Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B007603.499ON25925912791e-180
Skud_7.4463.499ON25825911111e-154
YGR135W (PRE9)3.499ON25824710891e-151
Suva_7.4233.499ON25824710891e-151
Smik_6.2313.499ON25824710881e-151
KAFR0C020203.499ON25825810791e-150
NDAI0G008903.499ON25424710781e-150
Kpol_480.103.499ON25924710751e-149
ZYRO0D09746g3.499ON25325510701e-148
CAGL0I10406g3.499ON25725810601e-147
TPHA0A057003.499ON25625310551e-146
NCAS0E007603.499ON25925910551e-146
SAKL0F02530g3.499ON25225110501e-145
TDEL0D056703.499ON25525510471e-145
Ecym_12303.499ON25125310331e-143
AFR318W3.499ON25125110011e-138
KLTH0G02376g3.499ON2512519991e-138
Kwal_47.188983.499ON2512519991e-138
KLLA0E03917g3.499ON2492489971e-137
TBLA0D029203.499ON2582609971e-137
KLLA0B11836g7.120ON2541763674e-42
KLTH0F13574g7.120ON2541763641e-41
Kwal_YGOB_Anc_7.1207.120ON2541763613e-41
Ecym_81518.871ON2501793613e-41
ADL354W8.871ON2501793613e-41
AAR012C7.120ON2511763604e-41
SAKL0F04224g7.120ON2521763596e-41
KAFR0G030307.120ON2541763588e-41
CAGL0F01199g7.120ON2541793552e-40
NCAS0F010307.120ON2531763553e-40
TBLA0J019807.120ON2541763535e-40
YOL038W (PRE6)7.120ON2541763535e-40
Suva_15.1317.120ON2541763535e-40
Ecym_12727.120ON2511763526e-40
NDAI0E001608.871ON2501793526e-40
Smik_15.1297.120ON2541763528e-40
Skud_15.1197.120ON2541763519e-40
NDAI0H015207.120ON2521763511e-39
KLLA0D10373g8.871ON2501793501e-39
NDAI0C034005.64ON2631813511e-39
TPHA0I020707.120ON2561763492e-39
ZYRO0G04136g7.120ON2541763482e-39
KLLA0A05093g5.64ON2621813492e-39
NCAS0D013405.64ON2611823483e-39
KLTH0H00528g5.64ON2611813483e-39
CAGL0H07007g8.871ON2501793464e-39
Kpol_455.58.871ON2491803465e-39
SAKL0H02068g5.64ON2611813466e-39
Smik_13.438.871ON2501793456e-39
KNAG0J001808.871ON2501793457e-39
Ecym_51005.64ON2611813458e-39
Kpol_1062.25.64ON2601813458e-39
TPHA0C049308.871ON2501803449e-39
Kwal_56.247805.64ON2621813459e-39
Kpol_1023.1087.120ON2541763441e-38
TPHA0H011905.64ON2601813441e-38
Suva_13.568.871ON2501793431e-38
NCAS0B001508.871ON2501793422e-38
Skud_13.518.871ON2501793412e-38
YML092C (PRE8)8.871ON2501793413e-38
AER296W5.64ON2601813413e-38
KLTH0E16324g8.871ON2501793403e-38
KAFR0L020808.871ON2501793403e-38
TDEL0H033007.120ON2561763404e-38
CAGL0I02442g5.64ON2601813398e-38
TDEL0B004008.871ON2501773361e-37
KAFR0B044405.64ON2601813362e-37
ZYRO0A00616g8.871ON2501793352e-37
TDEL0G008805.64ON2601813362e-37
TBLA0C066205.64ON2622363344e-37
KNAG0L010207.120ON2661763344e-37
ZYRO0C11770g5.64ON2602613335e-37
KNAG0K004505.64ON2671813302e-36
TBLA0C063408.871ON2561853292e-36
Suva_7.5495.64ON2602613283e-36
Skud_7.5865.64ON2602613274e-36
SAKL0D00440g8.871ON2501793257e-36
Smik_16.545.64ON2601813259e-36
YGR253C (PUP2)5.64ON2601813241e-35
ZYRO0C00792g7.20ON2901723163e-34
CAGL0H06105g7.20ON2901723103e-33
KAFR0C050007.20ON2811723067e-33
KLTH0D00902g7.20ON2771723032e-32
Kpol_538.407.20ON2741723022e-32
TBLA0E006907.20ON2781723023e-32
KNAG0E002307.20ON2791802998e-32
AGL089W4.110ON2461822961e-31
Suva_8.4197.20ON2921722972e-31
ADR401C7.20ON2791722962e-31
NCAS0I002507.20ON2921722972e-31
Smik_15.5467.20ON2881722963e-31
KLLA0A03487g7.20ON2751722953e-31
YOR362C (PRE10)7.20ON2881722954e-31
Skud_15.5307.20ON2881722954e-31
TPHA0N002407.20ON2771772927e-31
Ecym_50197.20ON2851722921e-30
Ecym_72334.110ON2461822891e-30
KLTH0E07788g4.110ON2461822863e-30
SAKL0D14476g7.20ON2811722867e-30
TDEL0H043107.20ON2741722867e-30
Kwal_47.174934.110ON2461822847e-30
Kpol_1061.454.110ON2561772847e-30
YGL011C (SCL1)4.110ON2521772839e-30
TPHA0F006704.110ON2571772812e-29
TBLA0C040804.110ON2531772812e-29
Smik_7.2794.110ON2521772803e-29
Suva_7.2704.110ON2521772795e-29
ZYRO0G10164g4.110ON2531732778e-29
Skud_7.2764.110ON2521772778e-29
KLLA0A05027g4.110ON2461822761e-28
TDEL0F023604.110ON2531782751e-28
NDAI0A087707.20ON2921722781e-28
NCAS0A016404.110ON2531772752e-28
CAGL0A00407g4.110ON2541772752e-28
SAKL0H21956g4.110ON2481822715e-28
KNAG0D035404.110ON2521772691e-27
KAFR0F034304.110ON2521772499e-25
AGL336W5.1ON3061772492e-24
KNAG0E011805.1ON2331782444e-24
KLTH0B09504g5.1ON2331822401e-23
Kwal_26.94835.1ON2331772392e-23
TPHA0A056705.1ON2331772392e-23
Ecym_56505.1ON2331772382e-23
KLLA0A10153g5.1ON2331782383e-23
KAFR0I027205.1ON2351792373e-23
CAGL0M14003g5.1ON2331772356e-23
NDAI0I026405.1ON2331772356e-23
ZYRO0C01144g5.1ON2331772357e-23
Kpol_1060.15.1ON2331772358e-23
YMR314W (PRE5)5.1ON2341772331e-22
Skud_13.4885.1ON2341772312e-22
Smik_13.5315.1ON2341772313e-22
NCAS0D023105.1ON2331772295e-22
Suva_13.5075.1ON2341772288e-22
TBLA0C071905.1ON2331772261e-21
SAKL0H00946g5.1ON2331772242e-21
Kwal_27.97208.871ON1731052203e-21
TDEL0G002405.1ON2381822061e-18
NDAI0D035604.110ON172801696e-14
Kwal_26.68197.20ON196951635e-13
AGL324W7.480ON2431531171e-06
NCAS0A148807.480ON2411741136e-06
Smik_15.3375.507ON2611561136e-06
NDAI0J006007.480ON2411741101e-05
Suva_8.2085.507ON2611561101e-05
KLTH0E01826g7.480ON2421741092e-05
AAR119W5.507ON2591711092e-05
YOR157C (PUP1)5.507ON2611561092e-05
KNAG0B038005.507ON2611491092e-05
Skud_15.3215.507ON2611561082e-05
TDEL0A037105.507ON2611701082e-05
NDAI0C011705.507ON2631481082e-05
Ecym_54585.507ON2581491083e-05
SAKL0G04290g5.507ON2611781083e-05
ZYRO0D12034g5.507ON2611521083e-05
KAFR0B006507.480ON2411741073e-05
Ecym_71717.480ON2421551065e-05
KNAG0F035907.480ON2481721057e-05
TBLA0D017505.507ON2591531048e-05
SAKL0F15092g7.480ON2611741049e-05
KAFR0C053005.507ON2611711041e-04
Kwal_55.198827.480ON2421651031e-04
KLLA0A02233g5.507ON2621481031e-04
TPHA0E020505.507ON2611591031e-04
CAGL0F04477g7.480ON2421551021e-04
TBLA0F026807.480ON2411551022e-04
Kpol_1028.927.480ON2421651012e-04
Kwal_47.187485.507ON2631601012e-04
TDEL0C034407.480ON2411741003e-04
Kpol_534.575.216ON21573993e-04
Kpol_2002.1095.216ON21573993e-04
Kpol_218.15.507ON261148994e-04
CAGL0L04312g5.507ON261148985e-04
TPHA0E004207.480ON241165977e-04
SAKL0G12584g5.216ON21573950.001
KLLA0F12936g5.216ON21573940.001
Skud_10.2225.216ON21572930.002
Ecym_82765.216ON21573930.002
KLLA0E05633g7.480ON240146940.002
NCAS0H024805.507ON264179940.002
Smik_10.2785.216ON21672930.002
YJL001W (PRE3)5.216ON21572930.002
Suva_2.777.480ON241155930.002
ZYRO0G17842g7.480ON244147930.002
KAFR0C063505.216ON21672910.003
Suva_12.805.216ON21572910.003
TBLA0C062005.216ON21676910.004
TDEL0E041305.216ON21970900.005
Smik_2.737.480ON241155900.005
KLTH0G03168g5.507ON263159900.005
YBL041W (PRE7)7.480ON241155880.008
Skud_2.617.480ON241155870.011
KNAG0H024505.216ON21672860.015
AAL172C5.216ON21573850.016
TPHA0E029905.216ON21673850.021
TPHA0N007405.216ON21673840.026
Kwal_33.151935.216ON19369820.036
NCAS0A014805.216ON21672820.044
ZYRO0B10142g5.216ON21573820.044
NDAI0C024205.216ON21672810.051
KLTH0D03058g3.417ON287153820.061
KLTH0G00550g3.574ON265163810.073
CAGL0D03058g5.216ON21573800.076
TPHA0M017503.417ON286153810.083
KLTH0B03102g5.216ON21573790.11
AEL326C3.417ON285153800.11
TDEL0C055403.417ON287153790.13
KNAG0A075203.417ON287153790.14
Suva_16.4293.417ON287153780.16
Skud_16.3883.417ON287153780.17
NCAS0A114403.417ON287153780.19
Smik_7.1736.159ON34942780.19
Kwal_26.72733.417ON287153780.19
Smik_16.3433.417ON287153780.20
YPR103W (PRE2)3.417ON287153770.23
CAGL0G01804g3.417ON286153750.38
Ecym_26143.417ON285153740.54
TBLA0F017603.417ON287153740.58
ZYRO0C17688g3.417ON287153730.67
KLTH0C07348g3.269ON316127730.73
SAKL0B09262g3.417ON287153730.77
KLLA0F08228g3.417ON285153711.3
KAFR0D042103.417ON287153701.6
TBLA0E001503.574ON265153701.7
Kpol_1018.1443.417ON288153701.8
NDAI0A048603.417ON287153692.5
TDEL0D064203.574ON265125692.5
Ecym_31481.519ON105235684.6
Kpol_380.123.574ON265150665.2
AFR258W3.574ON262127656.7
ZYRO0E09724g3.574ON261135657.3
SAKL0F00616g3.574ON265131657.5
KNAG0I001903.574ON265123648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00760
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   497   e-180
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   432   e-154
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   424   e-151
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   424   e-151
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   423   e-151
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   420   e-150
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   419   e-150
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   418   e-149
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   416   e-148
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   412   e-147
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   410   e-146
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     410   e-146
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   409   e-145
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   407   e-145
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   402   e-143
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   390   e-138
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   389   e-138
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   389   e-138
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   388   e-137
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   388   e-137
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   145   4e-42
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   144   1e-41
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   143   3e-41
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   143   3e-41
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   143   3e-41
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   143   4e-41
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   142   6e-41
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   142   8e-41
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   141   2e-40
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     141   3e-40
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   140   5e-40
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   140   5e-40
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   140   5e-40
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   140   6e-40
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   140   6e-40
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   140   8e-40
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   139   9e-40
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     139   1e-39
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   139   1e-39
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   139   1e-39
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   139   2e-39
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   138   2e-39
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   139   2e-39
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      138   3e-39
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   138   3e-39
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   137   4e-39
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   137   5e-39
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   137   6e-39
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   137   6e-39
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   137   7e-39
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   137   8e-39
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   137   8e-39
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   137   9e-39
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   137   9e-39
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   137   1e-38
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   137   1e-38
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   136   1e-38
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   136   2e-38
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   135   2e-38
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   135   3e-38
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   135   3e-38
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   135   3e-38
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   135   3e-38
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   135   4e-38
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   135   8e-38
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   134   1e-37
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   134   2e-37
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   133   2e-37
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   134   2e-37
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   133   4e-37
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   133   4e-37
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   132   5e-37
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   131   2e-36
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   131   2e-36
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   130   3e-36
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   130   4e-36
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   129   7e-36
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   129   9e-36
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   129   1e-35
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   126   3e-34
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   124   3e-33
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   122   7e-33
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   121   2e-32
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   120   2e-32
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   120   3e-32
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   119   8e-32
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   118   1e-31
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   119   2e-31
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   118   2e-31
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   119   2e-31
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   118   3e-31
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   118   3e-31
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   118   4e-31
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   118   4e-31
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   117   7e-31
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   117   1e-30
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   115   1e-30
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   114   3e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   114   7e-30
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   114   7e-30
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   114   7e-30
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   114   7e-30
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   113   9e-30
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   112   2e-29
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   112   2e-29
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   112   3e-29
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   112   5e-29
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   111   8e-29
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   111   8e-29
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   110   1e-28
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   110   1e-28
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   111   1e-28
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   110   2e-28
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   110   2e-28
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   108   5e-28
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   108   1e-27
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   100   9e-25
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   100   2e-24
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...    99   4e-24
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...    97   1e-23
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...    97   2e-23
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}              97   2e-23
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...    96   2e-23
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...    96   3e-23
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    96   3e-23
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...    95   6e-23
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1        95   6e-23
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...    95   7e-23
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...    95   8e-23
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...    94   1e-22
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...    94   2e-22
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...    94   3e-22
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...    93   5e-22
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...    92   8e-22
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....    92   1e-21
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    91   2e-21
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...    89   3e-21
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    84   1e-18
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    70   6e-14
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    67   5e-13
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    50   1e-06
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    48   6e-06
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    48   6e-06
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    47   1e-05
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    47   1e-05
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    47   2e-05
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    47   2e-05
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    47   2e-05
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    47   2e-05
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    46   2e-05
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    46   2e-05
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    46   2e-05
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    46   3e-05
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    46   3e-05
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    46   3e-05
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    46   3e-05
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    45   5e-05
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    45   7e-05
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    45   8e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    45   9e-05
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    45   1e-04
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    44   1e-04
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    44   1e-04
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    44   1e-04
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    44   1e-04
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    44   2e-04
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    44   2e-04
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    44   2e-04
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    43   3e-04
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    43   3e-04
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    43   3e-04
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    43   4e-04
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    42   5e-04
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    42   7e-04
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    41   0.001
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    41   0.001
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    40   0.002
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    40   0.002
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    41   0.002
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      41   0.002
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    40   0.002
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    40   0.002
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.002
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    40   0.002
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    40   0.003
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    40   0.003
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    40   0.004
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    39   0.005
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    39   0.005
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    39   0.005
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    39   0.008
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    38   0.011
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    38   0.015
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    37   0.016
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    37   0.021
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    37   0.026
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    36   0.036
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    36   0.044
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    36   0.044
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    36   0.051
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    36   0.061
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    36   0.073
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    35   0.076
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    36   0.083
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    35   0.11 
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    35   0.11 
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    35   0.13 
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    35   0.14 
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    35   0.16 
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    35   0.17 
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    35   0.19 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    35   0.19 
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    35   0.19 
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    35   0.20 
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    34   0.23 
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    33   0.38 
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    33   0.54 
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    33   0.58 
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    33   0.67 
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    33   0.73 
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    33   0.77 
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    32   1.3  
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    32   1.6  
TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574 ...    32   1.7  
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    32   1.8  
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    31   2.5  
TDEL0D06420 Chr4 complement(1150503..1151300) [798 bp, 265 aa] {...    31   2.5  
Ecym_3148 Chr3 (272390..275548) [3159 bp, 1052 aa] {ON} similar ...    31   4.6  
Kpol_380.12 s380 complement(19992..20789) [798 bp, 265 aa] {ON} ...    30   5.2  
AFR258W Chr6 (901053..901841) [789 bp, 262 aa] {ON} Syntenic hom...    30   6.7  
ZYRO0E09724g Chr5 complement(771237..772022) [786 bp, 261 aa] {O...    30   7.3  
SAKL0F00616g Chr6 (56334..57131) [798 bp, 265 aa] {ON} highly si...    30   7.5  
KNAG0I00190 Chr9 (21910..22707) [798 bp, 265 aa] {ON} Anc_3.574 ...    29   8.5  

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  497 bits (1279), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 244/259 (94%), Positives = 244/259 (94%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 241 KSGITKKDAEDGDADVEMK 259
           KSGITKKDAEDGDADVEMK
Sbjct: 241 KSGITKKDAEDGDADVEMK 259

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  432 bits (1111), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/259 (81%), Positives = 230/259 (88%), Gaps = 1/259 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTARVH QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           K+               SKTTDSSALTYDR+EF+TI++G  +G+V QKI+KP EIK LLV
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KSGITKKDAEDGDADVEMK 259
           K+GI+KKD ED +AD EMK
Sbjct: 241 KTGISKKD-EDDEADQEMK 258

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  424 bits (1089), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 203/247 (82%), Positives = 221/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDR+EF+TI++G  +G+V QKI+KP EIK +LV
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 241 KSGITKK 247
           K+GITKK
Sbjct: 241 KTGITKK 247

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  424 bits (1089), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/247 (82%), Positives = 221/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTARVH QNYLK+Y EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDR+EF+TI++G  +G+V QKI+KP EIK LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 241 KSGITKK 247
           K+GITKK
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  423 bits (1088), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 204/247 (82%), Positives = 221/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDR+EF+TI++G  +G+V QKI+KP EIK LLV
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 241 KSGITKK 247
           K+GITKK
Sbjct: 241 KTGITKK 247

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  420 bits (1079), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/258 (77%), Positives = 224/258 (86%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TS EKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG D+RYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SK TDSS LTYDR+EF+TIK+GK   ++ QKI+ P EIK LLV
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 241 KSGITKKDAEDGDADVEM 258
           K+GI+KK+ ED D ++++
Sbjct: 241 KTGISKKENEDEDTEMKL 258

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  419 bits (1078), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 200/247 (80%), Positives = 220/247 (89%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IG++  DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TS EKLY+LNDKI VAVAGLTADAEILINTAR+H QNYLKTY EDIPVE+LV+R+SDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS+LTYD++EF+TIK+GK +G+V QKIYKP EIK+LL+
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 241 KSGITKK 247
           K+G+TKK
Sbjct: 241 KTGVTKK 247

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  418 bits (1075), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/247 (82%), Positives = 220/247 (89%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEK+YRLNDKI VAVAGLTADAEILINTARVH Q YLKTY E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDRVEF+TIK+G E  ++ QKI+KP EIKQLL+
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENDKIYQKIFKPEEIKQLLL 239

Query: 241 KSGITKK 247
           K+GITKK
Sbjct: 240 KTGITKK 246

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  416 bits (1070), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 206/255 (80%), Positives = 224/255 (87%), Gaps = 2/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLYRLNDKIVVAVAGLT+DAEILINTAR+H QNYLKTY EDIPVE+LVKR+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDRVEF+TIK G E G++ QK++KP EI+ LLV
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLG-ENGKLYQKVFKPEEIQTLLV 239

Query: 241 KSGITKKDAEDGDAD 255
           K+GITK   ED D +
Sbjct: 240 KNGITKA-GEDEDEE 253

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  412 bits (1060), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/258 (77%), Positives = 224/258 (86%), Gaps = 2/258 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++  +GIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LND+  VAVAGLTADAEILINTAR+H QNYLKTY E+IPVEMLV+++SDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQ+GGLRP+GVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS+LTYDR+EF+T+K+  E  +  QKI+KP+EIKQLL+
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 241 KSGITKKDAEDGDADVEM 258
           K+GI+KK   D D DVEM
Sbjct: 241 KTGISKKS--DEDEDVEM 256

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  410 bits (1055), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/253 (79%), Positives = 223/253 (88%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LND I VAVAGLTADAEILINTARV  QNYL+TY EDIPVE+LV+++SDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG D+R G+QL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALTYDRVEF+TIK+G E  +V QKIYKP EIKQLL 
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENNKVYQKIYKPEEIKQLLS 239

Query: 241 KSGITKKDAEDGD 253
           K+GITKK +EDG+
Sbjct: 240 KAGITKK-SEDGE 251

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  410 bits (1055), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 202/259 (77%), Positives = 226/259 (87%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DG+V+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLY+LNDKI VAVAGLTADAEILINTARV+ Q+YLKTY E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS+LTYD++E +TIK+G    +V QKIYKP E+K+LL+
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 241 KSGITKKDAEDGDADVEMK 259
           K+GITKK  ++ D D EMK
Sbjct: 241 KTGITKKSEDEDDEDEEMK 259

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  409 bits (1050), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/251 (79%), Positives = 220/251 (87%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TS+EKLY+LND I VAVAGLTADAEILINTARV+ QNYL+TY E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG D+RYG+QLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALT+DR+EF+TIK+G   GQ+ QKIYKP EI+ LL 
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGS-NGQLYQKIYKPQEIQTLLS 239

Query: 241 KSGITKKDAED 251
           K+GITKKD ED
Sbjct: 240 KTGITKKDDED 250

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  407 bits (1047), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/255 (78%), Positives = 220/255 (86%), Gaps = 1/255 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TSTEKLYRLNDKI VAVAGLTADAEILINTARV+ QNYL+TY EDIPVE+LVKR+SDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSSALT DR+EF+TI++   +G++ QKI+KP EI+ LLV
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAP-DGKLYQKIFKPEEIQSLLV 239

Query: 241 KSGITKKDAEDGDAD 255
           K GITKK  +D   D
Sbjct: 240 KHGITKKHHDDEQDD 254

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  402 bits (1033), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/253 (77%), Positives = 220/253 (86%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TS+EKLYRLND I VAVAGLTADAEILINTAR+H QNYLK Y E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTD+S+LT DR+EF+TIK+    G+++QKIYKPSEIK+LL 
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQ-DSNGKLVQKIYKPSEIKELLQ 239

Query: 241 KSGITKKDAEDGD 253
           KSGI K++ E+ D
Sbjct: 240 KSGIMKQE-ENAD 251

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  390 bits (1001), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/251 (74%), Positives = 216/251 (86%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A+DGIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TS+EKLYRLND I VAVAGLTADAEIL+NTAR+H QNYLK Y E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG D RYG+QLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS+L+++R+EF+TI+R   +G+V+QKIYK  EIK LL 
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNA-DGKVVQKIYKLGEIKDLLE 239

Query: 241 KSGITKKDAED 251
           K+GI K++ ++
Sbjct: 240 KTGINKQEEKE 250

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/251 (74%), Positives = 215/251 (85%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIGV+A+DGIV+AAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +S+EKLY+LND I VAVAGLTADAEILINTAR+  QNYLK+Y E+IPVE+LV+R+SD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFG SFIYAG DDRYG+QLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS LT +RVEFSTI +  + G++ QKI+KP EI+ LL 
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITK-LDNGKIAQKIFKPQEIETLLN 239

Query: 241 KSGITKKDAED 251
           K+G+TKK+ +D
Sbjct: 240 KTGVTKKENDD 250

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  389 bits (999), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/251 (74%), Positives = 214/251 (85%), Gaps = 1/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGV+A+DGIV+AAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +S+EKLY+LND I VAVAGLTADAEILINTAR+  QNYLKTY E+IPVE+LV+R+SD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFG SFIYAG DDR+G+QLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS LT +RVEF+TI +  E G++ QKI+KP EI+ LL 
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITK-LENGKIAQKIFKPREIETLLN 239

Query: 241 KSGITKKDAED 251
           ++GI KK+ E+
Sbjct: 240 ETGINKKENEE 250

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  388 bits (997), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 211/248 (85%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++ + GIV+AAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           TS+EKLY+LND I VAVAGLTADAEILINTARV  Q+YLKTY E+IPVEMLV+R+SD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240
           KD               SKTTDSS LT++R+EF+TI +   EG++ QKIYKP+EI  LL 
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISK-DAEGKIYQKIYKPTEIATLLE 239

Query: 241 KSGITKKD 248
           K+ I KKD
Sbjct: 240 KTEIVKKD 247

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  388 bits (997), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/260 (74%), Positives = 215/260 (82%), Gaps = 3/260 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IG++++DGIV+ AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
              EKLY+L+DKI +AVAGLTADAEILIN AR   QNYL TY E+IPVE+LVK++SDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           SYTQHGGLRPFGVSFIYAG DD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKE-EGQVIQKIYKPSEIKQLL 239
           KD               SKTTDSS LTYDRVE S IK  KE + ++IQKIY P+EIKQLL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 240 VKSGITKKDAEDGDADVEMK 259
           +K GI KK+  D D DVEMK
Sbjct: 241 IKFGINKKN--DEDEDVEMK 258

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + ++++ +V++ AGL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDR-YGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNY 179

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +VI  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ AGL AD+ ILI  ARV  Q++  T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDR-YGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNY 179

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ AGL AD+ ILI  ARV  Q++  T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDR-YGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 111/179 (62%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K  STL   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+ ++   I    +G+  D  +LIN +R     +Y+KTYGE  P ++LV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+   F LY  +PSG+Y  WKA ++G   +AA+T L+  + +
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNN 181

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  143 bits (361), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 111/179 (62%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K  +TL  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+ ++   I    +G+  D  +LIN +R     +Y K YGE  P ++LV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G   +AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWND 181

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + R+++ ++++ AGL AD+ ILI  ARV  Q++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYGF-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNY 179

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  142 bits (359), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ AGL AD+ ILI  ARV  Q++  T  + + ++ L + ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYGF-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  142 bits (358), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GV   + +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + ++++ IV++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYGF-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNY 179

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  141 bits (355), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 112/179 (62%), Gaps = 6/179 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTST-- 63
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +V+  ER+  STL  QDT    
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERR--STLKLQDTRVIA 61

Query: 64  EKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
            K+  ++  +V++ AGL AD+ IL+N ARV  Q++  T  + + VE + + ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGVDDR--YGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNY 180

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  141 bits (355), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDR-YGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNY 179

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  140 bits (353), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +G+   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + ++++ IV++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYGF-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFG+S + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNY 179

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  140 bits (353), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GV  ++ +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYG-FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  140 bits (353), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GV  ++ +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYG-FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  140 bits (352), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 107/176 (60%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GV   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  ++++ AGL AD+ ILI  ARV  Q++  T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDR-YGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  140 bits (352), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 110/179 (61%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IG+ A +GIVIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ +R V   NY + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  + AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWND 181

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  140 bits (352), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GV  ++ +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYG-FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  139 bits (351), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GV  ++ +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYG-FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNY 179

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  139 bits (351), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 110/176 (62%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  AR+  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYG-FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNY 179

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  139 bits (350), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ + +GIVIA E+K +S+L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ AR V   NY + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG Y  WKA ++G  +SAA+T L+  + +
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNE 181

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  139 bits (351), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  +   +  A++GLTADA  +I  ARV   N+   Y ED+ VE L + + D+   + + 
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG DD  G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  139 bits (349), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + ++++ I+++ +GL AD+ ILI  AR+  Q++  T  + + +E L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVD-DRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNY 179

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  138 bits (348), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 65/176 (36%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+G+  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + +++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVD-DRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGV+ + AG D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNY 179

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  139 bits (349), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGV+  +GIV+  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  ++  ARV+   +   Y E I VE L + + D+   + + 
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ +  G D   GFQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 109/182 (59%), Gaps = 7/182 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
            YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++ TS LLE D S E
Sbjct: 7   EYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIE 65

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
           K+  +   I  A++GLTADA  +I  ARV   N+   Y EDI VE L + + D+   + +
Sbjct: 66  KIVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGE 125

Query: 125 HGG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM 178
                     RPFGV+ + AG D+  G+QL+ + PSG +  + A ++G+ +  AQ+ LQ 
Sbjct: 126 GASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQN 185

Query: 179 DY 180
           ++
Sbjct: 186 EW 187

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  138 bits (348), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 108/181 (59%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGV   +G+V+  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  +   +  A++GLTADA  +I  ARV    +   Y EDI +E L + + D+   + + 
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  137 bits (346), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 110/179 (61%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  L   I    +G+  D  +L++ +R V   NY + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  137 bits (346), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 110/180 (61%), Gaps = 4/180 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++G+ A +G++IA E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSY 122
            K+  L   I    +G+  D  +L++ +R V   NY + YGE  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  137 bits (346), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 74/181 (40%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  ARV    +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  137 bits (345), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  L   I    +G+  D  +L++ +R V   NY + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  + AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWND 181

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  137 bits (345), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ +R V   +Y + Y E  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG DD  GF LY  +PSG+Y  WKA ++G   +AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWND 181

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  137 bits (345), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR+    +   Y E+I VE L + + D+   + + 
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  137 bits (345), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  +++ I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  137 bits (344), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 111/180 (61%), Gaps = 4/180 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++G+ A +G++IA E+K +S+L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSY 122
            K+  L   I    +G+  D  +L++ +R V   NY + YGE    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  137 bits (345), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 108/181 (59%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGV   +G+V+  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  +   +  A++GLTADA  +I  ARV    +   Y E+I VE L + + D+   + + 
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  137 bits (344), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 111/176 (63%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  ++ +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           + ++++ ++++ +GL AD+ ILI  AR+  Q++  T  + I VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVD-DRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFG+S + AG D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNY 179

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  137 bits (344), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 108/181 (59%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  136 bits (343), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  L   I    +G+  D  +L++ +R V   +Y + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  + AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWND 181

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  136 bits (342), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 110/179 (61%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ +R V   NY + YG   P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  ++AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWND 181

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  135 bits (341), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  L   I    +G+  D  +L++ +R V   +Y + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  + AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWND 181

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  135 bits (341), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  L   I    +G+  D  +L++ +R V   +Y + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  + AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWND 181

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  135 bits (341), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 72/181 (39%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR+    +   Y E+I VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  135 bits (340), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G++IA E+K TS+L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I  A +G+  D  +LI+ +R V   +Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWND 181

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  135 bits (340), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 110/179 (61%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G+VIA E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ +R V   +Y + Y E  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  ++AA+T L+  + D
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWND 181

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  135 bits (340), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 108/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+G+  +D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  +V++ +GL AD+ ILI  ARV  Q++  T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYGF-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGV+ + AG D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNY 179

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  135 bits (339), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGV+  +G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  +  A++GLTADA  ++  ARV    +   Y EDI +E L + + D+   + + 
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  134 bits (336), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 69/177 (38%), Positives = 109/177 (61%), Gaps = 2/177 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A +G+VIA+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ +R V   +Y + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           Q GG+RPFGVS + AG D+  GF LY  +PSG+Y  WKA ++G  ++AA+T L+  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRW 179

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  134 bits (336), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 109/181 (60%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+G+   +G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  +  A++GLTADA  +I  ARV   ++   Y EDI +E L + + D+   + + 
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  133 bits (335), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 68/179 (37%), Positives = 108/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGV A +G+VIA E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+ ++   I    +G+  D  +L++ +R V   +Y + YGE  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RP+G S + AG D+  GF LY  +PSG+Y  WKA ++G  ++AA+T L+  + +
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNE 181

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  134 bits (336), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 107/181 (59%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y ED+ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  133 bits (334), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 83/236 (35%), Positives = 123/236 (52%), Gaps = 10/236 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  +   I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEI 235
           +                  +  +   L  + V+ S +   KEEG  I    K SEI
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVT--KEEGFKIYSDEKLSEI 239

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  133 bits (334), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 105/176 (59%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GV     +V+  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  + ++ AGL+ADA +LI  AR   Q++  T  + + VE + + ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGVDDRYGF-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG D      +LY + PSG Y+ W A ++G N    +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  132 bits (333), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 136/261 (52%), Gaps = 17/261 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+++  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y E+I VE L + + D+   + + 
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLL 239
           +                  +  +   L  +  + S+I   KEEG  I    K +EI + L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSIT--KEEGFKIYDDKKTAEIIKAL 243

Query: 240 VKSGITKKDAEDG--DADVEM 258
                 +K+AE+   D DVEM
Sbjct: 244 -----KEKEAEESPEDGDVEM 259

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  131 bits (330), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 107/181 (59%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+   +G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  131 bits (329), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 104/185 (56%), Gaps = 8/185 (4%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+G+ A +G+V+A E+K  S+L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQ-NYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  L   I    AG+  D  +L++ AR     NY + YGE  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDD------RYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG D+        GF LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKD 182
             + D
Sbjct: 183 KRWHD 187

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  130 bits (328), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 138/261 (52%), Gaps = 17/261 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLL 239
           +                  +  +   L  +  + S I   KE+G    KIY  S+  +L+
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCIT--KEDG---FKIYDDSKTAELI 240

Query: 240 VKSGITKKDAEDG--DADVEM 258
            +  + +K+A +   +ADVEM
Sbjct: 241 KE--LKEKEAAESPEEADVEM 259

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  130 bits (327), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 138/261 (52%), Gaps = 17/261 (6%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDXXXXXXXXXXXXXXXSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLL 239
           +                  +  +   L  +  + S I   KE+G    KIY  ++  +L+
Sbjct: 187 WHSSLSLKEAELLILKILKQVMEEK-LDENNAQLSCIT--KEDG---FKIYDDNKTAELI 240

Query: 240 VKSGITKKDAEDG--DADVEM 258
            +  + KK+A +   +ADVEM
Sbjct: 241 KE--LKKKEAAESPEEADVEM 259

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  129 bits (325), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 108/179 (60%), Gaps = 2/179 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++G+ A +G++IA E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTAR-VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYT 123
           K+  +   I    +G+  D  +L++ +R V   +Y + YGE  P ++LV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           Q GG+RPFGVS + AG D+  G+ LY  +PSG+Y  WKA ++G + +AA+T L+  + +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNE 181

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  129 bits (325), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 106/181 (58%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  129 bits (324), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 106/181 (58%), Gaps = 7/181 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  ++G+V+  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I  A++GLTADA  +I  AR     +   Y EDI VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AG D   G+QL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 Y 180
           +
Sbjct: 187 W 187

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  126 bits (316), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 102/172 (59%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ V+S LL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  +    +GL  D   L+N  R   Q++ KT+GE IP++ L  R+    Q++T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ GVDD+ G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELE 177

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IG+   DG+V A E+ +TS LL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I V  +GL  D   L+N AR   QN+ K YG  IPV+   +R+    Q++T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELE 177

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  122 bits (306), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TS L+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K YG+ IP+  L  R+    Q++T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I+ GVD+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  121 bits (303), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 63/172 (36%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+  +DGIV+A E+ VTS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  +  A +GL  D   L+N  R    ++ KTY   IP+  L  R+    Q++T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG++ I  GVDD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  120 bits (302), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++G+   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R   +++ + Y + IP+     R+    Q++T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G+DD  G  LY   PSG+Y G+K  + G+    A+T L+
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELE 177

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  120 bits (302), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++G+   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    N+ K Y + IPV  L  R+S   Q+YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+S I  G+D+  G  LY   PSG   G+K  + G    AA+  L+
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELE 177

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  119 bits (299), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 98/180 (54%), Gaps = 8/180 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G+L +DG+V+A E+ V S LL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  LYRLNDKIV-------VAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDI 118
               N KI         A +GL  D   L+N AR   Q + + Y  DIP   L  RM   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQSYTQHGGLRPFGVSFIYAGVDDRYG-FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q++T +  +RPFGV+ I+ GVD       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  118 bits (296), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 96/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ +  +   V+  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
            T T  L+ +   I +   G  ADA  +    R     +   YG D+PV +L KR +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q+YTQ   +RP GV   +  VD+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  119 bits (297), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TS LL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y   IP+     R+    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ GV D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  118 bits (296), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+  +DG+V A E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y + IP+     R+    Q++T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ GVD++ G  LY   PSG Y G++  + G    AA+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELE 177

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  119 bits (297), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D    +N  R    N+ K Y   IP+     R+    Q++T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G+D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  118 bits (296), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y   IP+     R+    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ GV D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  118 bits (295), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++G+  +DG+V+A E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y   IP+     R+    Q++T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ GVD   G  LY   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  118 bits (295), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y   IP+     R+    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ GV D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  118 bits (295), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y   IPV     R+    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ GV D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  117 bits (292), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IG+   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    N+ K YG+ I +     R+    Q+YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
             +RPFGVS I+ G+D   G  LY   P+G + G+K  + G    +A+  L+  + +
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELEKLFNE 182

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  117 bits (292), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IG+  +DG+V A E+ + S LL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y + I +     R+    Q++T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFG+  I+ GVDD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 99/182 (54%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++ +V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
            T +  ++ ++  I +   G   DA  +    +     +   YG DIPV +L KR++++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q+YTQ   +RP GV   +  VD+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  114 bits (286), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ +   D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
            T +  L+ ++  I +   G   DA      A+     Y   YG D+P ++L KRM+++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +  VD+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  114 bits (286), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++G+  +DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y + IPV     R+    Q++T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ GV D+ G  LY   PSG Y G+   + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELE 177

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  114 bits (286), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IG+  +DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y + IP+  L  R+    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G+D+  G  LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  114 bits (284), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 97/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I +   D  VI +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
            T +  L++++  + +   G   DA      A+     Y   YG D+P ++L KRM+++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +  VD+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  114 bits (284), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I +   +  VI  ++KV   LL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            +++++  I +   G   DA       +     +   YG D+PV++L KRM+++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  +D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  113 bits (283), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ V  +D  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I + V G   DA      A+     +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ V   D  VI  ++KV   LL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I +   G   DA       +     +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y S+PSG Y G+K  + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I +      VI  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I +   G   DA+     A+     Y   YG D+P ++L KRM++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFK 187

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ V  ++  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I + V G   DA      A+     +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  112 bits (279), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+ +++KV   LL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I + V G   DA      A+     +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  111 bits (277), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 58/173 (33%), Positives = 96/173 (55%), Gaps = 2/173 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  VI +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            +++++  I + + G   DA      A+     +   +G D+P ++L KRM+++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
              +RP GV   Y  VD+  G  +Y S+P+G + G+KA + G       T L+
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLE 183

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  111 bits (277), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ V  ++  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I + V G   DA      A+     +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  110 bits (276), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I + ++   V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
            T +  ++ +   I     G   DA  +    +     +   YG DIP  +L KRM+++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +   D+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  110 bits (275), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 96/178 (53%), Gaps = 2/178 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ V  ++  V+  ++KV   LLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I +   G   DA      A+     Y   YG D+P ++L KRM+++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
              +RP GV   +  VD+  G  +Y ++P+G + G+KA + G       T L+  +K+
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKN 189

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  111 bits (278), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IG+  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  LYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQH 125
           +  ++  I    +GL  D   L+N  R    ++ K Y   IP+    +R+    Q++T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G+D++ G  LY   PSG   G+   + G     A+  L+
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELE 177

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  110 bits (275), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ V   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  + +   G   DA      A++    +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  110 bits (275), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 95/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ V  ++  VI  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            +++++  I +   G   DA      A+     +   YG D+P ++L KRM+++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  108 bits (271), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 99/182 (54%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ +   + +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
           +T +  +++++  + +   G   DA      A+     +   YG D+P ++L KR++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +  VD+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  108 bits (269), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  +   VI  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  I +   G   DA      A+     Y   YG D+P ++L KRM+++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +  VD+  G  +Y S+P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFK 187

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  100 bits (249), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 93/177 (52%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGVLAQDGIVIAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ V  ++  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQ 124
            ++ ++  + +   G   DA      A+     +   YG D+P + L KRM+++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFK 187

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 90/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +V+ A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R  C      Y  D+ V    + +SD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  + AG D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLE 246

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score = 98.6 bits (244), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 92/178 (51%), Gaps = 6/178 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +     + A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLK-TYGEDIPVEMLVKRMSDIK 119
           +  +K+ + +D + +++AGL  DA +L N  R HC NY K  Y  ++ +E +   +SD  
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHC-NYSKLVYNRELSMEKIGYLLSDKA 116

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q  TQ  G RP+GV  +  G  D+ G  L    PSGN       ++GA +  ++T L+
Sbjct: 117 QKNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLE 173

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 97.1 bits (240), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 90/182 (49%), Gaps = 4/182 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +GV ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  D  +L N  R  C      Y   + +E     +SD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AG D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KD 182
           +D
Sbjct: 177 QD 178

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score = 96.7 bits (239), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 88/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +GV ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  D  +L N  R  C      Y   + +E     +SD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  + AG D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLE 173

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score = 96.7 bits (239), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 89/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +++  VI A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ R ++ + +++AGL  DA +L N  R  C      +   + VE     +SD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLE 173

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score = 96.3 bits (238), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 90/177 (50%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      Y  ++ +      +SD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  + AG D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLE 173

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 96.3 bits (238), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 88/178 (49%), Gaps = 6/178 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQD-GIVIAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIK 119
            +  +K+ + +D + V++AGL  DA +L N  R  C      Y   + +E     +SD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q  TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLE 173

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 95.9 bits (237), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 93/179 (51%), Gaps = 8/179 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQD-GIVIAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ +++   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLK-TYGEDIPVEMLVKRMSDI 118
            +  +K+ + +D + +++AGL  DA +L N  R  C NY K  +  D+ VE     +SD 
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQC-NYSKLVFNRDLSVEKAGFLLSDK 115

Query: 119 KQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q  TQ  G RP+GV  +  G  D+ G  L    PSGN       ++GA +  ++T L+
Sbjct: 116 AQKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLE 173

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score = 95.1 bits (235), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 88/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++D  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      Y   + VE     + D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLE 173

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score = 95.1 bits (235), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 87/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +A+AGL  DA +L N  R  C      Y   + VE     + D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLE 173

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score = 95.1 bits (235), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 87/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      Y   + VE +   + D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLE 173

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score = 95.1 bits (235), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 88/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+AA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      +   + VE     +SD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLE 173

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score = 94.4 bits (233), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 87/177 (49%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++      E  
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNAD---ELS 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      +   + VE     + D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G  D+ G  L    PSGN T     ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLE 173

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 93.6 bits (231), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      +   + VE     + D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G  D+ G  L    PSGN       S+GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLE 173

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 93.6 bits (231), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++      E  
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNAD---ELS 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + +D + +++AGL  DA +L N  R  C      +   + VE     + D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G  D+ G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLE 173

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score = 92.8 bits (229), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +A+AGL  DA +L N  R  C      +   + VE     + D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G  D+ G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLE 173

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score = 92.4 bits (228), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + ++ + +++AGL  DA +L N  R  C      +   + +E     + D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G  D+ G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLE 173

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score = 91.7 bits (226), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +  +K+ + +  + +++AGL  DA +L N  R  C      +   + VE     +SD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       S+GA +  A+T L+
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLE 173

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 90.9 bits (224), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 86/177 (48%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120
           +   K+ + ++ + +++AGL  DA +L N  R  C      +   + +E     + D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             TQ  G RP+GV  +  G D+  G  L    PSGN       ++GA +  A+T L+
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLE 173

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score = 89.4 bits (220), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 80  LTADAEILINTAR--VHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIY 137
           +  D  +LI+ +R   H Q Y + Y E  P ++LV  ++ I Q  TQ GG+RPFGVS + 
Sbjct: 1   MGPDFRVLIDKSRKVAHTQ-YKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLV 59

Query: 138 AGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           AG D+  GF LY  +PSG+Y  WKA ++G   +AA+T L+  + D
Sbjct: 60  AGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWND 104

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 84.0 bits (206), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 86/182 (47%), Gaps = 9/182 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGVLAQDGIVIAAERKVTST 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ ++   V+ A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRM 115
           L    +   K+ + ++ + +++AGL  DA +L N  R  C      +   + VE     +
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G  D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIG-HDKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQ 177
           L+
Sbjct: 177 LE 178

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 69.7 bits (169), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%)

Query: 102 YGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWK 161
           YG D+P ++L KRM+++ Q YTQ   +RP GV   +  VD+  G  +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISVGANTSAAQTLLQMDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 67.4 bits (163), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 83  DAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDD 142
           D   L+N AR    ++ KTYG  I +  L  R+    Q++T +  +RPFG++ I  GVD+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 96

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 71/153 (46%), Gaps = 6/153 (3%)

Query: 32  AGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           AGT +G+  +D  V+A + + T+          K++   D I+++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVK-- 88

Query: 92  RVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTS 151
               +N +K Y  D   +M +K  +   Q       + P+ V  I AG+D+     +Y+ 
Sbjct: 89  --RFKNSMKWYRFDHNKKMTIKSAARSIQHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 179

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           +S E R   +E+     S + GT +G+  +D  V+A + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRP 130
            IV++  G  AD E L+       +N LK Y  D   + L    +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVK----RFKNSLKWYHFDHNDKKLAMSSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 22/156 (14%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV   DG+VIAA+ + T   +  D +  KL+R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVT----- 85

Query: 94  HCQNYLKTYGEDIPVEML--------VKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYG 145
                 +  G +I +  L        V  +  +KQ   ++ G    G   I AGVD   G
Sbjct: 86  ------QLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             L++ +  G+      +S+G+ + AA  +L+  +K
Sbjct: 137 SHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWK 172

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 79/174 (45%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           +S E     +E+A    + + GT +G+  +D  ++A + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRP 130
            IV++  G  AD E L+       +N LK Y  D   + L  + +     +  +G    P
Sbjct: 68  NIVISANGFAADGEALVK----RFKNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 73/156 (46%), Gaps = 22/156 (14%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV  ++G+VIAA+ + T   +  D +  KL+R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVT----- 85

Query: 94  HCQNYLKTYGEDIPVEML--------VKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYG 145
                 +  G +I +  L        V  +  +KQ   ++ G    G   I AGVD   G
Sbjct: 86  ------QLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             L++ +  G+      +S+G+ + AA  +L+  +K
Sbjct: 137 AHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWK 172

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 78/174 (44%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           +S E +   +E+     S + GT +G+  +D  V+A + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRP 130
            I+++  G  AD   L+       QN LK Y  D   + L  R +     +  +G    P
Sbjct: 69  NILISANGFAADGNALVKR----FQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKRFFP 124

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 79/171 (46%), Gaps = 14/171 (8%)

Query: 20  YQVEYALESISH--------AGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +GV  + G+VIAA+ + T   +  + + EKL+R+  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPF 131
           +I  A AG  AD E +      + + +    G +  V   V  +  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTWLIGSNLELHSLYTGREPRV---VSALQKLKQHLFKYQG--HI 123

Query: 132 GVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           G   I AGVD   G  L++ +  G+    +  S+G+ + AA  +L+  +++
Sbjct: 124 GAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWRE 173

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 22/156 (14%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV   +G+VIAA+ + T   +  D +  KL+R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVT----- 85

Query: 94  HCQNYLKTYGEDIPVEML--------VKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYG 145
                 +  G +I +  L        V  +  +KQ   ++ G    G   I AGVD   G
Sbjct: 86  ------QLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             L++ +  G+      +S+G+ + AA  +L+  +K
Sbjct: 137 SHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWK 172

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 73/149 (48%), Gaps = 6/149 (4%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV   +G+VIAA+ + T   +  D +  KL+R++ +I  A AG  AD E +      
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLIGS 91

Query: 94  HCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNP 153
           + + +   Y +  P   +V  +  +KQ   ++ G    G   I AG D   G  L++   
Sbjct: 92  NVELH-SLYAKRQP--RVVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQA 145

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKD 182
            G+      +S+G+ + AA  +L+ ++K+
Sbjct: 146 HGSTDVGFYLSLGSGSLAAMAVLESNWKE 174

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 72/156 (46%), Gaps = 22/156 (14%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV   +G+VIAA+ + T   +  D +  KL+R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVT----- 85

Query: 94  HCQNYLKTYGEDIPVEML--------VKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYG 145
                 +  G +I +  L        V  +  +KQ   ++ G    G   I AGVD   G
Sbjct: 86  ------QLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 FQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             L++ +  G+      +S+G+ + AA  +L+  +K
Sbjct: 137 SHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWK 172

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 78/170 (45%), Gaps = 14/170 (8%)

Query: 20  YQVEYALESISHA--------GTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           YQ    L S SHA         T +GV   +G+VIAA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPF 131
           +I  A AG  AD E +      + + +   Y    P   +V  +  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNLELH-SLYASREP--RVVSALQMLKQHLFKYQG--HI 123

Query: 132 GVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           G   I AGVD   G  L++ +  G+       S+G+ + AA  +L+  +K
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWK 172

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 73/148 (49%), Gaps = 6/148 (4%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +G+  +DG+VIAA+ + T   +  D +  KL+R++ KI  A AG  AD E +      
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 91

Query: 94  HCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNP 153
           + + +   Y    P   +V  +  +KQ   ++ G    G   I AGVD   G  L++ + 
Sbjct: 92  NIELH-SLYTSRSP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 145

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYK 181
            G+      +S+G+ + AA  +L+  ++
Sbjct: 146 HGSTDVGYYLSLGSGSLAAMAVLESQWR 173

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 75/149 (50%), Gaps = 6/149 (4%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV  ++G+VIAA+ + T   +  + + EKL++++ +I  A AG  AD + +      
Sbjct: 31  TIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDAVTGLIGS 90

Query: 94  HCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNP 153
           + + +    G +  V   V  +  +KQ   ++ G    G   I AGVD   G  L++ + 
Sbjct: 91  NLELHSLFTGREPRV---VSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSVHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKD 182
            G+       S+G+ + AA  +L+ ++K+
Sbjct: 145 HGSTDVGYYQSLGSGSLAAMAVLEANWKE 173

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 80/178 (44%), Gaps = 30/178 (16%)

Query: 20  YQVEYALESISHA-------GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           YQ    L + SHA       GT I GV    G+VIAA+ + T   +  D + EKL+R++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEML--------VKRMSDIKQSYT 123
           +I  A AG  AD E +            +  G +I +  L        V  +  +KQ   
Sbjct: 69  RIWCAGAGTAADTEAVT-----------QLIGSNIELHSLYTNREPRVVSALQMLKQHLF 117

Query: 124 QHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           ++ G    G   I AGVD   G  L++ +  G+       S+G+ + AA  +L+ ++K
Sbjct: 118 KYQG--HVGAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWK 172

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAE----ILIN 89
           T +GV    G+VIAA+ + T   +  D +  KL+R+  +I  A AG  AD E    ++ +
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 90  TARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLY 149
              +H Q     Y    P   +V  +  +KQ   ++ G    G   I AGVD   G  L+
Sbjct: 91  NLELHSQ-----YANREP--RVVSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLF 140

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           +    G+      +S+G+ + AA   L+ ++K
Sbjct: 141 SVQAHGSTDVGHYLSLGSGSLAAMATLESNWK 172

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 75/174 (43%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           Y  E A + I H         GT +G+  +D  V+A + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEML-VKRMSDIKQSYTQHGGLRP 130
            IV++  G  AD E L+   +    N +K Y  D   + L +K  +   Q         P
Sbjct: 68  NIVISANGFAADGEALVKRFK----NSIKWYHFDHNDKKLSIKSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  VIA + + T+       +  K++   D I+++  G  AD + L+  
Sbjct: 28  NGGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKK 87

Query: 91  ARVHCQNYLKTYGEDI-PVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLY 149
            +    N LK Y  D    +M +K  +   Q       + P+ V  I AG+D+     +Y
Sbjct: 88  FK----NNLKWYHFDHNNKKMTLKSAARNIQHLLYGKRMFPYYVHTIIAGLDEDGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 144 SFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKN 178

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKI 73
           P      +E+     S + GT +G+  +D  V+A + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  VVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFG 132
           V++  G  AD+  L+   R    N LK Y  +   + L    +     +  +G    P+ 
Sbjct: 79  VISANGFAADSTALVKRFR----NSLKWYHFNENEKRLSLSAAARNIQHLLYGKRFFPYY 134

Query: 133 VSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 135 VHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 72/153 (47%), Gaps = 16/153 (10%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV   +G++IAA+ + T   +  D +  KL+R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLVGS 90

Query: 94  HCQ-NYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDR----YGFQL 148
           + + + L T+ E      +V  +  +KQ   ++ G    G   I AGVD      +  Q 
Sbjct: 91  NLELHSLYTHRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPTGPHLFAVQA 144

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           + S   G Y      S+G+ + AA  +L+ ++K
Sbjct: 145 HGSTDVGFYH-----SLGSGSLAAMAVLETNWK 172

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 77/174 (44%), Gaps = 8/174 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           +S E +   +E+     S + GT +G+  +D  V+A + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRP 130
            I+++  G  AD E L+       QN LK Y  +     L    +     +  +G    P
Sbjct: 88  NILISANGFAADGEALVK----RFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKRFFP 143

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 144 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 197

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 78/171 (45%), Gaps = 16/171 (9%)

Query: 20  YQVEYALESISH--------AGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           YQ    L S SH          T +GV    G+VIAA+ + T   +  D +  KL+R++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KIVVAVAGLTADAEILINTARVHCQ-NYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRP 130
           +I  A AG  AD E +      + + + L T  E      +V  +  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHSLSTRRE----PRVVTTLQMLKQHLFRYQG--H 122

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
            G   I AGVD   G  L++ +  G+      +S+G+ + AA  +L+  ++
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWR 172

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 74/165 (44%), Gaps = 8/165 (4%)

Query: 22  VEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGL 80
           +E+     S + GT +G+  +D  V+A + + T+          K++   D I+++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAG 139
            AD   L+       QN LK Y  D   + L  + +     +  +G    P+ V  I AG
Sbjct: 78  AADGTALVK----RFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKRFFPYYVHTIIAG 133

Query: 140 VDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           +D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 70/148 (47%), Gaps = 6/148 (4%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV    G++IAA+ + T   +  D + EKL+R+  +I  A AG  AD E +      
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAVTQLISS 91

Query: 94  HCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNP 153
           + + +    G +  V   V  +  +KQ   ++ G    G   I AGVD   G  L++ + 
Sbjct: 92  NIELHSLYTGREPRV---VSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 145

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYK 181
            G+       S+G+ + AA  +L+ ++ 
Sbjct: 146 HGSTDVGYYQSLGSGSLAAMAVLEANWN 173

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 75/159 (47%), Gaps = 7/159 (4%)

Query: 24  YALESISHAGTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTA 82
           YA    +  GT I GV  + G+VIAA+ + T   +  D +  KL+R+  +I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDD 142
           D E +      + + +   Y E  P   +V  +  +KQ   ++ G    G   I AGVD 
Sbjct: 80  DTEAVTQLIGSNIELH-SLYTERAP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             G  L++ +  G+       ++G+ + AA  +L+  +K
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWK 172

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 70/155 (45%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + + T+          K++   D I+++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVK- 86

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
                +N +K Y  D   + L    +     +  +G    P+ V  I AG+DD     +Y
Sbjct: 87  ---RFKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKRFFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + +  +          K++   D IV++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
            +    N +K Y  D   + L  + +     +  +G    P+ V  I AG+D+     +Y
Sbjct: 87  FK----NSIKWYHFDHNDKKLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 74/165 (44%), Gaps = 8/165 (4%)

Query: 22  VEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGL 80
           +E+     S + GT +G+  +D  V+A + + T+          K++   D IV++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAG 139
            AD E L+       +N +K Y  D   + L    +     +  +G    P+ V  I AG
Sbjct: 78  AADGEALVK----RFKNSIKWYHFDNNDKTLSLSSAARNIQHLLYGKRFFPYYVHTIIAG 133

Query: 140 VDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           +D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 75/160 (46%), Gaps = 14/160 (8%)

Query: 27  ESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAE- 85
           ++ S   T +GV    G+VIAA+ + T   +  + +  KL+R++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDD 142
              ++ +   +H       Y    P   +V  +  +KQ   ++ G    G   I AGVD 
Sbjct: 84  VTKLIGSNLELH-----SLYASRAP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
             G  L++ +  G+       S+G+ + AA  +L+  +K+
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKE 173

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 74/174 (42%), Gaps = 15/174 (8%)

Query: 20  YQVEYALESISH--------AGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLND 71
           Y  E A   I H         GT +G+  +D  V+A + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRP 130
            IV++  G  AD E L+   +    N +K Y  D   + L    +     +  +G    P
Sbjct: 68  NIVMSANGFAADGEALVKRFK----NSVKWYHFDHNDKKLSLSSAARNIQHLLYGKRFFP 123

Query: 131 FGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + V  I AG+D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + H + Y   YGE
Sbjct: 79  QYHLEMYTAQYGE 91

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + H + Y   YGE
Sbjct: 79  QYHLEMYTAQYGE 91

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 70/148 (47%), Gaps = 6/148 (4%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV    G+VIAA+ + T   +  D +  KL+R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNP 153
           + + +   Y    P   +V  +  +KQ   ++ G    G   I AGVD   G  L++ + 
Sbjct: 91  NIELH-SLYSNREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYK 181
            G+       S+G+ + AA  +L+ ++K
Sbjct: 145 HGSTDVGYYHSLGSGSLAAMAVLESNWK 172

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 70/148 (47%), Gaps = 6/148 (4%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARV 93
           T +GV    G+VIAA+ + T   +  D +  KL+R++ +I  A AG  AD E +      
Sbjct: 31  TIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNP 153
           + + +   Y    P   +V  +  +KQ   ++ G    G   I AGVD   G  L++ + 
Sbjct: 91  NIELH-SLYTNRSP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYK 181
            G+       S+G+ + AA  +L+  +K
Sbjct: 145 HGSTDVGYYQSLGSGSLAAMAVLESHWK 172

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 73/165 (44%), Gaps = 8/165 (4%)

Query: 22  VEYALESIS-HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGL 80
           +E+     S + GT +G+  +D  V+A + + T+          K++   D I+++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAG 139
            AD E L+       +N +K Y  D   + L    +     +  +G    P+ V  I AG
Sbjct: 77  AADGEALVK----RFKNSIKWYHFDNNDKKLALSSAARNIQHLLYGKRFFPYYVHTIIAG 132

Query: 140 VDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           +D+     +Y+ +P G+Y      + GA  S     L  Q+++K+
Sbjct: 133 LDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKN 177

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + H + Y   YGE
Sbjct: 79  QYHLELYDSQYGE 91

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + H + Y   YGE
Sbjct: 79  QYHLELYTSQYGE 91

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H + Y   YG
Sbjct: 79  QYHLELYTSQYG 90

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + H   Y   YGE
Sbjct: 79  QHHLDLYAAQYGE 91

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 4/146 (2%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + + T+          K++   D I+++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQLYT 150
            +     Y   + + + ++   + +    Q       + P+ V  I AG+D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNI----QHLLYGKRMFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL 176
            +P G+Y   +  + G+  S     L
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFL 168

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 31/179 (17%)

Query: 20  YQVEYALESISHA--------GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLN 70
           YQ   AL + SH+        GT I GV   +G++IAA+ + T   +  + +  KL+R++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEML--------VKRMSDIKQSY 122
            +I  A AG  AD E +            +  G +I +  L        V  +  +KQ  
Sbjct: 69  PRIWCAGAGTAADTEAVT-----------QLIGSNIELHSLYTSREPRVVSALQMLKQHL 117

Query: 123 TQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
            ++ G    G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++
Sbjct: 118 FKYQG--HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWE 173

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H + Y   YG
Sbjct: 79  QYHLELYTSQYG 90

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H + Y   YG
Sbjct: 79  QYHLELYTSQYG 90

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + +  +          K++   DKIV++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVK- 85

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
                +N +K Y  D   + L    +     +  +G    P+ V  I AG+D+     +Y
Sbjct: 86  ---RFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 5/147 (3%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + + T+          K++   D IV+   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVK- 88

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
                +N +K Y  D   + L    +     +  +G    P+ V  I AG+D+     +Y
Sbjct: 89  ---RFKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKRFFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL 176
           + +P G+Y   +  + GA  S     L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFL 172

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H + Y   YG
Sbjct: 79  QYHLELYESQYG 90

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H + Y   YG
Sbjct: 79  QYHLELYTSQYG 90

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 3/76 (3%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T      +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGEDIP 107
           + H + Y   YG  IP
Sbjct: 79  QYHLEVYTSQYG--IP 92

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%)

Query: 35  AIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARVH 94
           ++ V  +DG+++ A+ + T+     +  T+KL R+++KI    +G  AD + + +  + H
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  CQNYLKTYGE 104
              Y   YGE
Sbjct: 86  LDLYTAQYGE 95

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + +  +          K++   D IV++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVK- 85

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
                +N +K Y  D   + L    +     +  +G    P+ V  I AG+D+     +Y
Sbjct: 86  ---RFKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKRFFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 74/159 (46%), Gaps = 14/159 (8%)

Query: 27  ESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAE- 85
           ++ S   T +GV    G++IAA+ + T   +  + +  KL+R++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDD 142
              ++ +   +H       Y    P   +V  +  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELH-----SMYASREP--RVVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             G  L++ +  G+       S+G+ + AA  +L+ +++
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWR 172

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + +  +          K++   D IV++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVK- 85

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
                +N +K Y  D   + L    +     +  +G    P+ V  I AG+D+     +Y
Sbjct: 86  ---RFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 7/155 (4%)

Query: 31  HAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINT 90
           + GT +G+  +D  V+A + +  +          K++   D +V++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVK- 85

Query: 91  ARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGG-LRPFGVSFIYAGVDDRYGFQLY 149
                +N +K Y  D   + L    +     +  +G    P+ V  I AG+D+     +Y
Sbjct: 86  ---RFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKD 182
           + +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 33  GTAIGVLAQDG-IVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  +  DG +++ A+ + T+     +  T+KL R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H + Y   YG
Sbjct: 79  QYHLELYTSQYG 90

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RVHCQNYLKTYGE 104
           + + + Y   YGE
Sbjct: 79  QHYLELYTMQYGE 91

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R+ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           +   + Y   +GE
Sbjct: 79  QYQLELYTAQFGE 91

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R+ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           +   + Y   +GE
Sbjct: 79  QYQLELYTAQFGE 91

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 38/69 (55%)

Query: 36  IGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTARVHC 95
           + V  +DG+++ A+ + T+     +  T+KL R++DK+    +G  AD + + +  + + 
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQHYL 60

Query: 96  QNYLKTYGE 104
           + Y   +GE
Sbjct: 61  ELYTAQFGE 69

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYG 103
           + +   Y   YG
Sbjct: 79  QYYLDLYTTQYG 90

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 36.2 bits (82), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T      +  T+KL R++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + +   Y   YGE
Sbjct: 79  QYYLDLYTAQYGE 91

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 35.8 bits (81), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYG 103
           + H   Y   +G
Sbjct: 79  QYHLDIYSTQFG 90

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYK 220

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 72/163 (44%), Gaps = 8/163 (4%)

Query: 20  YQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAG 79
           Y   +  + I    + I +  +DG++IAA+R  +   L + +  E+L+ +    VV ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILINTARVHC--QNYLKTYGED---IPVEMLVKRMSDIKQSYTQHGGLRPFGVS 134
             +D + L N         NY   Y ED   +    + + ++++   Y +   + P   +
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAEDEEALKPSYVFEYLANVM--YNRRSKMNPLWNA 146

Query: 135 FIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            I AG++D   F  Y +     Y+   +++ G     A  LL+
Sbjct: 147 LIVAGLEDGKPFLKYVNLLGVTYSA-PSLATGFGAHLALPLLR 188

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 35.4 bits (80), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + +   Y   +GE
Sbjct: 79  QYYLDMYEGQFGE 91

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + T+       +  K+ R+N  ++  +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 186

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 187 YYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYK 219

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query: 33  GTAI-GVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILINTA 91
           GT+I  V  +DG+++ A+ + T+     +  T+KL R+++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADIV 78

Query: 92  RVHCQNYLKTYGE 104
           + + + Y   +GE
Sbjct: 79  QHYLELYTAQFGE 91

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +Y+
Sbjct: 186 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYR 218

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYK 220

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ Y     + I V    K ++++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYK 220

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYK 220

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYK 220

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYK 220

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  L  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           ++H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYK 220

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYK 220

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYK 220

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 60/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K + ++   Y   G      +  +  G   + G  +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKEGPTI 186

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 187 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYK 219

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 60/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K + ++   Y   G      +  +  G   + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 186 YYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYK 218

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYK 220

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/153 (19%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + ++       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K + ++   Y  +G      +  +  G   + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYK 220

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 32.7 bits (73), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERK----VTSTLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ + A+D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKLYR-----LNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSD 117
             KL R     L  K+VV +  LT +     N        Y ++  + I +E++ +   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKE-----NQDMAKMLGYGRSKEQHIELELIKRENQE 301

Query: 118 IKQSYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 30/153 (19%), Positives = 60/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     + I V    K + ++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGTQCRLHELKEKQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYK 220

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/153 (19%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    + GI++A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     E I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 129 TWLGSQCRLHELREKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 184

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +Y+
Sbjct: 185 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYR 217

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 61/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +     + I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELKEKDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYK 220

>TBLA0E00150 Chr5 (19516..20313) [798 bp, 265 aa] {ON} Anc_3.574
           YFR050C
          Length = 265

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 13/153 (8%)

Query: 34  TAIGVLA---QDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADA---EIL 87
           T   VLA   + G+VIAA+   +   L +    E+L ++    VV V+G  +D    E L
Sbjct: 40  TGTSVLAMKYKGGVVIAADNLASYGSLLRFNGIERLIKVGQNTVVGVSGDVSDMQHIERL 99

Query: 88  INTARVHCQNYLKTYGED---IPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRY 144
           +        NY  TY E    +    + K +S +   Y++   + P   + I AGV++  
Sbjct: 100 LEEIETD-NNYDNTYSESFEQLQPSYVFKYLSAVM--YSRRSKMNPLWNAIIVAGVENGA 156

Query: 145 GFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            F  Y +     YT    ++ G     A  L++
Sbjct: 157 PFMRYVNLLGVTYTS-PTLATGFGAHLANPLMR 188

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 60/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    Q GI++A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +       I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELKEKSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYK 220

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/153 (20%), Positives = 60/153 (39%), Gaps = 4/153 (2%)

Query: 29  ISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEILI 88
           I+H  T +    + GIV+A + + T+       + +K+  +N  ++  +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                 C+ +       I V    K +S++   Y   G      +  +  G   + G  +
Sbjct: 132 TWLGSQCRLHELKEKNRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Y  +  G         VG+  + A  +L  +YK
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYK 220

>TDEL0D06420 Chr4 complement(1150503..1151300) [798 bp, 265 aa] {ON}
           Anc_3.574 YFR050C
          Length = 265

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 57/125 (45%), Gaps = 11/125 (8%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEIL--INTA 91
           + I +   +G+VIAA+   +   L + T  E+L  +    VV ++G  +D + +  +   
Sbjct: 43  SVISMKYDNGVVIAADNLGSYGSLLRFTDIERLIPVGKNTVVGISGDISDMQHIEHLLEE 102

Query: 92  RVHCQNYLKTYGEDIPVEMLVKRMSDIKQ-----SYTQHGGLRPFGVSFIYAGVDDRYGF 146
                NY  +Y +D   E L  R S++ +      Y +   + P   + I AGV+D+  F
Sbjct: 103 LETENNYDNSYADD--EEAL--RPSNVFEYLAAVMYQRRSKMNPLWNALIVAGVEDKKPF 158

Query: 147 QLYTS 151
             Y +
Sbjct: 159 LRYVN 163

>Ecym_3148 Chr3 (272390..275548) [3159 bp, 1052 aa] {ON} similar to
           Ashbya gossypii AFR424C
          Length = 1052

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%)

Query: 224 QVIQKIYKPSEIKQLLVKSGITKKDAEDGDADVEM 258
           ++I K  KPS+  QLL    +T K  E GD DVE+
Sbjct: 266 EIISKKMKPSDKLQLLSMLNLTDKVVELGDVDVEV 300

>Kpol_380.12 s380 complement(19992..20789) [798 bp, 265 aa] {ON}
           complement(19992..20789) [798 nt, 266 aa]
          Length = 265

 Score = 30.0 bits (66), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 68/150 (45%), Gaps = 10/150 (6%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADA---EILINT 90
           + I +   +G++IAA+       L +    E+L+ + +  VV V+G  +D    E L++ 
Sbjct: 43  SVISMKYNNGVIIAADNLGAYGSLLRFNDVERLFAIGENTVVGVSGDISDMQYIERLLDE 102

Query: 91  ARVHCQNYLKTYG---EDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQ 147
            ++   NY  + G   E +    + + ++ +   Y++   + P   + I AG++D   F 
Sbjct: 103 LQIE-NNYDNSTGDGAESLKPSYVFEYLAAVM--YSRRSKMNPLWNAIIVAGMEDNKPFL 159

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Y +     Y+  + ++ G     A  LL+
Sbjct: 160 RYVNLLGVTYSS-QTLATGFGAHMANPLLR 188

>AFR258W Chr6 (901053..901841) [789 bp, 262 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR050C (PRE4)
          Length = 262

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 17/127 (13%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAG----------LTAD 83
           + I +   +G +IAA+R  +   L + T  ++L+ + +  VV V+G          L  D
Sbjct: 41  SVIAMKYNNGTIIAADRLGSYGSLLRFTDMDRLFAVGESTVVGVSGDVSDMQYLQRLLQD 100

Query: 84  AEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDR 143
            EI  N    H         E +    + + ++ +   Y +   L P   + I AGV+D 
Sbjct: 101 MEIENNYDNSHADG-----AEALKPSYIFEYLASLM--YQRRSKLNPLWNAIIVAGVEDG 153

Query: 144 YGFQLYT 150
             F  Y 
Sbjct: 154 QAFLRYV 160

>ZYRO0E09724g Chr5 complement(771237..772022) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P30657 Saccharomyces
           cerevisiae YFR050C PRE4 20S proteasome beta-type subunit
          Length = 261

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 55/135 (40%), Gaps = 17/135 (12%)

Query: 27  ESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADA-- 84
           + I    + + V   +G+VIAA+   +   L +  + E+L  + D  VV ++G  +D   
Sbjct: 32  QPIVTGTSVLSVKYNNGVVIAADNLGSYGSLLRFNNVERLIPVGDNTVVGISGDISDMQH 91

Query: 85  -EILINTARVHCQNYLKTYGEDIP-------VEMLVKRMSDIKQSYTQHGGLRPFGVSFI 136
            E LI    V   NY  ++ + +         E L   M      Y +     P   + I
Sbjct: 92  IETLIEEL-VTENNYDNSFADSVEGLKPSYVFEYLAAVM------YHRRSKFNPLWNAII 144

Query: 137 YAGVDDRYGFQLYTS 151
            AGV+D   F  Y +
Sbjct: 145 VAGVEDGKPFSRYVN 159

>SAKL0F00616g Chr6 (56334..57131) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 58/131 (44%), Gaps = 9/131 (6%)

Query: 27  ESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADA-- 84
           + I    + I +   +G++IAA+       L + T  E+L  +    VV ++G  +D   
Sbjct: 36  QPIVTGTSVISMKYNNGVIIAADNLGAYGSLLRFTDMERLIPVGQNTVVGISGDISDMQH 95

Query: 85  -EILINTARVHCQNYLKTYG---EDIPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGV 140
            E L+   +    NY  TY    E +    + + ++++   Y +   + P   + I AGV
Sbjct: 96  IEHLLEELQTE-NNYDNTYADEEESLQPSYVFEYLANVM--YNRRSKMNPLWNAIIVAGV 152

Query: 141 DDRYGFQLYTS 151
           +++  F  Y +
Sbjct: 153 ENKKPFLRYVN 163

>KNAG0I00190 Chr9 (21910..22707) [798 bp, 265 aa] {ON} Anc_3.574
           YFR050C
          Length = 265

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 56/123 (45%), Gaps = 7/123 (5%)

Query: 34  TAIGVLAQDGIVIAAERKVTSTLLEQDTSTEKLYRLNDKIVVAVAGLTADAEIL--INTA 91
           + I +   +G++IAA+   +   L + T  E+L+ +    VV ++G  +D + +  +   
Sbjct: 43  SVISMKYNNGVIIAADHLGSYGSLLRFTDIERLFPVGKNTVVGISGDISDMQHIEALLEE 102

Query: 92  RVHCQNYLKTYGED---IPVEMLVKRMSDIKQSYTQHGGLRPFGVSFIYAGVDDRYGFQL 148
                NY  ++ +D   +    + + ++ +   Y +   + P   + I AGV+D   F  
Sbjct: 103 LETENNYDNSHADDEESLQPSYVFEYLATVM--YQRRSKMNPLWNALIVAGVEDSKPFLK 160

Query: 149 YTS 151
           Y +
Sbjct: 161 YVN 163

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,688,116
Number of extensions: 893106
Number of successful extensions: 2270
Number of sequences better than 10.0: 242
Number of HSP's gapped: 2108
Number of HSP's successfully gapped: 242
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)