQKILFYAFLNLNCYDMEKLNKVDETK--------HWKEQLHLWLPHGLNPQN 418

Query: 383  LELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTF 442
            LELLYM+ I  VY I+  Y   P+  NPFL  L+S WK L+ V+L  L+VDR EE N++F
Sbjct: 419  LELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQVDRFEEENESF 478

Query: 443  DTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADL 502
            +TP++VRATIRGASALR+VVA +LN  +   +HDF+HEPLNTFMSPHGRKLC G+LYADL
Sbjct: 479  NTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRKLCTGALYADL 538

Query: 503  RSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXX 562
            +S+ A+ML+ G++ +D+TELLS LQPGD FDED++YMFEYEY+DYN  + ++ DED    
Sbjct: 539  KSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMFEYEYDDYNEPEEDESDEDGERN 598

Query: 563  XXXXXXXXXXXXXXNEGTGASQKRRCNCIFTDDKIIQ-------------SDESK----- 604
                                  +RRC C+F+DD +++             S+E+      
Sbjct: 599  NSEENIKFNF-----------NRRRCRCVFSDDDVLEHGDFNDANSEYSNSEENSNDVDN 647

Query: 605  -VSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSS 663
             V    G ++P     K+  EFD+ G DWR VPR LN+++   Y F+  P     R++ S
Sbjct: 648  FVLPNDGIDKP-----KNGVEFDFDGKDWRAVPRHLNMFYSFDYIFIENPLEVLIRSLIS 702

Query: 664  KAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTV-YPQTEGIAVGDDGLLTPDNIYDAW 722
            +A+   L+  +S  LL+ +AS IKI Q+  I+G+   P     +   +GL T D I    
Sbjct: 703  EASASALSKKKSHLLLRNIASVIKINQDSRILGSKRSPNGTDSSKSQNGLSTGDLIKLIT 762

Query: 723  FQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRG 782
              D  F+ IL  N+EL   LMDELLM  GYRRVLLWF+TH+ L+H++I+YIFEL+M  RG
Sbjct: 763  AGD-TFENILKFNRELGCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHRG 821

Query: 783  QELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTNAAIF 842
            Q     V+  E+ +  L            +  FSRQG L LS++E +MLLQEFFTNA +F
Sbjct: 822  Q-----VSDTEREQSEL------------SYTFSRQGELRLSDLEREMLLQEFFTNATMF 864

Query: 843  ------LXXXXXXXXXXXXXDV-------SLYSIGLVKLICFMVKTLIVNHKFEFSKSEC 889
                  L             DV       SLY++GL+++ C M+ +L  N  F+ S SE 
Sbjct: 865  FSSKSVLFASDTGDNNEINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSES 924

Query: 890  TFELQTLLMNWLGIVPDAQELFFLLKKNISDXXXXXXXXXXXSALGAPGDIFPTLTXXXX 949
             FELQTLLM W+ I+P+A+ LFF LK+++             + +  P       +    
Sbjct: 925  IFELQTLLMGWINIIPEAKLLFFKLKESVK----------SFNGIDNPELKSIEESSTTT 974

Query: 950  XXXXVAENLSE--FNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRI 1007
                + EN  +  FNKKL+   P++    G      +   ++F+R +S  SE P +GR++
Sbjct: 975  KKTTIDENSEQYRFNKKLLKTFPKSFS--GDDGDILLKTFKDFLRNYSFDSEPPYIGRKV 1032

Query: 1008 VRRGSQILPQATPERTVTLREYLG 1031
            +    +IL     E+ ++L ++L 
Sbjct: 1033 IYESDEILQLTDIEKPISLHKFLS 1056

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  365 bits (937), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 316/1139 (27%), Positives = 505/1139 (44%), Gaps = 167/1139 (14%)

Query: 11   LLEECVVTLFTTYRGQHVCQML-------EQLDLGVFSLSKTPSRIVQQVRTAWTEEALS 63
            LLE+ V+ LFTT  GQ V   L         +D GV  L +        +   W   A  
Sbjct: 23   LLEKLVIALFTTVPGQAVVTQLINDAKRTNDVD-GVECLIRMNDPYWVALFGTW---ATD 78

Query: 64   KYI-HLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDFVN 122
            K+I  LF   V R+  D   + +Y++ +FK+ +  L  ++  K    L    ++LLD+++
Sbjct: 79   KHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFTAPLWDTSNILLDYLH 138

Query: 123  TVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEFHDYFHWFNLSKK-KFANRDVLILNKGTP 181
              +P ++ ++++ + GS     + KY R+YEF+  + WF   +    A     IL + + 
Sbjct: 139  NAKPLIESVLKK-LDGSQFLQCLMKYNRLYEFNGSYQWFTPPQSTSHAESPTTILERNS- 196

Query: 182  DLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVK-YQQLGTNEHVYEFDLDEETHNGS 240
                    +F S            LG    GN+ V+   QL T +     +  E     S
Sbjct: 197  --------TFLST-----------LGNF--GNDMVRALSQLKTGD--IRLNSLESYGKNS 233

Query: 241  GNRTVAVDLMQQSN--------QRHEILTRMLNLKEIDSPHLYEQFKCMISLVDPLTQPP 292
            G+    +      N         R  +  + L L +   P L EQF  +    DP+TQPP
Sbjct: 234  GHNNPPLSKQDDHNPLNLNGKSDRFNLFFK-LGLHKEPHPLLAEQFNSLCLFADPMTQPP 292

Query: 293  PSDTYVVSXX--------XXXXXXXXXXPKNQDTEQNDTFLLCFNMQKIITRTLWRLKCW 344
            P+D++++S                    P  Q   +     L  N++ I    L  L+ W
Sbjct: 293  PNDSHIISLDLLHDLYLGSLTAYIVKLIPNYQKVWK---IHLSANLETITLAILQMLQIW 349

Query: 345  DYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYSHL 404
            DY  L ++   Q    ++   Y  ++  W+P  L+  ++E+LYM+  ++ Y+++  +S  
Sbjct: 350  DYRSLDNLKDIQARSPDA---YPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDK 406

Query: 405  PIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASALRAVVAC 464
            P +LNPFL M++  W+ LS+ L+L L++DR EE    + TP++V A IRGASALR+++A 
Sbjct: 407  PPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIAT 466

Query: 465  VLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLEDVTELLS 524
            +LNGHV E  HDFKH+P   FMSPHGRKLC G+LY     + AA+L  G+D +++ ELL+
Sbjct: 467  ILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLT 526

Query: 525  DLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDXXXXXXXXXXXXXXXXXXNEGTGASQ 584
            D+Q GDR DED+RY          + D+E  D +                  NE    ++
Sbjct: 527  DIQKGDRIDEDVRY----------MFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNR 576

Query: 585  KR-------RCNCIFT-------------------DDKIIQSDESK-------------- 604
             R       RC C F+                   +  ++  DE+               
Sbjct: 577  FRMLRGLYKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSES 636

Query: 605  ------VSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEF 658
                   SL   ++      +  +  +D +G+DWRD+PRGLNLY+   Y+FL++      
Sbjct: 637  SNAVAFTSLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSL 696

Query: 659  RNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGDDGLL--TPD 716
              +  +     +   ++  +L+ +A+ +K+EQE I++  +   T   A  D  +L  + D
Sbjct: 697  FELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILLKLI---TATSAEVDLKVLPFSTD 753

Query: 717  NIYDAWFQDK--VFDRILF--MNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHY 772
             +  A F D   +     F   N  L WK+ DEL+M HG+RR+L++ +TH     S IHY
Sbjct: 754  EVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHY 813

Query: 773  IFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPNG-----GTLMFSRQGNLALSEIE 827
            ++EL+ GLRG   +    LE  + + L  L    TP G       + FSRQG + LS IE
Sbjct: 814  VYELLFGLRGNP-ARSYDLESTKNKQLGILSW--TPTGEFERVAAIEFSRQGVIELSAIE 870

Query: 828  VKMLLQEFFT----------NAAIFLXXXXXXXXXXXXXDVS--LYSI--------GLVK 867
             KMLLQEFF           N A F              D     +S         G VK
Sbjct: 871  KKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSGKVK 930

Query: 868  LICFMVKTLIVNHKFEFSKSE-CTFELQTLLMNWLGIVPDAQELFFLLK-KNISDXXXXX 925
            ++CF+++ ++ + +FEF   E   +EL+  LM W     +A  ++ LLK K +       
Sbjct: 931  MVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSKALGKVLDLG 990

Query: 926  XXXXXXSALGAPGD-IFPT------LTXXXXXXXXVAENLSEFNKKLVMLLPRATQSEGK 978
                       P D + P       L+          +   E   K  ++  R ++    
Sbjct: 991  TEGLDDRPNTDPDDQLLPVDFDKLKLSDIDDRWDTETDTSIENGDKTSIMSERFSRMLPV 1050

Query: 979  GS--SQAID-ALRNFMRKHSLSSEIPVLGRRIVRRGSQILPQATPERTVTLREYLGSYD 1034
             S   Q +D   R+ ++K+ L+   P+ GR  +     ILP          RE+L  +D
Sbjct: 1051 QSLDGQPVDKVFRHLLQKYPLTEGTPIHGRITLEYHDHILPLDIRTHQSLHREFLAVFD 1109

>NDAI0A03290 Chr1 complement(745888..746901) [1014 bp, 337 aa] {ON}
           Anc_4.99 YBL010C
          Length = 337

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 55/121 (45%), Gaps = 18/121 (14%)

Query: 87  NEPAFKLQVSDLFPSEFSKARLVLNTDYDV----LLDFVNTVRPQLKGLIRQAVQ-GSLV 141
           N   F   + DLFP E SKA L +N   D+    L + +   RP +  + +Q V   +++
Sbjct: 93  NSALFSTILDDLFPDETSKATLAINDQLDMDSIKLSNLLENERPHV--IYQQLVDLDTIL 150

Query: 142 DPIVRKYGRVYEFHDYFHWFNLS------KKKFANRDVLILNKGTPDLFHYYINSFCSKA 195
            PI+  + + +   + FH   +S      KK  A  ++  LN     L++  +N   SK 
Sbjct: 151 QPII--WKKTHLRSELFHLLGISDEAEMLKKNQAREEIKPLNDT---LYNSIMNVINSKN 205

Query: 196 P 196
           P
Sbjct: 206 P 206

>YGR048W Chr7 (589826..590911) [1086 bp, 361 aa] {ON}
           UFD1Substrate-recruiting cofactor of the
           Cdc48p-Npl4p-Ufd1p segregase; polyubiquitin binding
           protein that assists in the dislocation of misfolded,
           ERAD substrates that are subsequently delivered to the
           proteasome for degradation; involved in the regulated
           destruction of resident ER membrane proteins, such as
           HMG-CoA reductase (Hmg1/2p) and cytoplasmic proteins
           (Fbp1p); involved in mobilizing membrane bound
           transaction factors by regulated Ub/proteasome-dependent
           processing (RUP)
          Length = 361

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 84  MQYNEPAFKLQVSDLFPSEFSKARLVLNTDYDVLLDF---VNTVRPQLKGLIRQA----- 135
           + YN   FK+++ ++ P   SK+  V+ T  D++ DF   V  V P  K L  Q      
Sbjct: 162 ISYNGKTFKIKILEVKPESSSKSICVIET--DLVTDFAPPVGYVEPDYKALKAQQDKEKK 219

Query: 136 ---VQGSLVDPIVRKYGRVYEFHDYFHWFNLSKKKFA 169
               +G ++DP V   G +    DY    N S+ K +
Sbjct: 220 NSFGKGQVLDPSVLGQGSMSTRIDYAGIANSSRNKLS 256

>Skud_11.179 Chr11 complement(322462..325224) [2763 bp, 920 aa] {ON}
           YKL050C (REAL)
          Length = 920

 Score = 33.5 bits (75), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 783 QELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTN 838
           +++S+ V L E +K A   L +ID+ N   L+F   GN A +++ VK+ L+ + TN
Sbjct: 343 KQVSSPVVLHEAQKLANKKLQDIDSSNTYMLLF---GNQAYNKLAVKIALEHYSTN 395

>Kpol_1028.75 s1028 complement(168225..174173) [5949 bp, 1982 aa]
           {ON} complement(168225..174173) [5949 nt, 1983 aa]
          Length = 1982

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%)

Query: 343 CWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTIYNAYS 402
           C    K  +++K Q+      YN  +++    P G    D+ LL +++I+  ++  N ++
Sbjct: 283 CRAVFKYKTLNKIQSLVFPVAYNTNENMLICAPTGAGKTDIALLTILNIIKQFSQVNEHN 342

Query: 403 HLPIQLNPFLSMLISLWKNLSAVLL 427
            L IQ + F  + ++  K L+A ++
Sbjct: 343 ELDIQYDDFKVIYVAPLKALAAEIV 367

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 105,955,865
Number of extensions: 4594361
Number of successful extensions: 11995
Number of sequences better than 10.0: 27
Number of HSP's gapped: 12071
Number of HSP's successfully gapped: 54
Length of query: 1038
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 918
Effective length of database: 39,721,479
Effective search space: 36464317722
Effective search space used: 36464317722
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)