Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0B007503.501ON2172178581e-117
Smik_16.4063.501ON2122173256e-37
TPHA0A057203.501ON2202203241e-36
Skud_16.4483.501ON2082173231e-36
Suva_16.4823.501ON2352233216e-36
Kpol_480.83.501ON2391183121e-34
YPR154W (PIN3)3.501ON2151293082e-34
TDEL0D056903.501ON2012133021e-33
YGR136W (LSB1)3.501ON2411143033e-33
NDAI0B059203.501ON2351233023e-33
CAGL0F04829g3.501ON2022132986e-33
Suva_7.4243.501ON2491142991e-32
KNAG0A079903.501ON2211272944e-32
SAKL0F02486g3.501ON2301202875e-31
KLTH0G02332g3.501ON2331232842e-30
Smik_6.2323.501ON2411122814e-30
NCAS0F036003.501ON2371242798e-30
Kwal_47.189053.501ON2361232781e-29
KAFR0G037403.501ON2342382753e-29
Skud_7.4473.501ON2381332623e-27
AFR320W3.501ON2571212625e-27
TBLA0C045303.501ON2222242561e-26
Ecym_12283.501ON2531152572e-26
KLLA0E03873g3.501ON2201172326e-23
ZYRO0D09702g3.501ON1581582067e-20
ZYRO0G20372gsingletonON150552013e-19
TBLA0D029103.501ON2691161962e-17
NCAS0A089901.356ON434711332e-08
ABR008C2.502ON443711312e-08
TPHA0C040202.502ON485641251e-07
ZYRO0B01298g2.502ON411561199e-07
KAFR0D033602.502ON455531191e-06
CAGL0K02761g2.502ON450531191e-06
TDEL0A027802.502ON451541181e-06
Smik_8.472.502ON447531181e-06
SAKL0E02200g2.502ON511531172e-06
KLLA0B13475g2.502ON508531172e-06
Ecym_24402.502ON459501162e-06
KLTH0D06138g2.502ON489531153e-06
Suva_8.512.502ON456531144e-06
TPHA0A022101.356ON397611144e-06
KLTH0H12980g1.356ON399531144e-06
NDAI0B045801.356ON424621135e-06
Kpol_1056.372.502ON501531127e-06
YHL002W (HSE1)2.502ON452531111e-05
Suva_6.961.356ON455671111e-05
NCAS0A050802.502ON450531111e-05
TBLA0F034901.356ON511611101e-05
TBLA0B054702.502ON539531101e-05
Kwal_0.3711.356ON217531081e-05
Ecym_27471.356ON452531092e-05
Kwal_26.79022.502ON532411092e-05
TBLA0A025705.470ON493581092e-05
KLLA0A08360g1.356ON423531082e-05
NDAI0A043505.470ON459581082e-05
TPHA0O012801.356ON454531083e-05
AEL017W1.356ON416531073e-05
SAKL0D09702g1.356ON428531073e-05
Skud_8.432.502ON454531073e-05
Smik_8.811.356ON468531064e-05
YHR016C (YSC84)1.356ON468511064e-05
Skud_8.681.356ON475671055e-05
Skud_6.1081.356ON459531055e-05
Smik_7.3351.356ON460531055e-05
CAGL0I08965g1.356ON437531056e-05
YFR024C-A (LSB3)1.356ON459531056e-05
Ecym_23082.591ON678561056e-05
TDEL0D022401.356ON433661056e-05
Ecym_23165.470ON421801056e-05
NCAS0B072501.356ON441531047e-05
KNAG0C046305.470ON516661047e-05
KLTH0F15114g5.470ON435601047e-05
SAKL0G03454g5.470ON468551048e-05
KAFR0C044001.356ON459601048e-05
KNAG0C020401.356ON464531039e-05
NCAS0A119205.470ON463551031e-04
Suva_15.1991.356ON457511031e-04
NDAI0G059601.356ON423741031e-04
TBLA0D049501.356ON468531031e-04
ZYRO0G00792g1.356ON469531012e-04
KAFR0E036405.470ON441551002e-04
NDAI0K021302.502ON459531003e-04
Skud_4.6615.470ON46055993e-04
ZYRO0D11110g5.470ON45959993e-04
Kpol_1008.251.356ON44966993e-04
TPHA0E015005.470ON45755985e-04
Kwal_55.212875.470ON46160985e-04
YDR388W (RVS167)5.470ON48255976e-04
Smik_4.6585.470ON47255976e-04
ABR082W2.591ON68356977e-04
Kpol_440.105.470ON47055968e-04
SAKL0H24222g4.45ON152659978e-04
AFR140C5.470ON38854968e-04
CAGL0M01650g5.470ON46655950.001
TDEL0A033405.470ON47356950.001
Ecym_25266.366ON52458920.003
KNAG0I015801.356ON58163920.003
KNAG0B022307.413ON90456920.003
KAFR0A009701.356ON39653910.003
Skud_12.2567.365ON40375900.005
Ecym_72314.108ON114661900.005
Smik_12.2517.365ON38872890.005
Kpol_538.255.170ON70762900.005
NDAI0A033304.108ON122658900.006
ACR266W2.159ON62670890.006
YLR191W (PEX13)7.365ON38675890.006
KLTH0E09790g2.159ON62276880.008
TBLA0B096202.319ON94164890.008
CAGL0H10516g2.319ON88060880.010
KLLA0D16874g8.344ON22768860.010
KLLA0F23848g2.159ON64951870.012
NDAI0E043907.365ON44586870.012
TDEL0E055204.45ON158959870.014
ZYRO0B04004g7.419ON37169850.020
KLLA0E09043g2.319ON81456850.020
NCAS0A034904.108ON123558860.020
Ecym_47107.365ON39997840.023
TPHA0F031007.365ON38173840.025
SAKL0A00594g6.366ON63658840.027
KLLA0C12551g2.591ON60759840.031
Kwal_33.148357.365ON38467830.033
Kwal_47.178942.159ON62155830.034
CAGL0E02783g4.108ON120370840.034
Suva_10.2877.365ON39275820.040
KAFR0I010404.108ON120360830.042
CAGL0A02145g1.356ON39152810.052
KLTH0E07744g4.108ON124958820.053
Kpol_1025.404.108ON120260820.060
SAKL0B11176g2.591ON63364810.067
KLLA0E03059g5.470ON42857800.073
TPHA0K016004.108ON113658810.073
CAGL0C01881g7.413ON99961810.084
Kwal_47.174814.108ON124961810.084
KLTH0B04818g7.365ON38067800.084
Ecym_82195.170ON102465800.087
ZYRO0G10098g4.108ON139271800.091
KNAG0A067102.502ON41953800.093
YLL017WsingletonOFF10348750.096
KAFR0L015807.365ON34466790.096
Ecym_54262.159ON67260800.096
Smik_8.1922.159ON63370800.10
CAGL0C03597g6.366ON58057790.10
Kwal_47.169434.335ON46061790.11
Suva_2.564singletonON4342710.11
NCAS0A145707.419ON35555790.11
TBLA0F002806.366ON57671790.12
Skud_8.1752.159ON63352790.12
TBLA0C041004.108ON130258790.14
SAKL0G17600g4.335ON44163780.14
Kpol_325.126.366ON57050780.15
Kpol_1072.562.159ON63752780.17
NCAS0D019505.170ON93960780.17
TPHA0B028902.159ON63452780.18
Ecym_33662.319ON90662780.19
ZYRO0D17358g6.366ON66850770.21
Suva_2.337.413ON98281770.21
NDAI0A015007.413ON104799770.21
KLTH0A07348g6.366ON62656770.21
KLLA0B04862g4.335ON39766770.22
ACR230C7.365ON39880760.22
NDAI0A014707.419ON36774760.24
TBLA0I010507.419ON37160760.24
KLTH0F09240g2.319ON88863770.26
ZYRO0B16214g2.159ON65979760.26
KLLA0E06953g7.419ON35759760.28
Skud_3.1606.366ON58658760.29
Smik_3.1866.366ON59162750.33
SAKL0F11748g7.365ON40867750.33
SAKL0E10780g2.159ON62567750.36
TPHA0H023806.366ON52859750.36
AGR170C4.108ON112157750.38
KNAG0B028807.295ON43941750.40
KLTH0D08580g2.591ON60063750.41
KAFR0J026506.366ON55350750.42
TPHA0K006807.419ON35560730.52
AGL237C6.366ON57859740.54
YHR114W (BZZ1)2.159ON63370740.55
TPHA0E007307.413ON97854740.55
TDEL0C018207.365ON38967730.56
ADL288C2.319ON92561740.57
YCR088W (ABP1)6.366ON59262730.60
Suva_15.3102.159ON63470730.61
Kpol_1045.217.419ON35875720.69
SAKL0H21912g4.108ON125358730.70
SAKL0E06820g2.319ON90562730.72
NCAS0D047406.366ON59450730.75
KLTH0H09416g4.45ON152877730.75
Kwal_23.64376.366ON63156730.75
KNAG0C029104.108ON124470730.80
KLLA0A04983g4.108ON125170720.85
ZYRO0F13882g8.344ON28850710.92
KLLA0F14575g5.170ON85158721.0
NDAI0I002206.366ON61553711.0
TDEL0A078106.366ON55850711.1
KAFR0F007502.159ON60272711.2
Kwal_23.34162.319ON88359711.3
Skud_2.1044.108ON121457711.3
TDEL0F023804.108ON125558711.4
Smik_2.1134.108ON123057711.4
CAGL0G03597g7.419ON35358701.4
Suva_3.1246.366ON60053701.5
AGL293C7.413ON98456701.5
KAFR0K020007.419ON33256701.5
NCAS0E027907.365ON37967701.5
KLLA0D09306g4.45ON153768701.6
YBL007C (SLA1)4.108ON124457692.1
Smik_2.357.413ON98563692.2
KNAG0I027006.366ON57550692.3
Skud_10.2005.170ON110168692.3
Skud_12.514.45ON125438692.4
ZYRO0B02706g7.365ON39680682.4
SAKL0F13112g7.419ON34059682.6
KNAG0B025207.365ON314104672.8
KNAG0J027504.45ON165257682.9
Kpol_1030.457.365ON38863682.9
Ecym_71347.419ON33259673.0
KNAG0B050005.170ON85564683.1
KNAG0A06930singletonON30599673.4
TDEL0C028107.419ON33768673.6
AGR306C5.170ON92365673.7
TDEL0E046005.170ON98361673.7
CAGL0E03476g4.45ON156446674.2
Scer_YGOB_SDC25 (SDC25)4.45ON125244674.3
Smik_10.2515.170ON112263674.3
TBLA0C055602.159ON67356664.5
AGL286C7.419ON33059656.1
Smik_12.474.45ON125148666.2
Suva_2.1184.108ON116657656.3
TPHA0E010707.365ON37261656.3
KLLA0F10175g6.366ON57650657.2
CAGL0M05357g8.539ON55782648.0
Suva_10.584.45ON125960649.2
CAGL0F05577g8.402ON66631649.2
Kwal_27.108007.401ON143980649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0B00750
         (217 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   335   e-117
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   129   6e-37
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   129   1e-36
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   129   1e-36
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   128   6e-36
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   124   1e-34
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   123   2e-34
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   120   1e-33
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   121   3e-33
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   120   3e-33
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   119   6e-33
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   119   1e-32
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   117   4e-32
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   115   5e-31
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   114   2e-30
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   112   4e-30
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   112   8e-30
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   111   1e-29
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   110   3e-29
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   105   3e-27
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   105   5e-27
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   103   1e-26
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   103   2e-26
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...    94   6e-23
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...    84   7e-20
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    82   3e-19
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    80   2e-17
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    56   2e-08
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    55   2e-08
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    53   1e-07
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    50   9e-07
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    50   1e-06
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    50   1e-06
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    50   1e-06
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    50   1e-06
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    50   2e-06
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    50   2e-06
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    49   2e-06
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    49   3e-06
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    49   4e-06
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    49   4e-06
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    49   4e-06
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    48   5e-06
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    48   7e-06
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    47   1e-05
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    47   1e-05
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    47   1e-05
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    47   1e-05
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    47   1e-05
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    46   1e-05
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    47   2e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    47   2e-05
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    47   2e-05
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    46   2e-05
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    46   2e-05
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    46   3e-05
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    46   3e-05
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    46   3e-05
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    46   3e-05
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    45   4e-05
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    45   4e-05
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    45   5e-05
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    45   5e-05
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    45   5e-05
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    45   6e-05
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    45   6e-05
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    45   6e-05
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    45   6e-05
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    45   6e-05
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    45   7e-05
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    45   7e-05
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    45   7e-05
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    45   8e-05
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    45   8e-05
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    44   9e-05
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    44   1e-04
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    44   1e-04
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    44   1e-04
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    44   1e-04
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    44   2e-04
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    43   2e-04
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    43   3e-04
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    43   3e-04
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    43   3e-04
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    43   3e-04
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    42   5e-04
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    42   5e-04
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    42   6e-04
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    42   6e-04
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    42   7e-04
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    42   8e-04
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    42   8e-04
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    42   8e-04
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    41   0.001
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    41   0.001
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    40   0.003
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    40   0.003
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    40   0.003
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    40   0.003
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    39   0.005
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    39   0.005
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    39   0.005
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    39   0.005
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    39   0.006
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    39   0.006
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    39   0.006
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    39   0.008
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    39   0.008
CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]...    39   0.010
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    38   0.010
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    38   0.012
NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.3...    38   0.012
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    38   0.014
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    37   0.020
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    37   0.020
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    38   0.020
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    37   0.023
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    37   0.025
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    37   0.027
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    37   0.031
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    37   0.033
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    37   0.034
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    37   0.034
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    36   0.040
KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4....    37   0.042
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    36   0.052
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    36   0.053
Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON} (104...    36   0.060
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    36   0.067
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    35   0.073
TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON} Anc_4...    36   0.073
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    36   0.084
Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa] ...    36   0.084
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    35   0.084
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    35   0.087
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    35   0.091
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    35   0.093
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    33   0.096
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    35   0.096
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    35   0.096
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    35   0.10 
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    35   0.10 
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    35   0.11 
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    32   0.11 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    35   0.11 
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    35   0.12 
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    35   0.12 
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    35   0.14 
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    35   0.14 
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    35   0.15 
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    35   0.17 
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     35   0.17 
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    35   0.18 
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    35   0.19 
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    34   0.21 
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    34   0.21 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    34   0.21 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    34   0.21 
KLLA0B04862g Chr2 (442398..443591) [1194 bp, 397 aa] {ON} conser...    34   0.22 
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    34   0.22 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    34   0.24 
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    34   0.24 
KLTH0F09240g Chr6 (799558..802224) [2667 bp, 888 aa] {ON} simila...    34   0.26 
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    34   0.26 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    34   0.28 
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    34   0.29 
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    33   0.33 
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    33   0.33 
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    33   0.36 
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    33   0.36 
AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON...    33   0.38 
KNAG0B02880 Chr2 (555679..556998) [1320 bp, 439 aa] {ON} Anc_7.2...    33   0.40 
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    33   0.41 
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    33   0.42 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    33   0.52 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    33   0.54 
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    33   0.55 
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    33   0.55 
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    33   0.56 
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    33   0.57 
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    33   0.60 
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    33   0.61 
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    32   0.69 
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    33   0.70 
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    33   0.72 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    33   0.75 
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    33   0.75 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    33   0.75 
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    33   0.80 
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    32   0.85 
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    32   0.92 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    32   1.0  
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    32   1.0  
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    32   1.1  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    32   1.2  
Kwal_23.3416 s23 (280746..283397) [2652 bp, 883 aa] {ON} YDL117W...    32   1.3  
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    32   1.3  
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    32   1.4  
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    32   1.4  
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    32   1.4  
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    32   1.5  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    32   1.5  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    32   1.5  
NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.3...    32   1.5  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    32   1.6  
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    31   2.1  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    31   2.2  
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    31   2.3  
Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa] ...    31   2.3  
Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016...    31   2.4  
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    31   2.4  
SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]...    31   2.6  
KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.36...    30   2.8  
KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa] ...    31   2.9  
Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON} (1021...    31   2.9  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    30   3.0  
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    31   3.1  
KNAG0A06930 Chr1 (1080433..1081350) [918 bp, 305 aa] {ON}              30   3.4  
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    30   3.6  
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    30   3.7  
TDEL0E04600 Chr5 complement(861586..864537) [2952 bp, 983 aa] {O...    30   3.7  
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    30   4.2  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    30   4.3  
Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa] ...    30   4.3  
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    30   4.5  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   6.1  
Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W...    30   6.2  
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    30   6.3  
TPHA0E01070 Chr5 (220093..221211) [1119 bp, 372 aa] {ON} Anc_7.3...    30   6.3  
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    30   7.2  
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    29   8.0  
Suva_10.58 Chr10 (117228..121007) [3780 bp, 1259 aa] {ON} YLL016...    29   9.2  
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...    29   9.2  
Kwal_27.10800 s27 (501753..506072) [4320 bp, 1439 aa] {ON} YBL07...    29   9.7  

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  335 bits (858), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 172/217 (79%), Positives = 172/217 (79%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

Query: 121 DAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 180
           DAMFQDIPPSSFST                                             H
Sbjct: 121 DAMFQDIPPSSFSTQQYVPPYVPPPQEKPQQPKPQPQPQPQPQPQPQPQPQPEPKPQKQH 180

Query: 181 HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGIANKF 217
           HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGIANKF
Sbjct: 181 HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGIANKF 217

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  129 bits (325), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 104/217 (47%), Gaps = 10/217 (4%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +NRS+TNIRTEL++L ES VIS D FD+ N+ LP  WD      A         E
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPP---SASRNTSSTSLE 57

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           YVEA++++ PQ+  DL L+ GDK+++LEKLS +WY+G   G+ G+FP+NYVK   FSG +
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPA-FSGSN 116

Query: 121 DAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 180
                ++PP                                                   
Sbjct: 117 GQ--SNLPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPSTNYYQQPQQAPAPAPQQQQQ 174

Query: 181 HHSGAGKNLLKQF----GNSIVFGAGQRIGSDIVNGI 213
                  N LK F    GN+ +FGAG  IGSDIVN I
Sbjct: 175 QQQPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSI 211

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  129 bits (324), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 106/220 (48%), Gaps = 8/220 (3%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD---GKPIGGAGEKHPPH 57
           MS   +NRS+T IRTELE+L ESKVIS   F E N  LP+ +D      +  A       
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 58  EPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFS 117
             EYVEAI+R+ PQ+  DL +Q GDK+++LEK+S +WY+G   GKVGVFPSNY K   FS
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPA-FS 119

Query: 118 GVDDAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 177
           G  +A   ++ P                                                
Sbjct: 120 GSTNASKSELTPVPPQYQQQQQPIQQVQSYHSYQQPFPPQSTNYYQQAPQQQQQQQQPEQ 179

Query: 178 XXHHH-SGAGKNLL---KQFGNSIVFGAGQRIGSDIVNGI 213
               H S  GK+L     + GN+ +FGAG  IGSDIVN I
Sbjct: 180 QQQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSI 219

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  129 bits (323), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 80/217 (36%), Positives = 105/217 (48%), Gaps = 14/217 (6%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +NRS+T IRTEL++L ES VIS D FD+ N+ LP  W+      A         E
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPS---SAARDTSSASLE 57

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           YVEA++++ PQ+  DL L+ GDKV++LEKLS +WY+G   G+VG+FP+NYVK   FSG +
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPA-FSGSN 116

Query: 121 DAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 180
            +     PP   +                                               
Sbjct: 117 GSSNLPPPPQYKAQELQQAPTQNSAVSSYQQQPFPPPSTNYYQQPQQQPQQAPPQQQPSS 176

Query: 181 HHSGAGKNLLKQF----GNSIVFGAGQRIGSDIVNGI 213
           H      N LK F    GN+ +FGAG  IGSDIVN I
Sbjct: 177 H------NHLKSFGSKLGNAAIFGAGASIGSDIVNSI 207

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  128 bits (321), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 106/223 (47%), Gaps = 17/223 (7%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD--GKPIGGAGEKHPPHE 58
           MS   VNRS+TNIRTEL++L ES VIS D FD+ N+ LP  WD    P G          
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASL---- 74

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSG 118
            EYVEA++++ PQ+  DL L+ GDKV++LEKLS +WY+G   G+ G+FP+NYVK V FS 
Sbjct: 75  -EYVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPV-FSD 132

Query: 119 VDDAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXXXXXXXXXX 174
             D   +  PP  +                                              
Sbjct: 133 -SDGQHRLPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPP 191

Query: 175 XXXXXHHHSGAGKNLLKQFG----NSIVFGAGQRIGSDIVNGI 213
                     +  N LK FG    N+ +FGAG  IGSDIVN I
Sbjct: 192 PPQQQQQQQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSI 234

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  124 bits (312), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 83/118 (70%), Gaps = 2/118 (1%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS  S+NRS+T+++TELE+L +S VIS + FD+ N  LPD  D      A     P+  E
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNL-E 59

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSG 118
           YVEAI+R+ PQ+  DL +Q GDK+++LEK+S +WY+GK  GKVGVFPSNYVK   FSG
Sbjct: 60  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPA-FSG 116

 Score = 32.3 bits (72), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 187 KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           K+   + GN+ +FGAG  +GSD+VN I
Sbjct: 212 KSFGSKLGNAAIFGAGATLGSDLVNSI 238

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  123 bits (308), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +NRS+TNIRTEL++L  S VIS D +D+ N+ LP  WD      A     P   E
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDP---ANAPRNASPASLE 57

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           YVEA++++ PQ+  DL L+ GDKV++LEKLS +WY+G   G+ G+FP+NYVK   FSG +
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPA-FSGSN 116

Query: 121 DAMFQDIPP 129
                  PP
Sbjct: 117 GPSNLPPPP 125

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 187 KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           K+   + GN+ +FGAG  IGSDIVN I
Sbjct: 188 KSFGSKLGNAAIFGAGASIGSDIVNNI 214

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  120 bits (302), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 102/213 (47%), Gaps = 13/213 (6%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +NRS+  +RTEL++L ES VIS++ +D  N+ LP N   K  GG          E
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNASNK--GG----------E 48

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           Y+EA++++ PQ+  DL L  GDK+E+LEK S +W++G+  G+VG+FP+NYVKA  +SG D
Sbjct: 49  YMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAA-YSGSD 107

Query: 121 DAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 180
                  P    +                                              H
Sbjct: 108 RPSVPPPPQYEQAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQQQQH 167

Query: 181 HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           H     K    + GN+ +FGAG  +GSD+VN I
Sbjct: 168 HSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSI 200

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  121 bits (303), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 79/114 (69%), Gaps = 8/114 (7%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHE-- 58
           MS   VNRS+ NIR ELE+L ES VIS D F+  N KLP+ WDG       ++ P +   
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGN------QRSPQNADT 54

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112
            EYVEA++ ++ Q+  DL L+ GDK+++LEK+S DWYRGK+  K+G+FP+NYVK
Sbjct: 55  EEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVK 108

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 183 SGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           S A K+   + GN+ +FGAG  IGSDIVN I
Sbjct: 210 SSAFKSFGSKLGNAAIFGAGSAIGSDIVNSI 240

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  120 bits (302), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 85/123 (69%), Gaps = 6/123 (4%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEP- 59
           MS   +NRS+TNIRTEL++L ES VIS +TF++ N +LP  +D     G+ E      P 
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPN---GSRESVSSQAPT 57

Query: 60  -EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSG 118
            EYVEAI+ ++PQ++ DL L+ GDK++++EK S +W++GK  G+VG+FPSNYV+   FSG
Sbjct: 58  LEYVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPA-FSG 116

Query: 119 VDD 121
              
Sbjct: 117 TSQ 119

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 180 HHHSGAG-KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           HHH+G   K    + GN+ +FGAG  IGSDIVN I
Sbjct: 200 HHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSI 234

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  119 bits (298), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 99/213 (46%), Gaps = 12/213 (5%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS  ++NRS+ NIR EL++L ES VIS   F E   KLP N       GA    PP   E
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN-------GASPVPPPMSLE 53

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           YVEA++ ++PQ+  DL ++ GDK+++LEK SA+WYRG   G+ G+FPSNYV+       +
Sbjct: 54  YVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPSAN 113

Query: 121 DAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 180
            A     PP+  +                                               
Sbjct: 114 LA-----PPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVVEQQPVQQS 168

Query: 181 HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
                 K+   + GN+ +FGAG  +GSD+VN I
Sbjct: 169 SAHNGLKSFGSKLGNAAIFGAGATLGSDLVNSI 201

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  119 bits (299), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 81/114 (71%), Gaps = 8/114 (7%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDG--KPIGGAGEKHPPHE 58
           MS   +NRS+ NIR EL++L ES+VIS D F+  N KLP+ WD   +P+  A  +     
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVE----- 55

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112
            E+VEA++ ++PQ++ DL L+ GDK++ILEK+S DWYRGK   +VG+FP+NYVK
Sbjct: 56  -EFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVK 108

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 183 SGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           S A K+   + GN+ +FGAG  IGSDIV+ I
Sbjct: 218 SSAFKSFGSKLGNAAIFGAGSTIGSDIVHSI 248

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  117 bits (294), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 86/127 (67%), Gaps = 8/127 (6%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGG-----AGEKHP 55
           MS   +NRS+TN+RTEL++L ES+VIS +TF++    LP  +D           + E H 
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESH- 59

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVK 115
             + EYVEA++ ++PQ+  DLEL+ GDK+++LEK SA+WY+GK  G+VG+FPSNYVK   
Sbjct: 60  -AKLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPA- 117

Query: 116 FSGVDDA 122
           FSG   A
Sbjct: 118 FSGESSA 124

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 20/33 (60%)

Query: 181 HHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           H   A K    Q GN+ +FGAG  IGSDIVN I
Sbjct: 188 HKHNAFKKFGSQLGNAAIFGAGATIGSDIVNSI 220

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  115 bits (287), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 80/120 (66%), Gaps = 4/120 (3%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +NRS+T IRTEL++L ES+VIS +TF + +  LP  +D       G +      E
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPN---ANGNRSSSPSLE 57

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           YVEAI+ ++ Q+  DL L+ GDK+++LEK S++WY+GK  G VG+FPSNYVK   FSG +
Sbjct: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPA-FSGSN 116

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 22/34 (64%)

Query: 180 HHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           H+ S A K    + GN+ +FGAG  IGSDIVN I
Sbjct: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSI 229

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  114 bits (284), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 83/123 (67%), Gaps = 14/123 (11%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEP- 59
           MS  S+NRS++ +RTELE+L ES VI+ +++ +    LP+ +D  P  G      P +P 
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYD--PSRG------PQQPS 52

Query: 60  ----EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVK 115
               E+VEAI+ ++ Q+  DL LQVGDKVE+LEK S +W++GK  G+VG+FPSNYVK   
Sbjct: 53  ATQGEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPA- 111

Query: 116 FSG 118
           FSG
Sbjct: 112 FSG 114

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 182 HSGAGKNLLKQFG----NSIVFGAGQRIGSDIVNGI 213
           HS    +  K+FG    N+ VFGAG  IGSDIVN I
Sbjct: 197 HSSQASSAFKKFGGKLGNAAVFGAGATIGSDIVNSI 232

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  112 bits (281), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 74/112 (66%), Gaps = 4/112 (3%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   VNRS+ NIR ELE+L ES VIS D FD  N KLP+ W+          +     E
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWND----NTRSPNNADTEE 56

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112
           YVEA++ ++ Q+  DL L+ GDK+++LEK+S DWY+GK   +VG+FP+NYVK
Sbjct: 57  YVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVK 108

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 187 KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           K+   + GN+ +FGAG  IGSDIVN I
Sbjct: 214 KSFGSKLGNAAIFGAGSAIGSDIVNSI 240

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  112 bits (279), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 7/124 (5%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD-----GKPIGGAGEKHP 55
           MS  S+NRS+  IRTEL++L ES VIS++TFD+    LP  +D        I  +    P
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 56  PHE-PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
             +  E+VEAI+ ++PQ++ DL L+ GDK+E++EK S +W++G+  G+ G+FPSNYVK  
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 115 KFSG 118
            FSG
Sbjct: 121 -FSG 123

 Score = 37.4 bits (85), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 181 HHSGAG-KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           HHS  G K    + GN+ +FGAG  IGSDIVN I
Sbjct: 203 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSI 236

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  111 bits (278), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 83/123 (67%), Gaps = 4/123 (3%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS  S+NRS++ +RTELE+L ES VI+  ++ +    LP+ ++      +    P  + E
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPP---RSTPTVPSSQSE 57

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           +VEAI+ ++ Q+  DL LQVGDK+E+LEK S +WY+G+  G+VG+FPSNYVK   FSG +
Sbjct: 58  FVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPA-FSGSN 116

Query: 121 DAM 123
            ++
Sbjct: 117 ASL 119

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 182 HSGAG-KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           H+GA  K    + GN+ +FGAG  IGSDIVN I
Sbjct: 203 HTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSI 235

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  110 bits (275), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 106/238 (44%), Gaps = 30/238 (12%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKP-------------- 46
           MS   +NR+ITNI+TEL++L ES++I++   DE  ++LP+ +D                 
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 47  ----------IGGAGEKHPP-HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWY 95
                     +  A    PP ++ EYVEA++ ++PQ++ DL L  GDKV+ILEK SA+WY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 96  RGKNKGKVGVFPSNYVKAVKFSGVDDAMFQDIPPSSFSTXXXXXXXXXXXXXXXXXXXXX 155
           +G   G++G+FP+NYVK      V    F   PP                          
Sbjct: 121 KGTCNGQIGMFPANYVKP-----VTKDSFAPPPPQYQQYSNNYQQPSYSQPAYPPASTGY 175

Query: 156 XXXXXXXXXXXXXXXXXXXXXXXXHHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
                                      +   K    + GN+ +FGAG  +GSD+VN I
Sbjct: 176 YQQPQQVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSKLGNAAIFGAGATLGSDLVNSI 233

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  105 bits (262), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 58/133 (43%), Positives = 79/133 (59%), Gaps = 9/133 (6%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWD--GKPIGGAGEKHPPHE 58
           MS   +NRS+ NIR ELE+L ES VIS + F   +  LP  WD   K    A  +     
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTE----- 55

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSG 118
            EYVEA++ ++ Q+  DL L+ GDK++ILEK+S DWY+GK    +G+FP+NYVK   F+ 
Sbjct: 56  -EYVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPA-FTR 113

Query: 119 VDDAMFQDIPPSS 131
                F+  P SS
Sbjct: 114 STSPDFEKTPLSS 126

 Score = 32.3 bits (72), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 187 KNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           K+   + G++ +FGAG  IGSDI+N I
Sbjct: 211 KSFGSKLGDAAIFGAGSTIGSDIINSI 237

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  105 bits (262), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 77/121 (63%), Gaps = 10/121 (8%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLP---DNWDGKPIGGAGEKHPPH 57
           MS   +NRS+  IRTEL +L++S VI+R   ++    LP   +   G P   AG      
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPV---- 56

Query: 58  EPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFS 117
             EYVEA++ ++ Q+  DL+ +VG+K+E+LEK S +WY+G+  GKVG+FPSNYVK   FS
Sbjct: 57  --EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPA-FS 113

Query: 118 G 118
           G
Sbjct: 114 G 114

 Score = 35.4 bits (80), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 183 SGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           SGA K    + GN+ +FGAG  +GSD+V+ I
Sbjct: 226 SGAAKKFGSKLGNAAIFGAGATLGSDLVHSI 256

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  103 bits (256), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 103/224 (45%), Gaps = 14/224 (6%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +N+S++ I TEL++LL+S  I + T+ + +  LP       +    + +     E
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR--APEVPSRQQSNSSKNEE 58

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           +VEAI+++ PQ+  DL+L  GDK+ + EK S +W++GK  GKVGVFPSNYV+   FSG +
Sbjct: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPA-FSGSN 117

Query: 121 DAMFQD--IPP---------SSFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 169
           +   +    PP         S  S+                                   
Sbjct: 118 NEKSRSDAAPPQYQQDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPPPQQQQAYQAPPQQ 177

Query: 170 XXXXXXXXXXHHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
                     HH     KN   + GN+ +FGAG  +GSD+VN I
Sbjct: 178 VVVEQAPAKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSI 221

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  103 bits (257), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 81/115 (70%), Gaps = 4/115 (3%)

Query: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60
           MS   +NRS+ NI+TELE+L+ES VIS+    +    L +  +G  +  A ++      E
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGT-MKAASQQV---LKE 56

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVK 115
           YVEA++ + PQ+  DLE +VGDK+E+LEK SADWY+G++ G+VG+FPSNYVK+++
Sbjct: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLR 111

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 4/36 (11%)

Query: 182 HSGAGKNLLKQFG----NSIVFGAGQRIGSDIVNGI 213
            S  G ++ K+FG    N+ VFGAG  +GS++V+ I
Sbjct: 217 QSSGGSDIFKKFGSKLGNAAVFGAGATMGSELVHHI 252

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score = 94.0 bits (232), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 49/117 (41%), Positives = 72/117 (61%), Gaps = 6/117 (5%)

Query: 5   SVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGA-GEKHPPHEPEYVE 63
           SV  S+  I++EL+YL E   ++   + +    LP      P+    G+ +     E VE
Sbjct: 3   SVEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVADTMGQNN-----EIVE 57

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120
           A++ ++PQ+  DL L+ GDK+EILEKLS +WY+GK  G+VGVFPSNYVK+V    V+
Sbjct: 58  ALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVKSVDTKDVE 114

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 180 HHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           H  S A K    + GN+ +FGAG  IGSD+VN I
Sbjct: 186 HQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSI 219

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score = 84.0 bits (206), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 75/158 (47%), Gaps = 8/158 (5%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGV 119
           E+VEAI+R+ PQ++ DL L  GDK+E+LEK S +W+RG+  G+VG+FPSNYVK   FSG 
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPA-FSGG 62

Query: 120 DDAMFQDIPPS----SFSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 175
            D      PP     + ++                                         
Sbjct: 63  FDRPAAPPPPQYDQKAMASQPSGGNAMWQQPSPYPPPSTNYYQPPPPQQQQPQPMVVQQE 122

Query: 176 XXXXHHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
               HH  G GK    + GN+ +FGAG  +GSD++N I
Sbjct: 123 QGKRHH--GLGK-FGSKLGNAAIFGAGATLGSDLINSI 157

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 82.0 bits (201), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 46/55 (83%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           EYVE ++ +KPQ KEDL ++ GDKVE++EKLSADWY+GK  GK G+FP+NYVK V
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPV 69

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 180 HHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213
           H H   GK +  + GN+ +FG G  +G+D+V+ I
Sbjct: 117 HRHHALGK-VGSKLGNAAIFGVGATLGNDLVDSI 149

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 80.1 bits (196), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 67/116 (57%), Gaps = 9/116 (7%)

Query: 4   GSVNRSITNIRTELEYLLESKVISRDTFDEFN------RKLPDNWD-GKPIGGAGEKHPP 56
            ++  + T IR  LE L+++K IS + +DE        R+ P       P  GA    P 
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGA--LSPR 65

Query: 57  HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112
           + P+YVEAI+ +  ++K DLEL  GD +E++ K S  WY G+  GKVGVFP+NYVK
Sbjct: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 192 QFGNSIVFGAGQRIGSDIVNGI 213
           + GN+ +FGAG   G+DIVN I
Sbjct: 247 KLGNAALFGAGSAFGADIVNDI 268

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 42/71 (59%), Gaps = 5/71 (7%)

Query: 49  GAGEKHPP---HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKV 103
           G GE   P   H      A++R+  ++K DL  Q GDK+ IL++  +  DW+ G+  GK 
Sbjct: 364 GKGENTDPTSGHASNEAVALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKE 423

Query: 104 GVFPSNYVKAV 114
           G+FP+NYV+ +
Sbjct: 424 GIFPANYVELI 434

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 46  PIGGAGEKHPPHEPE-----YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNK 100
           P   A E   P +P+      V+AIF     E ++L  + GD + ++E++  DW+RG  +
Sbjct: 194 PAALASETSLPEQPQPQIVRRVKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLR 253

Query: 101 GKVGVFPSNYV 111
           GKVG+FP NYV
Sbjct: 254 GKVGIFPVNYV 264

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%)

Query: 51  GEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNY 110
           G+   P+    V A++    QE+ +L  + GD + +LE++  DW+RG   GK+G+FP NY
Sbjct: 223 GQPQKPNIIRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNY 282

Query: 111 VKAV 114
           V  +
Sbjct: 283 VTPI 286

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 36/56 (64%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           P+ V+A++     E ++L  + GD + +LE++  DW+RG  +G +G+FP NYV  V
Sbjct: 229 PKRVKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 35/53 (66%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++ +   E ++L  + GD + +LE++  DW+RG  +G++G+FP NYV  +
Sbjct: 216 VRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTPI 268

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E+++L  + GD + +LE++  DW+RG   GK+G+FP NYV  +
Sbjct: 217 VRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPI 269

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 35/54 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVK 115
           V A++    +E ++L  + GD + +LE++  DW+RG   GKVG+FP NYV  ++
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTPIE 281

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E E+L  + GD + +LE++  DW++G  +GK+G+FP NYV  +
Sbjct: 217 VRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTPI 269

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E ++L  + GD + ++E++  DW+RG  +G+VG+FP NYV  +
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTPI 285

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++ +   E+++L  + GD + ++E++  DW+RG   G VG+FP NYV  V
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV 279

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYV 111
           V A++     E ++L    GD + ++E++  DW+RG  +GKVG+FP NYV
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYV 280

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A+     +E ++L  + GD + ++E++  DW+RG+ +G+VG+FP NYV  V
Sbjct: 217 VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPV 269

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E ++L  + GD + +LE++  DW++G  +G++G+FP NYV  +
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTPI 278

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 3/61 (4%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKA 113
           P  P+ + A+FR+K ++  DL    GD V IL+K     DW+ G+   + G+FP+NYV+ 
Sbjct: 338 PQGPKAI-ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVEL 396

Query: 114 V 114
           V
Sbjct: 397 V 397

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +K ++  DL  + GD + IL+K  +  DW+ G+N G+ G+FP+NYV+ V
Sbjct: 347 ALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVELV 399

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 55  PPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVK 112
           P   P+ V A++ +  +E +DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+
Sbjct: 364 PSSAPKAV-ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

Query: 113 AV 114
            V
Sbjct: 423 LV 424

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E ++L  + GD + +LE++  DW++G  +G +G+FP NYV  +
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPI 292

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E ++L  + GD + +LE++  DW++G  +G +G+FP NYV  +
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTPI 274

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 50  AGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFP 107
           A    P        A+F +  +E  DL  + GD V IL+K  +  DW+ G+  G+ G+FP
Sbjct: 389 AAPTSPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFP 448

Query: 108 SNYVKAV 114
           +NYV+ V
Sbjct: 449 ANYVELV 455

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E ++L    GD + +LE++  DW+RG  +G  G+FP NYV  +
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTPI 272

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 3/61 (4%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKA 113
           P  P+ V A++ +  +E+ DL  + GD + I++K  +  DW+ G+  G+ G+FP+NYV+ 
Sbjct: 452 PGSPKAV-ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVEL 510

Query: 114 V 114
           V
Sbjct: 511 V 511

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E  +L  + GD ++++E++  DW+RG  +G VG+FP NYV  +
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNPI 297

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  ++  DL  + GD + IL+K  +  DW+ G+N G+ G+FP+NYV+ V
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYVELV 217

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +K ++  DL  + GD + IL+K ++  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVELV 452

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 29/41 (70%)

Query: 74  EDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           ++L  + GD + ++E++  DW+RG  +GK+G+FP NYV  V
Sbjct: 241 DELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPV 281

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVKAVK 115
           E V A++ Y+ Q + DL    G  +EI+++ +   +W+ GK  G+ GVFP NYVK  K
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVKINK 492

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +K +E  DL  + GD + I++K  +  DW+ G+  GK G+FP+NYV+ V
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVELV 423

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVKAVK 115
           E V A++ Y+ Q   DL    G  +EI+E+ S   +W+ GK  G+ GVFP NYV+  K
Sbjct: 401 ETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGVFPGNYVQVNK 458

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + IL+K  +  DW+ G+  GK G+FP+NYV+ V
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVELV 454

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +K ++K DL  + GD + IL++  +  DW+ G+  G+ G+FP+NYV  V
Sbjct: 364 ALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRINGQEGIFPANYVDLV 416

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +K ++  DL  + GD V IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 376 ALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGIFPANYVELV 428

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++     E ++L  +  D + +LE++  DW++G  +GK+G+FP NYV  +
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTPI 277

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  ++  DL  + GD + IL+K  +  DW+ G+  GK G+FP+NYV+  
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVRVT 468

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVK 112
           A++ +  ++  DL  + GD + IL+K  +  DW+ G+  GK G+FP+NYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 49  GAGEKHPPHEPEYVE-AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGV 105
           GA  +   H P     A++ +  ++  DL  + GD + IL+K  +  DW+ G+  GK G+
Sbjct: 407 GAKMRPSLHSPTPTAIALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGI 466

Query: 106 FPSNYVK 112
           FP+NYV+
Sbjct: 467 FPANYVR 473

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVELV 459

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 460

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + I++K  +  DW+ GK  G+ G+FP+NYV+ V
Sbjct: 385 ALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVELV 437

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV 459

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 4/56 (7%)

Query: 61  YVEAIFRY-KPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKVGVFPSNYVK 112
           Y +A++ + +P E + L  Q+GD + + EKL+ DWY G+   + G+ G+ P NYVK
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 51  GEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPS 108
           G     + P+ V A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+
Sbjct: 369 GSPSSSNAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPA 427

Query: 109 NYVKAV 114
           NYV+ V
Sbjct: 428 NYVELV 433

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 34  FNRKLPDNWDGKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKL-SA 92
           +   +P  +   P            PE   +++ +  Q+K DL       +EIL++  S+
Sbjct: 338 YTSDMPPAYSPSPYTAYTTPSTAPAPETCTSLYAFAAQDKADLTFPANAVIEILDRADSS 397

Query: 93  DWYRGKNKGKVGVFPSNYVK 112
            W+ G+  G+ G+FP NYV+
Sbjct: 398 GWWTGRYNGQEGLFPGNYVR 417

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVELV 441

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 49  GAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVF 106
           G G    P   E V A++ Y+ Q   DL    G  +EI+++ +   +W+ G+  G+ GVF
Sbjct: 448 GMGAAPMPTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVF 507

Query: 107 PSNYVK 112
           P NYV+
Sbjct: 508 PGNYVQ 513

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 55  PPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKL--SADWYRGKNKGKVGVFPSNYVK 112
           P   PE V A++ Y+ Q + DL    G  +E++E+   +  W+ G+  G  GVFP NYV+
Sbjct: 373 PASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSAD--WYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q + DL   VG  +E++E+ +    W+ G+  G+ GVFP NYV+
Sbjct: 410 ETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 3/60 (5%)

Query: 57  HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           + P+ V A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 401 NAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVELV 459

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + +L+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVELV 464

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q   DL    G  +EI+E+     +W+ G+  G+ GVFP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVERTPDVNEWWTGRYNGQQGVFPGNYVQ 459

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVK 112
           A++ +  ++  DL  + GD + IL+K  +  DW+ G+  GK G+FP+NYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 9/74 (12%)

Query: 50  AGEKHPPHEP-------EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNK 100
           A  K  P  P       E V A++ +  ++K DL  + GD + +++K  +  DW+ GK  
Sbjct: 350 ANSKVSPSSPSIGLEKAEKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLG 409

Query: 101 GKVGVFPSNYVKAV 114
            K G+FP+NYV+ V
Sbjct: 410 NKEGIFPANYVELV 423

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E+ DL  + GD + I++K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVELV 468

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E  DL  + GD + IL+K  +  DW+ G+  G+ G+FP+NYV+ V
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVELV 469

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSAD--WYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q   DL    G  +EI+++ + +  W+ G+  G+ GVFP NYV+
Sbjct: 384 ETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++       ++L  + GD + +LE++  DW++GK + + G+FP NYV  V
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKL--SADWYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q   DL    G  +EI+++   + +W+ G+  G+ GVFP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKL--SADWYRGKNKGKVGVFPSNYVKAVKF 116
           E V A++ Y+ Q   DL       +EI+++   + +W+ G+  G+VGVFP NYV+  K 
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQLNKM 459

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 51  GEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPS 108
           G +     P+ + A++ +  +E  DL  + GD + IL+K  +  DW+ G+     G+FP+
Sbjct: 385 GTRQSSSTPKAI-ALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSEGIFPA 443

Query: 109 NYVKAV 114
           NYV+ V
Sbjct: 444 NYVELV 449

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVK 112
           EY  +++ Y+ Q + DL    G  ++I+++ +   DW+ G   G+ GVFP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 55  PPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVK 112
           P   PE V A++ Y+ Q + DL    G  +E++E+      W+ G+  G  GVFP NYV+
Sbjct: 399 PLSAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTPDVNGWWTGRYNGYQGVFPGNYVQ 458

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q   DL    G  +EI+++     +W+ G+  G+ GVFP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 478

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q   DL    G  +EI+++     +W+ G+  G+ GVFP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 468

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 61  YVEAIFRY-KPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKVGVFPSNYVK 112
           Y  AI+ + +P + + L  ++GD + + EKL+ DWY G+     GK G+ P NYV+
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVE 680

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVK 112
           E   +++ Y+ Q   DL    G  +EI+E+ +   +W+ G+  G+ GVFP NYV+
Sbjct: 413 ETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQGVFPGNYVQ 467

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG-----KNKGKVGVFPSNYVKAVK 115
           V A + Y P  K  L L  GD V +L K  + W+ G      NK   G FP NY K+++
Sbjct: 26  VVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSKSIR 84

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKL-SADWYRGKNKGKVGVFPSNYV 111
           PE   A++ +  Q   DL   V   +EIL++  +A W+ G+  G+ G+FP+NYV
Sbjct: 331 PETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVK 112
           E V A++ Y+ Q   DL    G  +E++++     +W+ G+  G+ GVFP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVFPGNYVQ 464

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLS--ADWYRGKNKGKVGVFPSNYVKAVK 115
           V A++ Y+ Q   DL    G  +E++++     +W+ G+  G+ GVFP NYV+  K
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQVNK 472

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 57  HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYVK 112
            EP  + A + Y+  E  +L  + GD++  +E +  DW+ G  KN G+ G+FPSNYVK
Sbjct: 465 REPSAI-AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 4/63 (6%)

Query: 56  PHEPEYVEAI--FRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYV 111
           P EP   +A+  F +   E  DL  + GD + I+++  +  DW+ G+   + G+FP+NYV
Sbjct: 519 PSEPNIAKAVALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYV 578

Query: 112 KAV 114
           + V
Sbjct: 579 ECV 581

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 6/56 (10%)

Query: 65  IFRYKPQEKEDLELQVGDKVEILE--KLSAD-WYRGKNKGK---VGVFPSNYVKAV 114
           I RY  + +++L+L  GD++E+LE  +L  D WY GKN  +   VG+FP  + K V
Sbjct: 25  INRYAKRMEDELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTKVV 80

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYVKAV 114
           A++ +  +E+ DL  + GD + I+++  +  DW+ G   GK G+FP+NYV+ +
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVEII 396

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 7/75 (9%)

Query: 48  GGAGEKHPPHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKL-----SADWYRGKNK- 100
           G   E   P + E+  A++ + P+  + ++ L  GD + IL K      ++DW++ + K 
Sbjct: 314 GSGSEPIDPSKLEFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKN 373

Query: 101 GKVGVFPSNYVKAVK 115
           GK+G  P NY++ +K
Sbjct: 374 GKIGYIPYNYIEIIK 388

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 62  VEAIFRYKPQEKEDLEL--QVGDKVEILEKLSADWY--RGKNKGKVGVFPSNYVKAVKFS 117
           V AI+ YK  +  D EL  Q GD  +I +   ADW+  R     KVG  P NYV+ ++  
Sbjct: 74  VHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNYVETIEEG 133

Query: 118 G 118
           G
Sbjct: 134 G 134

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           +AI+ Y+PQ  E+L ++  D + +LEK    DW+  K +         VG+ P+NY++
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIE 66

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 51  GEKHPPHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEK-----LSADWYRGKNK-GKV 103
           GE   P + E+  A++ + P+  E ++ L+ GD + IL K       +DW++ + K G +
Sbjct: 302 GECIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNI 361

Query: 104 GVFPSNYVKAVK 115
           G  P NY++ +K
Sbjct: 362 GYIPYNYIEIIK 373

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 5/62 (8%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGK-----VGVFPSNYVKA 113
           P  V A+  Y+PQ   DL++  GDK+ +L      WY G+   K      G+FPS++VK 
Sbjct: 8   PFEVVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVKV 67

Query: 114 VK 115
           ++
Sbjct: 68  IE 69

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           +AI+ Y+PQ  E+LEL+  D + +LEK    DW+  K +         VG+ PSNY++
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIE 66

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 44  GKPIGGAGEKHPPHEP-EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSAD-WYRGKNKG 101
           GKP+  A        P + V AI+ Y  Q+ +++ ++ GD +++L   + + W  G+  G
Sbjct: 556 GKPVPRAPPPRKGAAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNG 615

Query: 102 KVGVFPSNYV 111
             G+FPSNY 
Sbjct: 616 SKGLFPSNYC 625

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 48  GGAGEKHPPHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEK-----LSADWYRGKNK- 100
           G   E   P + E+  A++ + P+  E ++ L+ GD + IL K       +DW++ + K 
Sbjct: 297 GNGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKN 356

Query: 101 GKVGVFPSNYVKAVK 115
           G +G  P NY++ +K
Sbjct: 357 GNIGYIPYNYIEIIK 371

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 11/76 (14%)

Query: 45  KPIGGAGEKHPPHE----PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSAD----WYR 96
           KP   A    PP +       V+A+F Y+ Q  +++ ++ GD + +L+   AD    W  
Sbjct: 550 KPRSSAPRAPPPRKSGNAARTVKALFDYEAQGDDEISIRQGDLISVLK---ADDGSGWTY 606

Query: 97  GKNKGKVGVFPSNYVK 112
           G+  G+ G+FP+NY +
Sbjct: 607 GELNGQKGLFPTNYCQ 622

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 55  PPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKVGVFPSNYV 111
           P   P  V+A + +  Q K DL    GD +E+  K++ DWY G+   N+   G FP+N+V
Sbjct: 8   PLAPPFKVKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGYFPNNFV 66

Query: 112 KAVK 115
           K V+
Sbjct: 67  KIVE 70

>CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]
           {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117w CYK3
          Length = 880

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKVGVFPSNYVKAVK 115
           P  V+A + +  Q KEDL    GD +E+  +++ +WY G+   NK   G FP+N+V  V+
Sbjct: 7   PFKVKARYGWSGQAKEDLGFLEGDVMEV-SRVAGEWYYGRLLRNKKCAGYFPNNFVTIVE 65

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKN--KGKVGVFPSNYVKAVKFSGVDD 121
           A++ + P+   +LEL+ GD V I  K    W   +N  + K G+ P  YV+ ++  G D+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQLIEDDGEDN 126

Query: 122 AMFQDIPP 129
             +++  P
Sbjct: 127 GRYENPRP 134

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSAD-WYRGKNKGKVGVFPSNYV 111
           + A + Y+ Q  ++L LQVGDK+++L++   + W  G+  G  G+FP+ Y 
Sbjct: 598 MTAAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.365
           YLR191W
          Length = 445

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 7/86 (8%)

Query: 49  GAGEKHPPHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEK-----LSADWYRGKNK-G 101
           G+G    P+  E+  A +++ P+  E +L+L  GD + I+ K       ++W++ + K G
Sbjct: 360 GSGMSIDPNNLEFARAKYKFVPENPEMELQLSKGDLMAIISKQDPLGRDSEWWKVRTKNG 419

Query: 102 KVGVFPSNYVKAVKFSGVDDAMFQDI 127
            +G  P NY++ +K    D    +D+
Sbjct: 420 DMGYVPYNYLEIIKRVAKDRRPIEDV 445

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 38.1 bits (87), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG---KNKGKV--GVFPSNYVKA 113
           + V AIF Y  + K +L LQ GD + ++ K  + W+ G   +  GKV  G FP NY ++
Sbjct: 49  DVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRS 107

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 7/69 (10%)

Query: 50  AGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGK-NKGKVGVF 106
           AGE+  P+     + ++RY+  E +  E+   ++ EIL+   +   W++ K + G+ G+ 
Sbjct: 302 AGEESFPYT---AQTLYRYQADEDDAYEISF-EQGEILKVSDIEGRWWKAKRSTGETGII 357

Query: 107 PSNYVKAVK 115
           PSNYVK ++
Sbjct: 358 PSNYVKLIE 366

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKAVK 115
           V+  F +  ++K+DL    GD +E+  +++ DWY GK     K G FPSNYV  ++
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEV-TRVTGDWYFGKLIRNKKQGYFPSNYVSILE 65

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSAD-WYRGKNK-------GKVGVFPSNYVK 112
           +AI+ Y+PQ  E+LE+   D + +LEK   D W+  K +         VG+ PSNY++
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIE 66

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 31  FDEFNRKLPDNWDGKPIGGAGEKHPPH-----EPEYVEAIFRYKPQE-KEDLELQVGDKV 84
            ++F  KL +  + + I G   +H          E+  A++ + P+  + +  L+ GD +
Sbjct: 281 LNKFITKLQEMQNVRRIAGGPAQHQLQGIDLNNLEFARAVYDFTPENPRIECSLKKGDLM 340

Query: 85  EILEKL-----SADWYRGKNK-GKVGVFPSNYVKAVK 115
            I+ KL      + W++ + K G+VG  PSNY++ ++
Sbjct: 341 AIISKLDPTGNESQWWKVRTKKGEVGYIPSNYIELIR 377

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 37.0 bits (84), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 49  GAGEKHPPHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKL-----SADWYRGKNK-G 101
           G  EK      E+  A+F + P+ ++ +L L  GD + IL K      ++ W++ + K G
Sbjct: 296 GVNEKIDLSNLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNG 355

Query: 102 KVGVFPSNYVKAV 114
             G  PSNY++ +
Sbjct: 356 DTGYVPSNYIEII 368

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 57  HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYVK 112
           H P  V A + Y+  E+ +L    GDK+  +E +  DW+ G  +  G+ G+FPSNYV+
Sbjct: 577 HSPSAV-AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 60  EYVEAIFRY-KPQEKEDLELQVGDKVEILEKLSADWYRG---KNKGKVGVFPSNYVKAV 114
           +YV+A++ Y +P E   L    GD + ++E ++ DWY G   +   + G+ P NYVK +
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVKVI 606

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 36.6 bits (83), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 7/67 (10%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKLS-----ADWYRGKNK-GKVGVFPS 108
           P   E+  AI+ + P+  + +L L+ GD + ++ K       ++W+R + K G +G  P 
Sbjct: 304 PRSLEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPY 363

Query: 109 NYVKAVK 115
           NY++ +K
Sbjct: 364 NYLELIK 370

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 36.6 bits (83), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSAD----WYRGKNKGKVGVFPSNYVK 112
           VEA++ Y+ Q +++  L  GD + +L+   AD    W  G+  G+ G+FP++Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLK---ADDGSGWTYGEVNGEKGLFPTSYCK 621

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVKAV 114
           +A++ Y+PQ  E+L +Q  D + +LEK    DW+  K +          G+ PSNY++A 
Sbjct: 9   KAVYSYEPQTPEELAIQEDDLLYLLEKSEVDDWWTVKKRIIGSDAEEPQGLVPSNYIEAA 68

Query: 115 KFSGVDDAMF 124
                  A++
Sbjct: 69  PVISTMRALY 78

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 36.2 bits (82), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 48  GGAGEKHPPHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKLS-----ADWYRGKNK- 100
           G   E   P + E+  A++ + P+  + ++ L+ GD + IL K       +DW++ + K 
Sbjct: 303 GNGDEPIDPSKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKN 362

Query: 101 GKVGVFPSNYVKAVK 115
           G +G  P NY++ +K
Sbjct: 363 GSIGYIPYNYIEIIK 377

>KAFR0I01040 Chr9 (201597..205208) [3612 bp, 1203 aa] {ON} Anc_4.108
           YBL007C
          Length = 1203

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVKAV 114
           +AI+ Y+PQ  E+L LQ  D + +LEK    DW+  K +          G+ PSNY++  
Sbjct: 9   KAIYSYEPQTPEELALQEDDFLYLLEKSEVDDWWTVKKRVIGSDAEEPSGLVPSNYIETA 68

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSA--DWYRGKNKGKVGVFPSNYV 111
           V A++ +  Q++ DL  +  D + + +K  +  DW+ G   G  GVFP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 36.2 bits (82), Expect = 0.053,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 34/58 (58%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           +A+F+Y+PQ  E+L +  GD + +L+K    DW+  K +         VG+ P+NY++
Sbjct: 9   KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIE 66

>Kpol_1025.40 s1025 (104879..108487) [3609 bp, 1202 aa] {ON}
           (104879..108487) [3609 nt, 1203 aa]
          Length = 1202

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 8/60 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVKAV 114
           +AI+ Y+PQ  ++L +Q  D + +LEK +  DW+  K +          G+ PSNYV+  
Sbjct: 9   KAIYNYEPQTPDELTIQEDDLLYLLEKSNVDDWWTVKKRVIGSDIDEPAGLVPSNYVEVA 68

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 37/64 (57%), Gaps = 9/64 (14%)

Query: 60  EYVEAIFRY-KPQEKEDLELQVGDKVEILEKLSADWYRG--------KNKGKVGVFPSNY 110
           +Y +A++ Y +P E   +  +V D + + ++L+ DWY G        +++ + G+ P+NY
Sbjct: 569 KYAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGLVPANY 628

Query: 111 VKAV 114
           ++ +
Sbjct: 629 IEIL 632

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 35.4 bits (80), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 60  EYVEAIFRYKPQEKEDLELQVGDKVEILEKL-SADWYRGKNKGKVGVFPSNYVKAVK 115
           E   A++ Y  Q + DL    G  ++++++  +A W+ G   G  GVFP NYV+  K
Sbjct: 371 ETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVELSK 427

>TPHA0K01600 Chr11 (338182..341592) [3411 bp, 1136 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1136

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           +AI+ Y+PQ  E+L +Q  D + +LEK    DW+  K +          G+ PSNY++
Sbjct: 9   KAIYNYEPQTPEELAIQEDDLLYLLEKSDVDDWWTVKKRVIGSDAEEPSGLIPSNYIE 66

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 38/61 (62%), Gaps = 6/61 (9%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE---KLSADWYRGKN--KGKVGVFPSNYVKA 113
           P YV  +  Y+ + +++++++ GDK+E+L    +    WY+GKN    +VG++P+ + + 
Sbjct: 3   PVYV-CVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGKNLRTAQVGLYPAVFTQP 61

Query: 114 V 114
           +
Sbjct: 62  I 62

>Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa]
           {ON} YBL007C (SLA1) - contains 3 SH3 domains, interacts
           with Bee1p [contig 207] FULL
          Length = 1249

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 8/61 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVKAV 114
           +A+F+Y PQ +E+L ++  D + +L+K    DW+  K +         VG+ P+NY++  
Sbjct: 9   KAVFQYTPQSEEELAIEEDDLLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

Query: 115 K 115
           +
Sbjct: 69  Q 69

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKL-----SADWYRGKNK-GKVGVFPS 108
           P   E+  A++ + P+  + +  L+ GD + ++ K      +++W++ + K G VG  PS
Sbjct: 307 PRNLEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGYVPS 366

Query: 109 NYVKAVK 115
           NYV+ ++
Sbjct: 367 NYVELIR 373

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 35.4 bits (80), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 5/65 (7%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG-----KNKGKVGVFPSNY 110
           P  P  V A F YK + K DL    G K+ ++      WY G     + K + G+FP ++
Sbjct: 7   PEIPFQVVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREGIFPKSF 66

Query: 111 VKAVK 115
           V  V+
Sbjct: 67  VSIVR 71

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 35.4 bits (80), Expect = 0.091,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 8/71 (11%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSAD-WYRGKNK-------GKVGVFPSNYVKA 113
           V+A++ Y+PQ  E+L ++  D + +LEK   D W+  K +          G+ PSNYV+ 
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 114 VKFSGVDDAMF 124
               G   A++
Sbjct: 68  ANVIGTVRALY 78

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 35.4 bits (80), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V A++  +  + ++L  +  D + ++E+   DW+ G    +VG+FP NYV  +
Sbjct: 219 VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIFPLNYVTPI 271

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 33.5 bits (75), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 51 GEKHPPHEP-EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG 97
          G   P  +P + VE  ++Y  + +  L L+VGD + +L K S  W+ G
Sbjct: 19 GHGIPCLQPIDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 35.0 bits (79), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 7/66 (10%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKLSA-----DWYRGKNK-GKVGVFPS 108
           P + E+  AI+ + P+    ++ LQ GD + IL K  +      W++ + K G VG  P 
Sbjct: 256 PTKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPF 315

Query: 109 NYVKAV 114
           NY++ +
Sbjct: 316 NYIEVI 321

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 53  KHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSAD-WYRGKNKGKVGVFPSNYV 111
           +  P     V A++ Y  ++ +++ ++ GD ++++   + + W  G+ +G  G+FPSNY 
Sbjct: 612 RRNPTSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 48  GGAGEKHPPHEPEY----VEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGK 102
           G A E  PP         +EA++ Y+ Q  +++ + VGD + ++     + W  G+  G 
Sbjct: 564 GPAPEVPPPRRSTLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGL 623

Query: 103 VGVFPSNYVK 112
            G+FP++Y K
Sbjct: 624 KGLFPTSYCK 633

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 57  HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
            E  +  A + Y+  E  +L  +  DK+  +E +  DW+ G  +  G+ G+FPSNYV
Sbjct: 519 EEKPWATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 5/61 (8%)

Query: 61  YVEAIFRYKPQEKE---DLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKAVK 115
           Y  A+F Y+P E +   DL  +  + +++++K    W+ G+     K G FP+NYV+  +
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVELER 458

Query: 116 F 116
           F
Sbjct: 459 F 459

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 32.0 bits (71), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 76  LELQVGDKVEILEKL--SADWYRGKNKGKVGVFPSNYVKAVK 115
           L    G  +EI+++   + +W+ G+  G+ GVFP NYV+  K
Sbjct: 1   LTFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQLNK 42

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 62  VEAIFRYKPQEKEDLELQV--GDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAV 114
           V+A++ YK  + +  EL    GD +++ +     W   K  G+ G+ PSNYVK +
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVKLM 354

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 12/71 (16%)

Query: 44  GKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKG 101
            KP GGA             A + Y+  E  +L     DK+  +E +  DW+ G  ++ G
Sbjct: 513 SKPAGGA----------TAIAQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSG 562

Query: 102 KVGVFPSNYVK 112
           + G+FPSNYV+
Sbjct: 563 EKGLFPSNYVE 573

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGKVGVFPSNYVK 112
           +EA++ Y+ Q  +++ + VGD++ ++     + W  G+  G  G+FP++Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           +A++ Y+PQ  E+L ++  D + +LEK    DW+  K +          G+ PSNYV+
Sbjct: 9   KAVYAYEPQTPEELAIEEDDLLYLLEKSDVDDWWTVKKRVLGTDADEPTGLVPSNYVE 66

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 61  YVEAIFRYKPQEK-----EDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKA 113
           Y  A++ Y P        EDL  + GD + +++K   +W+ G+     + G FP N+V+ 
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVET 437

Query: 114 VKF 116
            ++
Sbjct: 438 ERY 440

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           A + Y   E  +L    GDK+  +E +  DW+ G  +  G+ G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGKVGVFPSNYVK 112
           VEAI+ Y+    ++L +  G+ ++++     + W  G++ G  G+FPS+Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVK 115
           P  P  V+A F YK + ++DL       + +      +WY G+   K G+FP ++VK ++
Sbjct: 4   PDTPFKVQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVKILE 63

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 34.7 bits (78), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGKVGVFPSNYVK 112
           V+A++ Y+ Q  +++ + VGD + +++    + W  G+  G  G+FPS+Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEK-LSADWYRGKN--KGKVGVFPSNYVK 112
           + +++Y  Q+ +++ + VGD + +++    + W R KN   G+ G+ P++YV+
Sbjct: 505 KVLYQYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYVE 557

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKA 113
           P+ P  V A++ +  ++ +DL     D +E+  K+  DW  G+     K G FP  YV+ 
Sbjct: 6   PNTPFKVRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQL 64

Query: 114 VK 115
           ++
Sbjct: 65  IQ 66

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYV 111
           A + Y   E  +L  +  DK+  +E +  DW+ G+  + G+ G+FPSNYV
Sbjct: 615 AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPSNYV 664

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 41  NWDGKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILE---KLSADWYRG 97
           N++G+ +G     HP     Y+ A+  Y  + +++L ++ GDK+E++    + +  WY G
Sbjct: 2   NFEGRALGNRSNFHP----LYI-AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYG 56

Query: 98  KN--KGKVGVFPSNYVKAVKF 116
           +N    + G++P+ + K    
Sbjct: 57  RNLRTKEEGLYPAVFTKKTTL 77

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 21  LESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQV 80
           L S + S D      R + D+    PI    +K  P    Y+  I  Y  + +++L+++ 
Sbjct: 7   LPSIITSGDVSPTRIRHVSDSSFNSPISPKVQKQYPM---YI-CINEYSKRMEDELDMRP 62

Query: 81  GDKVEIL---EKLSADWYRGKN--KGKVGVFPSNYVKAV 114
           GDK+E+L   E+ +  WY G+N   G+ G++P  + + +
Sbjct: 63  GDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYPVVFTQII 101

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 64  AIFRY--KPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKAVK 115
           AI  Y  + +E  +L  + GDK+  +  +  DW+ G+    G+ G+FPSNYV+ +K
Sbjct: 571 AIAEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQLIK 626

>KLLA0B04862g Chr2 (442398..443591) [1194 bp, 397 aa] {ON} conserved
           hypothetical protein
          Length = 397

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 47  IGGAGEKHPPHEPEYVEAIFRYKPQEKE---DLELQVGDKVEILEKLSADWYRGKN--KG 101
           I    + +  H P+Y +AI  + P E++    L L+  D ++I  K +  W+ G++    
Sbjct: 323 IATYNDPYQKHSPQYCKAIADFVPTEEDSENSLSLRKEDVIKIYRKEAEVWWYGQSLRTN 382

Query: 102 KVGVFP 107
           K+G FP
Sbjct: 383 KIGYFP 388

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 39/80 (48%), Gaps = 15/80 (18%)

Query: 51  GEKHPPHEP--------EYVEAIFRYKPQE-KEDLELQVGDKVEILEKL-----SADWYR 96
           G    PH+P        E+  AI+ + P+  + +  L+ GD + I+ +       + W++
Sbjct: 298 GRIATPHQPQSLDLNSLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWK 357

Query: 97  GKNK-GKVGVFPSNYVKAVK 115
            + K G VG  P NY++ ++
Sbjct: 358 VRTKKGDVGYVPCNYIELIR 377

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 44  GKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKNK- 100
           G  +G   E    +    V+A++ Y+  + +  E+   D+ EIL+   +   W++ K + 
Sbjct: 293 GDTLGLYSELDDDNFTYTVKALYSYQADDADAYEISF-DQGEILKVSDIEGRWWKAKREN 351

Query: 101 GKVGVFPSNYVKAV 114
           G+ G+ PSNYV+ +
Sbjct: 352 GQTGIIPSNYVELI 365

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKNK-GKVGVFPSNYVKAVK 115
           P    A++ YK  E +  E+   ++ E+LE   +   W++ + + G  G+ PSNYV+ ++
Sbjct: 313 PYKARALYSYKANENDAYEISF-EQNELLEVSDIEGRWWKARRENGTTGIIPSNYVELIE 371

>KLTH0F09240g Chr6 (799558..802224) [2667 bp, 888 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 888

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG---KNKGKVGVFPSNYVK 112
           P  P  V+A + +  + K DL     D +++  K+  +W+ G   +N  K G FP+N+V 
Sbjct: 6   PQPPFKVKAHYSWSGETKNDLGFLENDVIQVT-KIKGNWFYGTLLRNSKKYGYFPTNFVT 64

Query: 113 AVK 115
            ++
Sbjct: 65  IIQ 67

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 11/79 (13%)

Query: 45  KPIGGAGEKH-PPHEPE---------YVEAIFRYKPQEKEDLELQVGDKVEIL-EKLSAD 93
           KPI    E+  PP  P           +   + Y  QE+ ++ ++VGD V +L E   + 
Sbjct: 581 KPINSHAERGVPPSVPPPRGSKKPSLTLTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSG 640

Query: 94  WYRGKNKGKVGVFPSNYVK 112
           W   +  G  G+ P+NY K
Sbjct: 641 WTLAELDGDSGLIPTNYCK 659

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGK-NKGKVGVFPSNYVKAV 114
           P   EA++ Y+  + +  E+   ++ EIL    +   W++ K + G+ G+ PSNYVK +
Sbjct: 295 PYTAEALYTYQADQTDAYEISF-EQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVKLL 352

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 33.9 bits (76), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           P E  +  A + Y   E  +L     DK+  +E +  DW+ G  +  G  G+FPSNYV
Sbjct: 525 PKENPWATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 52  EKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSN 109
           EK P   P +  A + Y   E  +L     DK+  +E +  DW+ G  +  G  G+FPSN
Sbjct: 527 EKKPKENP-WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSN 585

Query: 110 YV 111
           YV
Sbjct: 586 YV 587

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 33.5 bits (75), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%), Gaps = 7/67 (10%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKL-----SADWYRGKNK-GKVGVFPS 108
           P   E+  A++ + P+  + ++ L+ GD + I+ K       + W++ + K G +G  P 
Sbjct: 320 PKNLEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWWKVRTKKGDIGYVPY 379

Query: 109 NYVKAVK 115
           NY++ +K
Sbjct: 380 NYIEVIK 386

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 10/67 (14%)

Query: 56  PHEP---------EYVEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGKVGV 105
           PH P           +EA++ Y+ Q  ++L +  G  V++L+    + W  G+  G  G+
Sbjct: 559 PHAPPPRKCVSSVRTIEALYDYQAQGDDELSIYAGSVVKVLKPDDGSGWTYGELDGAKGL 618

Query: 106 FPSNYVK 112
           FP++Y K
Sbjct: 619 FPTSYCK 625

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 57  HEPEYVEAIFRYKPQEKEDLELQV--GDKVEILEKLSADWYRGKN--KGKVGVFPSNYV 111
            +P    A+  Y     ED EL    G K+  +E +  DW+ G+N   G+ G+FP+NYV
Sbjct: 466 EKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKGLFPANYV 524

>AGR170C Chr7 complement(1066831..1070196) [3366 bp, 1121 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL007C
           (SLA1)
          Length = 1121

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 62  VEAIFRYKPQEKEDLEL--QVGDKVEILEKLSADW--YRGKNKGKVGVFPSNYVKAV 114
           V +++ Y+  +  D EL  + GD+ ++ +   ADW   R +  G VG  P NYV+ V
Sbjct: 74  VRSVYDYEEAQNPDEELVFREGDEFDVYDDRDADWVLVRKRADGSVGFAPGNYVEKV 130

>KNAG0B02880 Chr2 (555679..556998) [1320 bp, 439 aa] {ON} Anc_7.295
           YDL131W
          Length = 439

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 46  PIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEI 86
           P+GG   +     PEYV++  +YK  +  DLEL V D VE+
Sbjct: 260 PLGGLMARMIVAAPEYVKS--KYKLHKLRDLELLVADAVEV 298

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 33.5 bits (75), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 9/63 (14%)

Query: 61  YVEAIFRY-KPQEKEDLELQVGDKVEILEKLSADWYRGK--------NKGKVGVFPSNYV 111
           Y +A++ + +P E++ +   VGD + + E+L  DW+ G+         + + G+ P NY+
Sbjct: 537 YAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYRYGIIPRNYI 596

Query: 112 KAV 114
           + +
Sbjct: 597 EIL 599

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 33.5 bits (75), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           A + Y+  E  +L  +  DK+  +E +  DW+ G  +  G+ G+FPSNYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 32.7 bits (73), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKNK-GKVGVFPSNYVKAVK 115
           P   +A++ Y+  + +  E+   ++ EIL+   +   W++ K + G+VG+ PSNYV+ ++
Sbjct: 296 PYTAKALYSYQADDADGYEISF-EQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQLIE 354

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 58  EPEYVEAIFRYKPQEKEDLEL--QVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYVK 112
           EP    AI  Y  +  ED EL  + GD +  ++ +  DW+ G  +  G+ G+FPSNYV+
Sbjct: 517 EPAAPTAIAEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 48  GGAGEKHPPHEPEY----VEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGK 102
           G A E  PP         +EAI+ Y+ Q  +++ +  GD + ++     + W  G+  G 
Sbjct: 564 GPAPEVPPPRRSTLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGL 623

Query: 103 VGVFPSNYVK 112
            G+FP++Y K
Sbjct: 624 KGLFPTSYCK 633

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 35/54 (64%), Gaps = 6/54 (11%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEIL---EKLSADWYRGKN--KGKVGVFP 107
           P Y+ AI +Y+ + +++L +Q+GDK++++    + +  WY GKN    + G++P
Sbjct: 34  PLYI-AINQYEKRMEDELNMQLGDKIQVITDDSEYNDGWYYGKNLRTQEEGLYP 86

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 38/67 (56%), Gaps = 7/67 (10%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEK-----LSADWYRGKNK-GKVGVFPS 108
           P + E+  A++ + P+  + ++ L+ GD + I+ K       ++W++ + K G +G  P 
Sbjct: 305 PSKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPF 364

Query: 109 NYVKAVK 115
           NY++ ++
Sbjct: 365 NYIEIIR 371

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKA 113
           P  P  V+A++ +  + ++DL     D +E+  K+  +W  G+     K G FP NYV+ 
Sbjct: 6   PKAPFKVKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQV 64

Query: 114 V 114
           +
Sbjct: 65  L 65

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 32.7 bits (73), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 52  EKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSN 109
           EK P   P +  A + Y   E  +L     DK+  +E +  DW+ G  +  G  G+FPSN
Sbjct: 528 EKKPKENP-WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSN 586

Query: 110 YV 111
           YV
Sbjct: 587 YV 588

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 48  GGAGEKHPPHEP----EYVEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNKGK 102
           G A E  PP         +EA + Y+ +  +++ + VGD + ++     + W  G+  G 
Sbjct: 565 GPAPEVPPPRRTALPVRTLEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGL 624

Query: 103 VGVFPSNYVK 112
            G+FP++Y K
Sbjct: 625 KGLFPTSYCK 634

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 44  GKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKNK- 100
           G  +G   E      P    A++ Y+  + +  E+   ++ EIL+   +   W++ K + 
Sbjct: 280 GDTLGLYSEFGDESFPYTARALYSYQADDADGYEVSF-EQGEILKVSDIEGRWWKSKKET 338

Query: 101 GKVGVFPSNYVKAVK 115
           G+VG+ PSNYV+ ++
Sbjct: 339 GEVGIIPSNYVQLIE 353

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           +AI+ Y+PQ  E+L +   D + +L+K    DW+  K +         VG+ P+NY++
Sbjct: 9   KAIYAYQPQNPEELAIDEEDLLYLLQKSDVDDWWTVKKRVIGTDQEEPVGLVPNNYIE 66

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 61  YVEAIFRYKPQEKEDLEL--QVGDKVEILEKLSADW--YRGKNKGKVGVFPSNYVKAVKF 116
           + +A++ Y   +  D EL    GD+ ++ +    DW     K  G++G  P NYV+  + 
Sbjct: 73  HAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEISEA 132

Query: 117 SGVDDAMFQDIP 128
           + V    F   P
Sbjct: 133 TPVGSNSFPPPP 144

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKA 113
           P  P  V+AI+ +  +++ DL     D +E+  K    WY G+     K G FP+NYV  
Sbjct: 6   PKLPFKVKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYVTI 64

Query: 114 VK 115
           +K
Sbjct: 65  IK 66

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 32.7 bits (73), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           A + Y+  E  +L     DK+  +E +  DW+ G  ++ G+ G+FPSNYV
Sbjct: 541 AEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESSGEKGLFPSNYV 590

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 32.7 bits (73), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 10/77 (12%)

Query: 46  PIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWY-------RGK 98
           P   AG   P    + V A   + P +K  L L  GD V +L K  + W+       R  
Sbjct: 14  PAARAGSTRPV---DVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSP 70

Query: 99  NKGKVGVFPSNYVKAVK 115
            +   G FP N+ ++ +
Sbjct: 71  QRVARGWFPHNFTRSYR 87

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 32.7 bits (73), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 64  AIFRY--KPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYVKAVK 115
           AI  Y  + +E  +L  + GDK+  +  +  DW+ G+    G+ G+FPSNYV+ V+
Sbjct: 576 AIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQLVE 631

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 8/70 (11%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVKAV 114
           +A++ Y+PQ +E+L ++  D + +L+K    DW+  K +          G+ PSNY++  
Sbjct: 9   KAVYDYEPQTEEELAVRENDMLYLLQKSDVDDWWTVKKRVIGSDVEEPSGLVPSNYIEES 68

Query: 115 KFSGVDDAMF 124
              G   A++
Sbjct: 69  PVIGQWRALY 78

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 64  AIFRY-KPQEK-EDLELQVGDKVEILEKLSADWY--RGKNKGKVGVFPSNYVKAV 114
           A++ Y +PQ   E+L  +  D  ++ +    DW   R +  G VG  P NYV+ +
Sbjct: 76  ALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEPL 130

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVKAV 114
           +A++ Y  Q  E+L ++ GD + +LEK S  DW+  K +         VG+ P  Y++  
Sbjct: 9   QALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTYIEEA 68

Query: 115 KFSGVDDAMF 124
              G   A++
Sbjct: 69  PVIGSVVALY 78

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 32.0 bits (71), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWY--RGKNKGKVGVFPSNYV 111
           A++ ++P+   +LELQ GD V I  +    W     +N+ K G+ P  +V
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFV 182

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK-----NKGKVGVFPSNYV 111
           P  VEA+F Y    ++DL    G  + +LE    +W+ G+      K K G+FP  +V
Sbjct: 4   PFKVEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           +  A + Y   E+ +L     DK+  +E +  DW+ G  +  G+ G+FPSNYV
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 611

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           A + Y+  E+ +L     DK+  ++ +  DW+ G  +  G+ G+FPSNYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 3/72 (4%)

Query: 44  GKPIGGAGEKHPPHEP--EYVEAIFRYKPQEKEDLELQVGDKVEILE-KLSADWYRGKNK 100
           G+P+       PP       +E +F Y  Q  +++ + VGD V +++    + W  G+  
Sbjct: 531 GEPVRAKPSVPPPRRKHVRTLEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELN 590

Query: 101 GKVGVFPSNYVK 112
           G  G+ P++Y K
Sbjct: 591 GLKGLVPTSYCK 602

>Kwal_23.3416 s23 (280746..283397) [2652 bp, 883 aa] {ON} YDL117W
           (CYK3) - may be involved in cytokinesis [contig 252]
           FULL
          Length = 883

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG---KNKGKVGVFPSNYVKAV 114
           P  V+A + +  + K DL     D +++  K   DW+ G   +N  K G FP+N+V  +
Sbjct: 9   PFKVKAHYSWSGETKNDLGFIENDIIQV-TKTKGDWFYGTLLRNSKKYGYFPTNFVTII 66

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           AI+ Y+PQ  E+L ++  D + +L K    DW+  K +         VG+ PS Y++
Sbjct: 10  AIYAYEPQTPEELAIEEDDLLYLLHKSDVDDWWTVKKRVIGSDSEEPVGLVPSTYIE 66

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 32.0 bits (71), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 8/58 (13%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEKLSAD-WYRGKNK-------GKVGVFPSNYVK 112
           +A++ Y+PQ  E+L ++  + + +LEK   D W+  K +         VG+ PSNYV+
Sbjct: 9   KALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNYVE 66

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 32.0 bits (71), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           AI+ Y+PQ  E+L +Q  D + +L+K    DW+  K +         VG+ PS Y++
Sbjct: 10  AIYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIE 66

>CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118c SSU81
          Length = 353

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGD-KVEILEKLSADWYRGKNK-GKVGVFPSNYVKAV 114
           P  V+A++ Y+    +  E+     ++ ++  +   W++ K + G+ G+ PSNYV  +
Sbjct: 290 PYRVKALYSYEADSADAYEMSFEQGEILMVSDIEGRWWKAKKESGETGIIPSNYVTII 347

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG--KNKGKVGVFPSNYV 111
           +  A + Y   E  +L     DK+  +E +  DW+ G  +  G  G+FPSNYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 35/56 (62%), Gaps = 5/56 (8%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEIL---EKLSADWYRGKN--KGKVGVFPSNYVKAV 114
           AI  Y  + +++L+++ GDK+E++   ++ +  WY G+N   G+ G++P  + + +
Sbjct: 34  AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKLFTQEL 89

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEIL--EKLSADWYRGKNK-GKVGVFPSNYVKAV 114
            +A++ Y+  E +  E+   ++ EIL    +   W++ K + G+ G+ PSNYV+ +
Sbjct: 272 AKALYSYQADESDQYEISF-EQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQLI 326

>NCAS0E02790 Chr5 (551328..552467) [1140 bp, 379 aa] {ON} Anc_7.365
           YLR191W
          Length = 379

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 39/67 (58%), Gaps = 7/67 (10%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKL-----SADWYRGKNK-GKVGVFPS 108
           P++ E+  A++ + P+  + + EL+ G+ + I+ +       ++W++ + K G +G  P 
Sbjct: 301 PNKIEFARALYDFVPENPQIEAELKKGELMAIISQRDPVGRESNWWKVRTKDGSMGYVPY 360

Query: 109 NYVKAVK 115
           NY++ +K
Sbjct: 361 NYIEVIK 367

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 5/68 (7%)

Query: 62  VEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG---KNKGKV--GVFPSNYVKAVKF 116
           V A + + P  K  L    GD + ++ K  + W+ G    NK  V  G FP +Y K++K 
Sbjct: 26  VIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSLVLRGWFPRSYTKSIKD 85

Query: 117 SGVDDAMF 124
           +     +F
Sbjct: 86  TSSSRKIF 93

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 31.2 bits (69), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           A++ Y+PQ  E+L +Q  D + +L+K    DW+  K +         VG+ PS Y++
Sbjct: 10  AVYAYEPQTPEELAIQEDDLLYLLQKSDIDDWWTVKKRVIGSDSEEPVGLVPSTYIE 66

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 6/63 (9%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE---KLSADWYRGKN--KGKVGVFPSNYVKA 113
           P Y+ A+  Y  + +++L ++ GDK+E++    + +  WY G+N    + G++P+ + K 
Sbjct: 16  PLYI-AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTKK 74

Query: 114 VKF 116
           +  
Sbjct: 75  ITL 77

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYV 111
           A + Y   E+ +L     DK+  +E +  DW+ G+    G+ G+FPSNYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa]
           {ON} YJL020C (REAL)
          Length = 1101

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKV--GVFPSNY 110
           P  P  V A F YK   ++DL  +   ++ I     A+WY G+   + G +  G+FP ++
Sbjct: 4   PEVPFKVVAQFPYKSDYEDDLNFEKDQEITITSVEDAEWYYGEYRDSSGDIVEGIFPKSF 63

Query: 111 VKAVKFSG 118
           V A++ SG
Sbjct: 64  V-AIQTSG 70

>Skud_12.51 Chr12 (103635..107399) [3765 bp, 1254 aa] {ON} YLL016W
          (REAL)
          Length = 1254

 Score = 31.2 bits (69), Expect = 2.4,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 60 EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG 97
          + VE I+ +  + ++ L L++GD V +L K S  W+ G
Sbjct: 29 DVVECIYEHFTESRDKLSLRIGDMVYVLNKGSNGWWDG 66

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 42/80 (52%), Gaps = 11/80 (13%)

Query: 56  PHEPEYVEAIFRYKPQEKE-DLELQVGDKVEILEKL-----SADWYRGKNK-GKVGVFPS 108
           P + E+  A++ + P+  + +  L+ G+ + I+ K      +++W++ + K G +G  P 
Sbjct: 310 PSKLEFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVPF 369

Query: 109 NYVKAVKFSGVDDAMFQDIP 128
           NYV+ +K         +DIP
Sbjct: 370 NYVEIIK----RQKRIEDIP 385

>SAKL0F13112g Chr6 complement(1037049..1038071) [1023 bp, 340 aa]
           {ON} similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 340

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKN-KGKVGVFPSNYVKAV 114
           P   +A++ Y   E +  E+   ++ EIL    +   W++ K   G+ G+ PSNYV+ +
Sbjct: 277 PYTAKALYDYNASESDAYEISF-EQGEILRVGDIEGRWWKAKKATGETGIIPSNYVQLI 334

>KNAG0B02520 Chr2 (493975..494919) [945 bp, 314 aa] {ON} Anc_7.365
           YLR191W
          Length = 314

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 15/104 (14%)

Query: 19  YLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPEYVEAIFRYKPQE-KEDLE 77
           YLL +K I+R      N+ L    D  P+     K       +  A++ + P+  K ++ 
Sbjct: 212 YLL-NKYINRLNEKHANQILSKGLDDDPVDLTKLK-------FARALYDFVPENAKIEVP 263

Query: 78  LQVGDKVEILEK-----LSADWYRGKNK-GKVGVFPSNYVKAVK 115
           L+ GD + I+ +       + W+R + + G VG  P NYV+ +K
Sbjct: 264 LKKGDLMAIISEKDTFGRDSQWWRVRTRDGNVGYIPYNYVEVIK 307

>KNAG0J02750 Chr10 complement(521086..526044) [4959 bp, 1652 aa]
           {ON} Anc_4.45 Scer_YGOB_SDC25
          Length = 1652

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 66  FRYKPQEKED-LELQVGDKVEILEKLSADWYRG------KNKGKVGVFPSNYVKAVK 115
           F Y P    + L  Q GD V +L K ++ W+ G       NK   G FP N+V+ ++
Sbjct: 99  FNYPPASATNKLSFQRGDTVYVLAKSASGWWDGLSIADTDNKVIRGWFPYNHVRLLR 155

>Kpol_1030.45 s1030 (102192..103358) [1167 bp, 388 aa] {ON}
           (102192..103358) [1167 nt, 389 aa]
          Length = 388

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 60  EYVEAIFRYKPQE-KEDLELQVGDKVEILEKLSA-----DWYRGKNK-GKVGVFPSNYVK 112
           E+  A + + P+  K ++ L   D V +L K  A     +W++ + K GK G  P NY++
Sbjct: 319 EFARACYDFTPENNKFEVPLNKDDIVAVLRKQDALGRNSNWWKVQTKDGKTGYVPYNYIE 378

Query: 113 AVK 115
            ++
Sbjct: 379 VIR 381

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGK-NKGKVGVFPSNYVKAV 114
           P    A++ Y+  E +  E+    + EIL    +   W++ K + G+ G+ PSNYV+ +
Sbjct: 269 PYTSRALYAYEADESDAYEISF-QQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVELI 326

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKV--GVFPSNY 110
           P  P    A F Y+ + ++DL  + G K+ +      +WY G+   + G V  G+FP ++
Sbjct: 4   PAVPFQAVAQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSF 63

Query: 111 VKAV 114
           V  V
Sbjct: 64  VTVV 67

>KNAG0A06930 Chr1 (1080433..1081350) [918 bp, 305 aa] {ON} 
          Length = 305

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 38/99 (38%), Gaps = 14/99 (14%)

Query: 1   MSVGSVNRSITNIRTELEY----------LLESKVISRDTFDEFNRKLPDNWDGKPIGGA 50
            S     R + N  TE++           L +S + +++   EF   + D    KP    
Sbjct: 136 CSAAEARRDLQNPNTEVQLFWISSADPKGLPQSNIETQNILKEFKEVVVDTLPNKPTQQR 195

Query: 51  GEKHP----PHEPEYVEAIFRYKPQEKEDLELQVGDKVE 85
             KH     P         +R  P EKE+LE Q+ D +E
Sbjct: 196 ETKHKVDLIPGSAPVARRPYRMGPAEKEELERQLHDLLE 234

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 50  AGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKN-KGKVGVF 106
           AG++  P+     + ++ Y+    +  E+   D+ EIL+   +   W++ K   G+ G+ 
Sbjct: 269 AGDESFPYT---AKTLYSYQADAGDAYEISF-DQGEILKVSDIEGRWWKAKRANGETGII 324

Query: 107 PSNYVKAV 114
           PSNYV+ +
Sbjct: 325 PSNYVQLI 332

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 5/65 (7%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWY-----RGKNKGKVGVFPSNY 110
           P  P  V A + Y+     DL  + G ++E++      WY      G    + G+FP NY
Sbjct: 7   PEVPFDVIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNY 66

Query: 111 VKAVK 115
           V+  +
Sbjct: 67  VEVAQ 71

>TDEL0E04600 Chr5 complement(861586..864537) [2952 bp, 983 aa] {ON}
           Anc_5.170 YJL020C
          Length = 983

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 5/61 (8%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGK-----VGVFPSNY 110
           PH P  V A F YK + ++DL  +    + +      +WY G  K K      G+FP ++
Sbjct: 4   PHPPFQVVAQFPYKSEYEDDLNFEKDQIITVTSIEDDEWYYGDFKNKGGELVEGIFPKSF 63

Query: 111 V 111
           V
Sbjct: 64  V 64

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 76  LELQVGDKVEILEKLSADWYRG------KNKGKVGVFPSNYVKAVK 115
           L +Q GD V +L K  + W+ G       +K   G FP NY K ++
Sbjct: 38  LSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNYTKPLR 83

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
          1252 aa] {ON} ANNOTATED BY YGOB - skipping over
          frameshift in strain S288c
          Length = 1252

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 55 PPHEP-EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG 97
          P  +P + VE  ++Y  + +  L L+VGD + +L K S  W+ G
Sbjct: 23 PCLQPIDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>Smik_10.251 Chr10 complement(395243..398611) [3369 bp, 1122 aa]
           {ON} YJL020C (REAL)
          Length = 1122

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 56  PHEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK---NKGKV--GVFPSNY 110
           P  P  V A F YK   ++DL  +   ++ +     A+WY G+   + G+V  G+FP ++
Sbjct: 4   PEVPFKVVAQFPYKSDYEDDLNFEKDQEITVTSVEDAEWYFGEYQDSNGEVIEGIFPKSF 63

Query: 111 VKA 113
           V A
Sbjct: 64  VAA 66

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 34/56 (60%), Gaps = 3/56 (5%)

Query: 63  EAIFRYKPQEKEDLELQVGDKVEILEK-LSADWYRGKN--KGKVGVFPSNYVKAVK 115
           + ++ Y   + +++ +  GD ++++EK   + W +  N   G++G+ PS+Y++ V+
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLETVE 593

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 59  PEYVEAIFRYKPQEKEDLELQVGDKVEILE--KLSADWYRGKNK-GKVGVFPSNYVKAV 114
           P   +A++ Y+    +  E+    + EIL    +   W++ K   G+ G+ PSNYV+ V
Sbjct: 267 PYTAKALYAYEADASDAYEISF-QQGEILRVGDIEGRWWKAKKANGETGIIPSNYVELV 324

>Smik_12.47 Chr12 (99536..103291) [3756 bp, 1251 aa] {ON} YLL016W
          (REAL)
          Length = 1251

 Score = 30.0 bits (66), Expect = 6.2,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 51 GEKHPPHEP-EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG 97
          G   P  +P + VE I  Y   ++  L L++GD + +L K S+ W+ G
Sbjct: 19 GHDVPCLQPIDVVECICEYFINKRNKLSLRIGDLIYVLNKGSSGWWDG 66

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 29.6 bits (65), Expect = 6.3,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSA-DWYRGKNK-------GKVGVFPSNYVK 112
           AI+ Y+PQ  E+L +   D + +L+K    DW+  K +         VG+ PS Y++
Sbjct: 10  AIYDYEPQTPEELAIHEDDLLYLLQKSDIDDWWTVKRRVIGSDSDEPVGLVPSTYIE 66

>TPHA0E01070 Chr5 (220093..221211) [1119 bp, 372 aa] {ON} Anc_7.365
           YLR191W
          Length = 372

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 66  FRYKPQE-KEDLELQVGDKVEILEKLSAD-----WYRGKNK-GKVGVFPSNYVKAVKFSG 118
           + Y P++ +    L+  D V I+E   +D     W + KNK GKVG+ P+ YV  +K S 
Sbjct: 311 YDYIPEDLRLGYTLKKNDIVSIVEGYLSDNGISNWLKIKNKEGKVGLIPNKYVDLLKSSN 370

Query: 119 V 119
           +
Sbjct: 371 M 371

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 64  AIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGK--NKGKVGVFPSNYV 111
           A + Y+  E  +L  +  +++  ++ +  DW+ G+  + G+ G+FPSNYV
Sbjct: 523 AEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGLFPSNYV 572

>CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} similar
           to uniprot|P29366 Saccharomyces cerevisiae YBR200w BEM1
           bud emergence mediator
          Length = 557

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 39/82 (47%), Gaps = 2/82 (2%)

Query: 25  VISRDTFDEFNRKLPDNWD--GKPIGGAGEKHPPHEPEYVEAIFRYKPQEKEDLELQVGD 82
           V+ +  FD  +R  P + D  G+ +  +          Y   ++ +K ++ ++L+  VG+
Sbjct: 111 VVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDELDTFVGE 170

Query: 83  KVEILEKLSADWYRGKNKGKVG 104
            + I    + +W+  K  G++G
Sbjct: 171 NLFICAHHNYEWFIAKPIGRLG 192

>Suva_10.58 Chr10 (117228..121007) [3780 bp, 1259 aa] {ON} YLL016W
          (REAL)
          Length = 1259

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 39 PDNWDGKPIGGAGEKHPPHEP-EYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRG 97
          PD    K     G + P  +P + VE  + +  + ++ L L++GD V +L K +  W+ G
Sbjct: 6  PDAGTTKIKDNEGHEVPCLQPIDVVECTYEHFSESRDKLSLRLGDLVYVLNKGTNGWWDG 65

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 6   VNRSITNIRTELEYLLESKVISRDTFDEFNR 36
           + +S ++I   LE LLE  VISRD +D  +R
Sbjct: 146 IGKSDSDIVVTLESLLEKNVISRDLYDSISR 176

>Kwal_27.10800 s27 (501753..506072) [4320 bp, 1439 aa] {ON} YBL079W
           (NUP170) - Nucleoporin highly similar to Nup157p and to
           mammalian Nup155p (nup170 mutant can be complemented
           with NUP155) [contig 33] FULL
          Length = 1439

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 2   SVGSVN--RSITNIRTELEYLLESKVISRDTFDEFNRKL-----PDNWDGKPIGGAGEKH 54
           S+G+ N  RSI+N + ++EY L S +I  + FD +   +     P    GK I  A E  
Sbjct: 772 SIGTENLIRSISNSKADVEYYLSSIMILNEFFDTYGNSISSISVPSFQSGKNIDRAEEVA 831

Query: 55  PPHEPEYVEAIFRYKPQEKE 74
              E   + ++ R     KE
Sbjct: 832 NQAENIAINSLIRLIHSMKE 851

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,864,048
Number of extensions: 805774
Number of successful extensions: 1901
Number of sequences better than 10.0: 262
Number of HSP's gapped: 1846
Number of HSP's successfully gapped: 298
Length of query: 217
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 112
Effective length of database: 41,441,469
Effective search space: 4641444528
Effective search space used: 4641444528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)