Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079703.498ON38838816440.0
KAFR0G037203.498ON4093996802e-85
Suva_16.4803.498ON4523545092e-59
YPR152C (URN1)3.498ON4654424981e-57
TDEL0D056603.498ON4424414873e-56
Kwal_47.188953.498ON4434474873e-56
CAGL0L08404g3.498ON4103984792e-55
NCAS0F035803.498ON4133994373e-49
KLLA0E03939g3.498ON4354344368e-49
ZYRO0D09768g3.498ON4601613502e-36
Skud_16.4463.498ON4561443423e-35
KLTH0G02398g3.498ON4622363329e-34
Smik_16.4043.498ON4601473282e-33
TPHA0A056903.498ON4782503204e-32
Ecym_12313.498ON3292343126e-32
AFR317C3.498ON3282283022e-30
Kpol_480.113.498ON4632343073e-30
SAKL0F02552g3.498ON4782593021e-29
NDAI0B059003.498ON5222542608e-24
TBLA0D029303.498ON2761261742e-13
YKL012W (PRP40)2.649ON583661052e-04
Kpol_1073.42.649ON530671043e-04
Smik_11.2432.649ON57966990.001
Kwal_14.9392.649ON56263960.003
ZYRO0E00682g2.649ON57066960.003
KLTH0C00924g2.649ON56467950.003
Skud_11.2172.649ON583127920.008
Suva_11.2162.649ON58566920.009
NCAS0C051102.649ON60463870.035
CAGL0L05368g2.649ON59067860.051
TPHA0L020202.649ON58365850.068
TBLA0C009302.649ON65883820.15
Ecym_33972.649ON57565810.18
SAKL0G19360g2.649ON56829810.20
KAFR0A002302.649ON55664790.31
KLLA0E18239g2.649ON57165790.34
TDEL0B074402.649ON57065780.48
KNAG0M024702.649ON60630731.6
NDAI0G046002.649ON64724694.7
ADR159C2.649ON56967695.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07970
         (388 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   637   0.0  
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   266   2e-85
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   200   2e-59
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   196   1e-57
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   192   3e-56
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   192   3e-56
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   189   2e-55
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   172   3e-49
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   172   8e-49
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   139   2e-36
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   136   3e-35
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   132   9e-34
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   130   2e-33
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   127   4e-32
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   124   6e-32
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   120   2e-30
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   122   3e-30
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   120   1e-29
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   104   8e-24
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    72   2e-13
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    45   2e-04
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    45   3e-04
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    43   0.001
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    42   0.003
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    42   0.003
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    41   0.003
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    40   0.008
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    40   0.009
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    38   0.035
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    38   0.051
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    37   0.068
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    36   0.15 
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    36   0.18 
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    36   0.20 
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    35   0.31 
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    35   0.34 
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    35   0.48 
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    33   1.6  
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    31   4.7  
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    31   5.1  

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/388 (81%), Positives = 318/388 (81%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN 60
           MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN 60

Query: 61  GAKFYLNPDGDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYNSVLEEIS 120
           GAKFYLNPDGDPV              VDREKLILLIGVARGYHCTSGDKVYNSVLEEIS
Sbjct: 61  GAKFYLNPDGDPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSGDKVYNSVLEEIS 120

Query: 121 FLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVPSALVXXXXXXXXXXXXXXXVPPDTDA 180
           FLKDDLANDK               TNVQSEPVPSALV               VPPDTDA
Sbjct: 121 FLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSALVSGYGSSSDGSDDEEEVPPDTDA 180

Query: 181 NRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVXXXXX 240
           NRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVV     
Sbjct: 181 NRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVDDSED 240

Query: 241 XXXXXXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQ 300
                    LSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQ
Sbjct: 241 EGYSSGDDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQ 300

Query: 301 FVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVXXXXXXXXXXXXEDIETNLLQMESHLP 360
           FVSQLLFYYKKFTLEERVQLFTKFIAESRTGTV            EDIETNLLQMESHLP
Sbjct: 301 FVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVPSPTSPADSATPEDIETNLLQMESHLP 360

Query: 361 PTVLDNTVYYTLDIKTKQSVLHRMLPHG 388
           PTVLDNTVYYTLDIKTKQSVLHRMLPHG
Sbjct: 361 PTVLDNTVYYTLDIKTKQSVLHRMLPHG 388

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  266 bits (680), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/399 (36%), Positives = 211/399 (52%), Gaps = 25/399 (6%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN 60
           M  +W+EYRAPNGKKYY+NT T +TTW+ P   K +    I+P +VI L+N W LVICNN
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPEAAKRE---EIEPVFVIRLMNDWKLVICNN 57

Query: 61  GAKFYLNPDGDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYNSVLEEIS 120
           G K+YL+ + +P                D+EKL+ LIG+ARGY   + +K+Y +++EE+ 
Sbjct: 58  GMKYYLDNENEPTKELSDEESLRLIELFDKEKLVCLIGIARGYAIENVEKIYGNIVEEVE 117

Query: 121 FLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVPSAL--------VXXXXXXXXXXXXXX 172
           FLK+D+ N++                    +P  + +                       
Sbjct: 118 FLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGYDSSESEEEEEEEDDYEFLNN 177

Query: 173 XVPPDTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCS 232
                   ++  +  LF  YGLDK+S WS+E  K+S DP F++++DD++RE++FE WC  
Sbjct: 178 VADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSG 237

Query: 233 GVVXXXXXXXXXXXXXXLSP-------TKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFK 285
             +                        TK+HYLSQIV+KS +  TTIFQDIK++   LFK
Sbjct: 238 QGIHSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLFK 297

Query: 286 QYGIKQFL-SKREQEQFVSQLLFYYKKF-TLEERVQLFTKFIAESRTG--TVXXXXXXXX 341
           +Y IK F+ S +EQE+FVS+LLFYYK F  +E+R + F  F+ E      ++        
Sbjct: 298 EYKIKDFIESSKEQEKFVSKLLFYYKTFPQVEDRTKQFNDFLREKNANYTSMSDMNTLSE 357

Query: 342 XXXXED---IETNLLQMESHLPPTVLDNTVYYTLDIKTK 377
                D   IET LLQ+E + P  VL +  YY LD+K K
Sbjct: 358 HIKRNDTYAIETTLLQIECNFPQDVLSDVRYYILDLKQK 396

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  200 bits (509), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 182/354 (51%), Gaps = 36/354 (10%)

Query: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQ--------RELSIKPQYVIPLLNAWNL 55
           VW+E++ P GK+Y++N  T E+ WD P  +K           ++  KP + + L++ W+L
Sbjct: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65

Query: 56  VICNNGAKFYLNPDGD----PVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGD-- 109
           +ICN+G KFY N + +     +              +D+EKLILLIGVARGY+    D  
Sbjct: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125

Query: 110 KVYNSVLEEISFLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVP--SALVXXXXXXXXX 167
           K++ S+ EEI   K     ++                + ++ P    + LV         
Sbjct: 126 KIFESLNEEIDLFK----KNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSSEE 181

Query: 168 XXXXXXVPPDT-----DANRIS---------YFNLFSEYGLDKYSVWSIESLKISNDPRF 213
                    D      D N+I          +F L   Y LDK+S WS++  KI NDP F
Sbjct: 182 EEEEEEPENDDAGIIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPDF 241

Query: 214 HIISDDRQREEIFEEWCCSGVVXXXXXXXXXXXXXX-LSPTKYHYLSQIVAKSTVTPTTI 272
           + + D   RE +FEEWC S                  L PTK+HYL+QIVAK+ + P  I
Sbjct: 242 YKVGDAAVRESLFEEWCASASASASGNESEDEDDADLLEPTKFHYLAQIVAKAEIAPDCI 301

Query: 273 FQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFI 325
            QDI++++ +LFK Y IK+++ SKR+Q++FVSQLLFYYK F+LE+R ++F + +
Sbjct: 302 PQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECL 355

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  196 bits (498), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 142/442 (32%), Positives = 201/442 (45%), Gaps = 57/442 (12%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRK--------PQRELSIKPQYVIPLLNA 52
           M+  W+E++ P GKKYY+N  T ++ W+ P  +K         + +   KP + + L+N 
Sbjct: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60

Query: 53  WNLVICNNGAKFYLNPDG----DPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSG 108
           W+L+I N+G K Y N D     + +              +D+EKL+LLIGVARGY     
Sbjct: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120

Query: 109 D--KVYNSVLEEISFL---------KDDLANDKXXXXXXXXXXXXXXXTNVQSEP--VPS 155
           D  K+  S  EEI            KD+++ +                +   S       
Sbjct: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDE 180

Query: 156 ALVXXXXXXXXXXXXXXXVPPDTDANRIS---------YFNLFSEYGLDKYSVWSIESLK 206
                             +    D NRI          +F LF  Y LDK+S WS++S K
Sbjct: 181 EEDEEEDEENEEQIVNQDISIIDDLNRIDTDDIDERNIFFELFDRYKLDKFSTWSLQSKK 240

Query: 207 ISNDPRFHIISDDRQREEIFEEWCC--SGVVXXXXXXXXXXX---XXXLSPTKYHYLSQI 261
           I NDP F+ I DD  RE +FEEWC   SG                   L PTKYHYL+QI
Sbjct: 241 IENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYLAQI 300

Query: 262 VAKS-TVTPTTIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQ 319
           VA + T+ P TI QDI++++ +L+K Y IK+++ SKR+Q++FVSQLLFYYK F LE+R +
Sbjct: 301 VANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQRKE 360

Query: 320 LFTKFIAESR---TGTVXXXXXXXXX-----------XXXEDIETNLLQMESH--LPPTV 363
           +F   + +     TG V                         IE  LL +E    + P V
Sbjct: 361 IFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPADSSSIEDILLSIEHRCCVSPIV 420

Query: 364 LDNTVYYTLDIKTKQSVLHRML 385
           +    YY + I  K  V  R L
Sbjct: 421 VTEPRYYVVGILEKTVVWVRWL 442

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  192 bits (487), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 135/441 (30%), Positives = 203/441 (46%), Gaps = 59/441 (13%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYT-------RKPQRELSIKPQYVIPLLNAW 53
           M  +W  + AP+G+KYY+N  T E+TW  P +       ++P+     +P Y IPL+N W
Sbjct: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTREPEPFYAIPLVNDW 60

Query: 54  NLVICNNGAKFYLNPDGDPVX-XXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVY 112
            LVI + G K+Y +   +                 +D+ K+ILL+ +ARGY+   GD+VY
Sbjct: 61  FLVIDDIGGKYYFDSSTEEASWTLEDPESAELLSTIDKNKIILLVAIARGYNTNVGDRVY 120

Query: 113 NSVLEEISFLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVPSALVX------------X 160
             V++++  L+   A ++                + + E  PS L+              
Sbjct: 121 QEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEEEENEID 180

Query: 161 XXXXXXXXXXXXXVPPDTDAN----RISYFNLFSEYGLDKYSVWSIESLKISNDPRFHII 216
                        +P +   +    R  +F L   +  D YS WSI++ KI  DP F+ I
Sbjct: 181 SDVEKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYSTWSIQARKIQEDPLFYRI 240

Query: 217 SDDRQREEIFEEWCCSGVVXXXX------------XXXXXXXXXXLSPTKYHYLSQIVAK 264
           +DD  RE +FEEWC   +                           L P  +HYL+ IV+K
Sbjct: 241 TDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEEDELEPLPFHYLAHIVSK 300

Query: 265 STVTPTTIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTK 323
           + +TP+TIFQDIK +  + FK+Y IKQF+ SK +QE FVS+LLFYYKKFTL+ER ++F  
Sbjct: 301 ANITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHD 360

Query: 324 FI--------------AESRTGTVXXXXXXXXXXXXEDIETNLLQMESHLP-----PTVL 364
            +              +ES   T+              IET LL+ME+ +        + 
Sbjct: 361 LLESHSRSIKKNLEQESESMRSTLSEEAGSNDAYA---IETKLLKMENLIGLARDMEELA 417

Query: 365 DNTVYYTLDIKTKQSVLHRML 385
           ++  YY L IK K   L   L
Sbjct: 418 NDPKYYVLGIKDKMIELMHYL 438

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  192 bits (487), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 138/447 (30%), Positives = 206/447 (46%), Gaps = 70/447 (15%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSP-------YTRKPQRELSIKPQYVIPLLNAW 53
           M   WREY+ P+G KYY+N  T ++T++ P        + +  R+L  KP + + L N W
Sbjct: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPDDFDEDQNSGRKSRKLDAKPLFALSLFNDW 60

Query: 54  NLVICNNGAKFYLNPDGDPVX-XXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDK-V 111
            L+ICN G +F+ N +                   +DREKL+LL+GVA+G+    GD+ V
Sbjct: 61  ALIICNTGLRFFYNSESHTSRWDLDDEASLELLAKLDREKLVLLVGVAKGFD--PGDRNV 118

Query: 112 YNSVLEEISFLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVPSA--------------- 156
           Y  + + IS LK+    D                T V  + + S                
Sbjct: 119 YQELSDSISELKE----DSNNRDFRKETAEESIPTAVPGQSLVSGYGSSDESDKDEDEEE 174

Query: 157 ----------LVXXXXXXXXXXXXXXXVPPDTD-ANRISYFNLFSEYGLDKYSVWSIESL 205
                      V               V P+ D +N   + +LFS+Y +D YS W+++S 
Sbjct: 175 EENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSR 234

Query: 206 KISNDPRFHIISDDRQREEIFEEWC---CSGVVXX-------XXXXXXXXXXXXLSPTKY 255
           KI +DP F+ I++D  R+E+FE WC   CS                        L P++Y
Sbjct: 235 KIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLEPSRY 294

Query: 256 HYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQLLFYYKKFTLE 315
           HYL+ IV+KS +T +T+ +DI+ ++  LFKQ+ IK  LSKREQ+ F+S+LLFYYK+ T E
Sbjct: 295 HYLAHIVSKSKITSSTLPKDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPE 354

Query: 316 ERVQLFTKFIA------------ESRTGTVXXXXXXXXXXXXEDIETNLLQME----SHL 359
           +R+ +F +F+             + R  T+              IET LL +E    +H 
Sbjct: 355 QRIAIFKRFLEGKKKALKKGLKNQERLSTILSTPSLPQENYA--IETQLLILEDCIDTHG 412

Query: 360 PPTVLDNTV-YYTLDIKTKQSVLHRML 385
               L   V YY L IK K   L  +L
Sbjct: 413 SNAFLQEDVQYYVLGIKDKTVALRDIL 439

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  189 bits (479), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 133/398 (33%), Positives = 197/398 (49%), Gaps = 26/398 (6%)

Query: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYTRK----PQRELSIKPQYVIPLLNAWNLVICN 59
           +W+EY APNG KYY+NT T ETTW  P T +      +E+ IKP     LL  W L+I +
Sbjct: 8   LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETADKEIEIKPLVAFELLAGWALIIFS 67

Query: 60  NGAKFYLNPDGDPVXXXXXX-XXXXXXXXVDREKLILLIGVARGYHC-TSGDKVYNSVLE 117
           +G+K Y N +                   +++++L+LLIG+ RGY C T+   + N + E
Sbjct: 68  DGSKKYYNCNESQWSRKISHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKDLVNEIRE 127

Query: 118 EISFLKDDLANDKXXXXXXXXXXXXXXXTNVQS---------EPVPSALVXXXXXXXXXX 168
           +I F+++D+   K                   +         E  P+             
Sbjct: 128 DIDFIREDMNAAKTSEDMKSGSTVNNLENTKNALLGYYSSDDEEEPAKRDEQAVVEEPDE 187

Query: 169 XXXXXVPPDTDA----NRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREE 224
                VP  T       + SYF LF+++ L+KYS W IES K+S DP F+ I DD  RE 
Sbjct: 188 TNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAVREN 247

Query: 225 IFEEWCCSGVVXXXXXXXXXXXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLF 284
           IFEEWC +G V                PTKYHYLSQ+VA   + P TI  +   +   L 
Sbjct: 248 IFEEWCNAGSV-ESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTI-PEDIIKDKKLI 305

Query: 285 KQYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVXXXXXXXXXXX 344
           K+Y IK + +K EQ QF+S++L +YK  +LE+R Q+F  +I     G             
Sbjct: 306 KKYRIKDYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKY----TDIDSDA 361

Query: 345 XEDIETNLLQMESHLP-PTVLDNTVYYTLDIKTKQSVL 381
            ED+E+ LL++E+ L  PT  ++  YY +D+++K+ +L
Sbjct: 362 QEDVESQLLELENQLGIPTSENDLEYYCIDLRSKRDIL 399

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  172 bits (437), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 126/399 (31%), Positives = 188/399 (47%), Gaps = 38/399 (9%)

Query: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYTR-KPQRELSIKPQYVIPLLNAWNLVICNNGA 62
           +WREY+APNG+KYY+N  T ETTW  P    KP+   + + ++   L + W L+I  +G 
Sbjct: 6   LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVKFAFELFDGWYLLIRGDGG 65

Query: 63  KFYLNPDGDPVXXXXXXXXXXXXXX-----VDREKLILLIGVARG-----YHCTSGDKVY 112
           K + +   +                     +D+EK+ILLIG+ RG     YH      VY
Sbjct: 66  KLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHIKG---VY 122

Query: 113 NSVLEEISFLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVPSALVXXXXXXXXXXXXXX 172
           + + ++I+FLK ++ ND                 + + E +P                  
Sbjct: 123 DDIAQDINFLKQEILND--AMELERLNAEAEEEESEKEEALPQEEQDDHTVELLNNLEEE 180

Query: 173 XVPPDTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCS 232
               D   +R+  F+LF  + LD YS WS++S KISN   + ++ DD QREE+FE+WC  
Sbjct: 181 EEEQDV-KDRL--FHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAM 237

Query: 233 GVVXXXXXXXXXXXXXXLSPTKYHYLSQIV--AKSTVTPTTIFQDIKQEKASLFKQYGIK 290
            V                 PTKYHYLS+I+   +  +   T+  DI +    LFKQY IK
Sbjct: 238 KVAQLPEDESEAEDDDY-EPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIK 296

Query: 291 QFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTV---XXXXXXXXXXXXE 346
           QF+  +RE    VS+LLFYYK+FT  ER  +F  ++++ R G +               E
Sbjct: 297 QFIPDRRELRAVVSRLLFYYKRFTARERRAVFHDYVSQ-RYGLLPGEDVDNDDAGSLSGE 355

Query: 347 DIETNLLQME--------SHLPPTVLDNTVYYTLDIKTK 377
            +ET +LQ E        S   PT L+   YY + ++ K
Sbjct: 356 QMETRILQWERDRQTEGNSSWDPTALE---YYVVGLREK 391

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  172 bits (436), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 126/434 (29%), Positives = 197/434 (45%), Gaps = 57/434 (13%)

Query: 3   SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQ----RELSIKPQYVIPLLNAWNLVIC 58
           S W+ ++ P+G  YY NT +  +T + P     Q    +EL + P + +PL N WNLVIC
Sbjct: 2   SEWKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQAGMKELRV-PVFCLPLRNYWNLVIC 60

Query: 59  NNGAKFYLNPDGDPVX-XXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYNSVLE 117
            +G+KF+ N + +                 VD   L LLIGVARG++  +   VY  + +
Sbjct: 61  KDGSKFFHNDESNVSQFKLADDESKALLDKVDTSLLALLIGVARGFNLRNDRDVYGEIRD 120

Query: 118 EISFLKDDLANDKXXXXXXXXXXXXXXXTNVQSEPVPSA---LVXXXXXXXXXXXXXXXV 174
            +    D  +NDK               +NV +E    +   LV               V
Sbjct: 121 VLQAKLD--SNDKEQNDITEERPQVTN-SNVDTEDKSESSNILVSGYSSSSDDSGEESEV 177

Query: 175 PPDTDANRIS------------------YFNLFSEYGLDKYSVWSIESLKISNDPRFHII 216
               D + I                   +  L +E  LD YS WSI++ +I +DPR+++I
Sbjct: 178 EEKNDPSSIDVKEEDTLPSLNNTEIESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLI 237

Query: 217 SDDRQREEIFEEWCCSGVVX-----------XXXXXXXXXXXXXLSPTKYHYLSQIVAKS 265
           + + +R+E+F+ WC   +                          L PTKYHYL+ I++K+
Sbjct: 238 TSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTKYHYLAHIISKA 297

Query: 266 TVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFI 325
            +TP T+F +IK+E  SLFK+  I + L+K+EQEQF S+++ YYK+    +R +LF K +
Sbjct: 298 NITPETLFSNIKKENKSLFKELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMM 357

Query: 326 AESR-----TGTVXXXXXXXXXXXXEDIETNLLQMESHLPPTVLDN---------TVYYT 371
                    +  +              +ET LLQ+E+ L   +LDN          +YY 
Sbjct: 358 KNKLRFPPISEKLSQLMLEETPSDSFKLETQLLQLENAL--LILDNLQNSYMQNEIMYYI 415

Query: 372 LDIKTKQSVLHRML 385
           L IK K + L  +L
Sbjct: 416 LGIKDKLAALKEIL 429

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  139 bits (350), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (60%), Gaps = 7/161 (4%)

Query: 175 PPDTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGV 234
           P D   ++ + ++LF+ Y L+ YS W  E  KI +DP F  + DD  RE++FEEWC   +
Sbjct: 223 PVDISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAI 282

Query: 235 VXXXX------XXXXXXXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYG 288
                                L PTKYHYL+ IV+KS +TPTTIF DIK +  S FK+Y 
Sbjct: 283 SGDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDNKSSFKKYN 342

Query: 289 IKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAES 328
           IK FL SK++QE FVS+LLFYYK+  LEER ++F + + ++
Sbjct: 343 IKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQN 383

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTR---------KPQRELSIKPQYVIPLLN 51
           M  +WREY AP+G+KYY+N  T ++TW  P +          K  +++  KP   + L +
Sbjct: 1   MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKRFKKIESKPHVALELYH 60

Query: 52  AWNLVICNNGAKFYLNPD-GDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDK 110
            W+LVIC+ G KFY N +  +                +D+ KL+ LIG+ARGY    G  
Sbjct: 61  GWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNKLVALIGLARGY-SPGGLH 119

Query: 111 VYNSVLEEISFLK 123
           +Y  ++ ++  L+
Sbjct: 120 IYEELVTDLVKLR 132

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  136 bits (342), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 94/144 (65%), Gaps = 4/144 (2%)

Query: 182 RISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCC--SGVVXXXX 239
           R  +F LF  Y LDK+S WS++S KI NDP F+ I DD  RE  FEEWC           
Sbjct: 212 RGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAE 271

Query: 240 XXXXXXXXXXLSPTKYHYLSQIVAKS-TVTPTTIFQDIKQEKASLFKQYGIKQFL-SKRE 297
                     L PTKYHYL+QI+AK+ T+ P  + QDI++++  L+K Y IK+++ SKRE
Sbjct: 272 ASGSEDVGDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKRE 331

Query: 298 QEQFVSQLLFYYKKFTLEERVQLF 321
           Q++FVSQLLFYYK F+LE+R ++F
Sbjct: 332 QDKFVSQLLFYYKTFSLEQRKEIF 355

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 77/134 (57%), Gaps = 14/134 (10%)

Query: 4   VWREYRAPNGKKYYHNTTTGETTWDSP----YTRKPQRELSI----KPQYVIPLLNAWNL 55
           +W+E++ P G +YY+N  T ++ W++P    ++ +   E ++    KP + + L++AW+L
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 56  VICNNGAKFYLNPDG----DPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSG--D 109
           VICN+G KFY N D     + +              +D+EKL+LLIGVARGY       D
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120

Query: 110 KVYNSVLEEISFLK 123
           K++ S+ EEI+  K
Sbjct: 121 KIFESLNEEINLFK 134

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  132 bits (332), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 120/236 (50%), Gaps = 29/236 (12%)

Query: 179 DANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCS------ 232
           +A +  + +LF EY LD YS W+++S KI ++P F+ ++ D +R E+FE+WC +      
Sbjct: 220 EATKQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLED 279

Query: 233 --------GVVXXXXXXXXXXXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLF 284
                    V               L PT+YHYL+ IV+K+ V P+T+ +D++ E+  LF
Sbjct: 280 VIEDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLF 339

Query: 285 KQYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESR---TGTVXXXXXXXX 341
           KQ+ IK+ L K++Q++F+S+LLFYYK  T E+R+++  KF+   R               
Sbjct: 340 KQFKIKESLGKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLES 399

Query: 342 XXXXEDIETNLLQMESHL------------PPTVLDNTVYYTLDIKTKQSVLHRML 385
               +D+ T+   +ES L               + D   YY L IK K + L   L
Sbjct: 400 VLSQQDLPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFL 455

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 62/131 (47%), Gaps = 9/131 (6%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYT-------RKPQRELSIKPQYVIPLLNAW 53
           M   WREY+ P+G KYY+N  T  +T D P         R   R +     +V+PL N W
Sbjct: 6   MPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFRSKSRRVDPGVTFVVPLSNDW 65

Query: 54  NLVICNNGAKFYLNPDGDPVX-XXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVY 112
            L +C NG +F+     +                 VD+ KL+LL+  ARG+     D VY
Sbjct: 66  VLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKNKLVLLLATARGFDIGERD-VY 124

Query: 113 NSVLEEISFLK 123
             +LE+I+ LK
Sbjct: 125 QELLEDINNLK 135

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  130 bits (328), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/147 (47%), Positives = 91/147 (61%), Gaps = 5/147 (3%)

Query: 177 DTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVX 236
           D    R  +F L   Y LDK+S WS++S KI NDP F+ I DD  RE +FEEWC      
Sbjct: 214 DEGRERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEK---H 270

Query: 237 XXXXXXXXXXXXXLSPTKYHYLSQIVAKS-TVTPTTIFQDIKQEKASLFKQYGIKQFLS- 294
                        L PTKYHYL+QIVAK+  + P  I QDI++ + +L+K Y IK+++  
Sbjct: 271 SAKESDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPL 330

Query: 295 KREQEQFVSQLLFYYKKFTLEERVQLF 321
           KREQ++FVSQLLFYYK F LE+R  +F
Sbjct: 331 KREQDRFVSQLLFYYKTFNLEQRKTIF 357

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 14/137 (10%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQ--------RELSIKPQYVIPLLNA 52
           M  VW+E++ P G+KYY+N TT ++ W+ P  +K           ++   P + + L++ 
Sbjct: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60

Query: 53  WNLVICNNGAKFYLNPDG----DPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSG 108
           W+L+ICN+G K Y N D       +              +D++KL+LLIG+ARGY     
Sbjct: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120

Query: 109 --DKVYNSVLEEISFLK 123
             DK++ S+ EEI   K
Sbjct: 121 DIDKIFESLNEEIDLFK 137

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  127 bits (320), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 84/250 (33%), Positives = 123/250 (49%), Gaps = 41/250 (16%)

Query: 177 DTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCC----- 231
           D +A++  YF LF +Y L+ +S WS +S  + +DP F++I+D+  RE+IFEEWC      
Sbjct: 225 DFNASKEKYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSH 284

Query: 232 ---------------SGVVXXXXX------XXXXXXXXXLSPTKYHYLSQIVAKSTVTPT 270
                          SG                      L PTKYHYLS I++K+ ++P 
Sbjct: 285 HNSITSVDKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPD 344

Query: 271 TIFQDIKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESR 329
           TIFQDIK++   LFKQ+ I +F+ SKR+ E F S+L+FYYKKF   +R  +F   + +++
Sbjct: 345 TIFQDIKKDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNK 404

Query: 330 TGT-------VXXXXXXXXXXXXEDI--ETNLLQMESHLPPT-----VLDNTVYYTLDIK 375
           T                      ED   ET LL++E  L  +     + ++  YY L IK
Sbjct: 405 TAINKHVVEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYILGIK 464

Query: 376 TKQSVLHRML 385
            K   L   L
Sbjct: 465 DKLECLKNYL 474

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 77/134 (57%), Gaps = 10/134 (7%)

Query: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYT-------RKPQRELSIKPQYVIPLLNAWNLV 56
           VW+E+ APNG+KYY+N  T +TTWD P +        + Q++ S  P +  PL N W LV
Sbjct: 5   VWKEFIAPNGQKYYYNLKTKKTTWDEPESLFEGNAVSQGQKDES--PVFAFPLFNDWYLV 62

Query: 57  ICNNGAKFYLNP-DGDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYNSV 115
           I + G KFY N  +   V              +D++KLILL+GVARG+      +VY  +
Sbjct: 63  ISSLGKKFYFNAVENISVLELHDELNTQLLQSIDKQKLILLVGVARGFIYDEYLQVYEEI 122

Query: 116 LEEISFLKDDLAND 129
           +E + F+K++++N+
Sbjct: 123 MENLDFVKNEISNE 136

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  124 bits (312), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 112/234 (47%), Gaps = 25/234 (10%)

Query: 179 DANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVXXX 238
           D+    +  LF  Y L+ YS WS++S K+ +DP F+ + DD  R E+FE+WC   +    
Sbjct: 84  DSEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAG 143

Query: 239 XXXXXXXX-------------XXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFK 285
                                   L P K+HYLS IV+KST+ P T+F D+K E   LFK
Sbjct: 144 GDSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFK 203

Query: 286 QYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVXXXXXXXXXXXX 345
            + I +   K+EQ QFVS LLFYYKK + +ERV++F   +       +            
Sbjct: 204 NFNIDETHPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVKHEINNEDQLQQILDQ 263

Query: 346 E-------DIETNLLQMESHLP-----PTVLDNTVYYTLDIKTKQSVLHRMLPH 387
           E       +IE+ L+ ME ++        + ++  YY + ++ K  ++   L H
Sbjct: 264 ENLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKEFLRH 317

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 4  VWREYRAPNGKKYYHNTTTGETTWDSPYT 32
          VW+  +   G+ YY+ T +GE TW+ P T
Sbjct: 2  VWKRAKTGEGEFYYYETVSGEKTWERPET 30

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  120 bits (302), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 109/228 (47%), Gaps = 20/228 (8%)

Query: 177 DTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVX 236
           +TD  +   + LF    LD YS W  ES KIS D  F+ + DD  R+E+FE+WC   +  
Sbjct: 92  ETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIAD 151

Query: 237 XXXX---XXXXXXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFL 293
                           L PT++HYL+ IV+KSTV P T++ D+++E   LF Q  +   L
Sbjct: 152 EGNAVLEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLEV-DIL 210

Query: 294 SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVXXXXXXXXXXXX-------- 345
            K+EQ +FV+ LLFYYKK     R ++F K +   R                        
Sbjct: 211 DKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAHRAAITAAFLENDAQLRELLEYDELP 270

Query: 346 ED---IETNLLQMES----HLPPTVLDNTV-YYTLDIKTKQSVLHRML 385
           +D   IET+L  +E     H   + L + + YY L +K K  V+  +L
Sbjct: 271 QDSYSIETDLFIVEKCIGLHGALSKLQSEIKYYVLGVKDKLVVMKEVL 318

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 4  VWREYRAPNGKKYYHNTTTGETTWDSPYTRKP 35
          VW+  ++ +GK YY+NT T ETTWD P   +P
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEP 33

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  122 bits (307), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 116/234 (49%), Gaps = 25/234 (10%)

Query: 177 DTDANRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCS---- 232
           D + ++  +  LF E+ LD YS W ++  KI N P +  I+D+  REE+FE WC S    
Sbjct: 226 DLEKSKSLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNG 285

Query: 233 ------GVVXXXXXXXXXXXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQ 286
                                    PTK+HYL+ I++K+ +   TIF DIK+   SLFK+
Sbjct: 286 GKSNVTNFEGEDEETLTSDEEDDFEPTKFHYLAHIISKADIAADTIFLDIKENNKSLFKE 345

Query: 287 YGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESR-------TGTVXXXXX 338
           + IK F+ SK++QE F S+LLF+YKKF L ER  LF + + E+           +     
Sbjct: 346 FKIKDFIKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINSNIEIVRH 405

Query: 339 XXXXXXXE--DIETNLLQME-----SHLPPTVLDNTVYYTLDIKTKQSVLHRML 385
                  E  +IET LLQ+E      ++   + ++  YY L IK K  +L   L
Sbjct: 406 IIKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYL 459

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 4   VWREYRAPNGKKYYHNTTTGETTWDSPYT------RKPQRELSIKPQYVIPLLNAWNLVI 57
           +W+E+ AP+G+KYY+N  + E+TW  P +       K   + +  P +V PLLN W+L+I
Sbjct: 5   IWKEFNAPDGRKYYYNIKSKESTWTKPDSLYDTEKGKVGSDRAGAPLFVFPLLNGWHLII 64

Query: 58  CNNGAKFYLNP--DGDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYNSV 115
           C  G K+Y N   +                  VD++KLILLI VARGY+    +K+Y+ +
Sbjct: 65  CVGGEKYYYNKVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWPDYEKLYDEL 124

Query: 116 LEEISFLKDDL 126
           L+E   + +D+
Sbjct: 125 LKEFELISNDM 135

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  120 bits (302), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 118/259 (45%), Gaps = 50/259 (19%)

Query: 175 PPDTDA-NRISYFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSG 233
           PP  DA NR +   LF +Y LD YS+W  +S KI+ DP F+++++   R+++FE+WC   
Sbjct: 218 PPQLDAKNRFTI--LFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTET 275

Query: 234 VVXXXXXXXXXX--------------------------------XXXXLSPTKYHYLSQI 261
           +                                               L PT++HYLS I
Sbjct: 276 IANSKDAISDANINENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHI 335

Query: 262 VAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQLLFYYKKFTLEERVQLF 321
           ++KS++  TTIF DIK+E  +LFK + IK  L K++QE F S+LLFYYK+  LE+R  +F
Sbjct: 336 ISKSSIEQTTIFLDIKKENKALFKTFRIKSSLKKKDQEDFASKLLFYYKRMDLEQRKLIF 395

Query: 322 TKF------IAESRTGTVXXXXXXXXXXXXE----DIETNLLQMES----HLPPTVLDNT 367
            K       I  S    V                  IET LL ME     H   + L   
Sbjct: 396 QKLLLSKLDIIRSNLRNVEKLRDIATEQSTPADSYAIETQLLMMEDCMDIHGKLSFLQGE 455

Query: 368 V-YYTLDIKTKQSVLHRML 385
           V YY L IK K   L + L
Sbjct: 456 VHYYILGIKDKTIQLKQFL 474

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPY------TRKPQRELSIKPQYVIPLLNAWN 54
           M   W E+  P+G KYY+N  T ++T + P       +RK Q+ L  KP+Y++PL   W+
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKPAGFDDQKSRKRQK-LQHKPKYLVPLDKGWS 59

Query: 55  LVICNNGAKFYLNP-DGDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYN 113
           LV+CN G KFY N    +                +D+EKL+LLIG++RGY+C   + VY+
Sbjct: 60  LVLCNTGTKFYHNKITNESHWTLDDPCSIELLQQLDKEKLVLLIGISRGYYCPRRN-VYD 118

Query: 114 SVLEEISFLKD 124
            ++ ++ FLKD
Sbjct: 119 EIINDLKFLKD 129

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  104 bits (260), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 117/254 (46%), Gaps = 52/254 (20%)

Query: 184 SYFNLFSEYGLDKYSVWSIESLKISNDPR-FHIISDDRQREEIFEEWCCSGVVXXXXXXX 242
           ++F L  +  LD YS WS++S +I   P  F+ IS+D +REEIFE+WC + V        
Sbjct: 258 AFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLYSS 317

Query: 243 XXXXXX-------------------------XLSPTKYHYLSQIVAK--STVTPTTIFQD 275
                                           L PTKYHYLS+++ K   ++   +IFQD
Sbjct: 318 NVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIFQD 377

Query: 276 IKQEKASLFKQYGIKQFL-SKREQEQFVSQLLFYYKKFTLEERVQLFTKFIAESRTGTVX 334
           IK++  SLFK Y IK ++  K+E E+ VS LLFYYKK + +ER   F +++ +     + 
Sbjct: 378 IKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKHYGEKIK 437

Query: 335 ------------XXXXXXXXXXXEDIETNLLQMES--------HLPPTVLDNT---VYYT 371
                                   DIE  +LQ+E+        H+P T   +T    YY 
Sbjct: 438 LHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPGLEYYI 497

Query: 372 LDIKTKQSVLHRML 385
           + ++ K S L  ++
Sbjct: 498 IGLRAKHSALATLI 511

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 72/145 (49%), Gaps = 20/145 (13%)

Query: 2   KSVWREYRAPNGKKYYHNTTTGETTWDSPY----TRK--------PQRELSIKPQYVIPL 49
           K +W+EY+ PNGKKYY+N  T ++TW+ P+    T K         Q    I+ ++   L
Sbjct: 9   KRIWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKL 68

Query: 50  LNAWNLVICNNGAKFYLNPDGDPVXXXXXXXXXXXXXX------VDREKLILLIGVARGY 103
           LN W L++ ++G+KFY N   +                      +D+  LI LIG+ RGY
Sbjct: 69  LNEWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGY 128

Query: 104 HCTSGD--KVYNSVLEEISFLKDDL 126
           +  S D   +Y  ++  I FLK D+
Sbjct: 129 NDPSIDIKGLYEEIVANIGFLKQDI 153

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 68/126 (53%), Gaps = 5/126 (3%)

Query: 185 YFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVXXXXXXXXX 244
           +F L     +D YS W +E+ KIS+DP F+ I  D +RE++FE+W C G +         
Sbjct: 75  FFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQW-CYGKLHSREEETTQ 133

Query: 245 XXXXXLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQ 304
                  P  YH L++++    +   TI++DI++    + +Q  I + +SK EQE+F ++
Sbjct: 134 PQLALALP--YHDLAEMICCFDIQSNTIYKDIRKANKKMVRQ--IDEKISKNEQEKFGTK 189

Query: 305 LLFYYK 310
           LL   K
Sbjct: 190 LLGILK 195

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 7/66 (10%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
          S+W+E +  +G+ YY+NT T ++TW+ P     Q EL ++        N W      +G 
Sbjct: 2  SIWKEAKDASGRIYYYNTLTKKSTWEKPKELISQEELLLRE-------NGWKAAKTADGK 54

Query: 63 KFYLNP 68
           +Y NP
Sbjct: 55 VYYYNP 60

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSP 30
          W+  +  +GK YY+N TT ET+W  P
Sbjct: 45 WKAAKTADGKVYYYNPTTRETSWTIP 70

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN 60
          M  +W+E +  NG+ YY+N+ TGE+ W+ P     ++E  +K        N W++     
Sbjct: 1  MSDIWKEAKDNNGRVYYYNSKTGESRWEKPVEAPSKQEQLLKK-------NGWSIGKSKA 53

Query: 61 GAKFYLN 67
          G  +Y N
Sbjct: 54 GKIYYYN 60

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 2  KSVWREYRAPNGKKYYHNTTTGETTWDSP 30
          K+ W   ++  GK YY+NT TGE++W+ P
Sbjct: 43 KNGWSIGKSKAGKIYYYNTKTGESSWELP 71

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 7/66 (10%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
          S+W+E +  NG+ YY+N+ T ++TW+ P      +EL  + + ++   N W       G 
Sbjct: 2  SIWKEAKDANGRVYYYNSLTKKSTWEKP------KELVSEEEQLLR-ENGWRAAKTKEGK 54

Query: 63 KFYLNP 68
           +Y NP
Sbjct: 55 VYYYNP 60

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSP 30
          WR  +   GK YY+N  T ET+W  P
Sbjct: 45 WRAAKTKEGKVYYYNPATRETSWTIP 70

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGAKF 64
          W E   P G+ YY+N+ +GETTWD P     + EL ++        + W       G  +
Sbjct: 4  WNEAHDPEGRVYYYNSESGETTWDKPRELYSELELQLEK-------HGWKTGETEGGKLY 56

Query: 65 YLN 67
          Y N
Sbjct: 57 YYN 59

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 23/41 (56%)

Query: 2  KSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIK 42
          K  W+      GK YY+N ++GE+ W+ P     ++E +++
Sbjct: 42 KHGWKTGETEGGKLYYYNESSGESRWEVPTFESDEKEEAVE 82

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 2  KSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNG 61
          +S+W+E +  +G+ YY+N  TGE+ W+ P      REL +  Q +I   + W     ++G
Sbjct: 4  ESLWKEAKDTSGRIYYYNAKTGESKWEKP------REL-LSEQELILAKHGWKSSKTSDG 56

Query: 62 AKFYLN 67
            +Y N
Sbjct: 57 KLYYYN 62

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
          S W+E     G+ YY+N  +GETTWD P     Q EL ++        + W     + G 
Sbjct: 2  SSWKEANDAEGRVYYYNADSGETTWDKPRELFTQLELKLEK-------HGWKTGKTDEGQ 54

Query: 63 KFYLNPD 69
           +Y N +
Sbjct: 55 VYYYNQE 61

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
           (REAL)
          Length = 583

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 50/127 (39%), Gaps = 7/127 (5%)

Query: 3   SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
           S W+E +  NG+ YY+NT T ++TW+     KP + +S + Q +    N W       G 
Sbjct: 2   SNWKEAKDANGRVYYYNTLTKKSTWE-----KPTQLVSKQEQLLQE--NGWRAAKTAEGK 54

Query: 63  KFYLNPDGDPVXXXXXXXXXXXXXXVDREKLILLIGVARGYHCTSGDKVYNSVLEEISFL 122
            +Y N                      +E  ++L   A  Y   S D+    + + I   
Sbjct: 55  VYYYNTTTRKTSWAIPIFEKKTEDIAKKEPDVILSAQASKYRTVSTDEEKKELRQNIKEE 114

Query: 123 KDDLAND 129
           +   +ND
Sbjct: 115 ESQYSND 121

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
          S W+E +  NG+ YY+NT T ++ W+ P     Q+E  ++        N W       G 
Sbjct: 2  SNWKEAKDANGRVYYYNTLTKKSIWEKPEELVSQQEQLLQE-------NGWKAAKTAEGK 54

Query: 63 KFYLNP 68
           +Y NP
Sbjct: 55 IYYYNP 60

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGAKF 64
          WR  +  NG+ YY+N  T E+ WD P + +         + ++  +  W   + N G  +
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNNDDSDKMLLEQI-GWKSNVTNEGKVY 69

Query: 65 YLN 67
          Y N
Sbjct: 70 YYN 72

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 7/67 (10%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNN 60
          M   W++    NGK YY+NT T E+ WD P       +  ++          WN+     
Sbjct: 1  MAGQWKKATDSNGKVYYYNTVTKESRWDKPVEDTTDLKQKLRDA-------GWNVAKTKE 53

Query: 61 GAKFYLN 67
          G  +Y N
Sbjct: 54 GKVYYYN 60

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSPYTRKP 35
          W   +   GK YY+N  T E+ WD+P   K 
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNPLAEKA 76

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 9/65 (13%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
          S+WR  +  NGK YY+NT TG + W+ P          +         + W +    +G 
Sbjct: 5  SLWRTAKDSNGKVYYYNTKTGVSQWEKP---------GVSADIETLKQHGWGVARTKDGK 55

Query: 63 KFYLN 67
           +Y N
Sbjct: 56 LYYYN 60

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSP 30
          W   R  +GK YY+N++TGE+ W++P
Sbjct: 46 WGVARTKDGKLYYYNSSTGESRWEAP 71

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa]
          {ON} Anc_2.649 YKL012W
          Length = 658

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 14/83 (16%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTR-------KPQRELSIKPQYV---IPL- 49
          M++ W++ + P G+ YY+N  T E+ WD P +          ++++S+K   +   I L 
Sbjct: 1  MENDWKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLE 60

Query: 50 ---LNAWNLVICNNGAKFYLNPD 69
             L+ W       G  +Y N D
Sbjct: 61 FLKLHGWRTAQTKEGRIYYYNVD 83

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSP 30
          WR  +   G+ YY+N  T E+ WD P
Sbjct: 67 WRTAQTKEGRIYYYNVDTKESRWDPP 92

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGAKF 64
          W+E   P G+ YY+N + GETTW  P      +E+ +    ++ L   W +    +G  +
Sbjct: 4  WKETIDPEGRVYYYN-SKGETTWHKP------KEMEVVLDAIL-LKQGWKVASTEDGKVY 55

Query: 65 YLNPD 69
          Y N +
Sbjct: 56 YYNKN 60

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRE 38
          +K  W+     +GK YY+N  T E+TW+ P  R+ +++
Sbjct: 40 LKQGWKVASTEDGKVYYYNKNTNESTWELPVVREEKKD 77

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 2  KSVWREYRAPNGKKYYHNTTTGETTWDSP 30
          ++ W+E +   G+ YY+NT T ETTW  P
Sbjct: 3  EATWKEAKDLQGRIYYYNTATSETTWTKP 31

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 11/64 (17%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSPYT-RKPQRELSIKPQYVIPLLNAWNLVICNNGAK 63
          W+  + P G+ YY+NT T ++TW+ P    +P +          P  N W      +G  
Sbjct: 4  WKAAKDPKGRIYYYNTVTKKSTWEKPKNFAEPDQ----------PSANDWKTGKTKDGKT 53

Query: 64 FYLN 67
          +Y N
Sbjct: 54 YYYN 57

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 8/65 (12%)

Query: 5  WREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGAKF 64
          W+E + P G+ YY+N  TG+TTW+ P     + E  +       L   W   +  +G  +
Sbjct: 3  WQETKDPQGRVYYYN-DTGQTTWEKPEELFTEFERKL-------LKYGWKTALAEDGRVY 54

Query: 65 YLNPD 69
          Y   D
Sbjct: 55 YYKSD 59

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSP 30
          +K  W+   A +G+ YY+ + TGETTW+ P
Sbjct: 39 LKYGWKTALAEDGRVYYYKSDTGETTWNVP 68

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLNAWNLVICNNGA 62
          S W+E     G+ YY+N   GE+ W+ P      +EL  + + V+ L + W       G 
Sbjct: 5  SEWKEALDDKGRTYYYNAKNGESRWEKP------QELFTEEELVL-LKHGWKSSRTAEGK 57

Query: 63 KFYLN 67
           +Y N
Sbjct: 58 IYYYN 62

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSP 30
          +K  W+  R   GK YY+N+ T E+ W+ P
Sbjct: 44 LKHGWKSSRTAEGKIYYYNSITKESRWEKP 73

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 1  MKSVWREYRAPNGKKYYHNTTTGETTWDSP 30
          +K  W+  +  +GK Y++N+ TG+++W  P
Sbjct: 62 VKGTWKSAKTKDGKVYFYNSATGKSSWTLP 91

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
           {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 15/24 (62%)

Query: 5   WREYRAPNGKKYYHNTTTGETTWD 28
           W+     +GK YY+N  TGE+ WD
Sbjct: 82  WKSNVTADGKTYYYNLKTGESRWD 105

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 12/67 (17%)

Query: 3  SVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQRELSIKPQYVIPLLN--AWNLVICNN 60
          S W+E +   G+ YY+N + GET+W+ P         +  P  + P L    W +    +
Sbjct: 2  SDWKEAQDSTGRVYYYN-SKGETSWNKP---------NDTPVELEPRLEECGWKVATTED 51

Query: 61 GAKFYLN 67
          G  +Y N
Sbjct: 52 GNVYYYN 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,437,066
Number of extensions: 1329571
Number of successful extensions: 3565
Number of sequences better than 10.0: 43
Number of HSP's gapped: 3553
Number of HSP's successfully gapped: 83
Length of query: 388
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 277
Effective length of database: 40,753,473
Effective search space: 11288712021
Effective search space used: 11288712021
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)