Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079603.496ON1771779491e-133
YPR151C (SUE1)3.496ON2061464084e-50
Suva_16.4793.496ON2121494051e-49
Smik_16.4033.496ON2031524033e-49
Skud_16.4453.496ON2151383982e-48
TPHA0D033003.496ON1961463676e-44
Kpol_1017.43.496ON1841603613e-43
NDAI0B058903.496ON2781493528e-41
SAKL0F02618g3.496ON2531463431e-39
ZYRO0D09812g3.496ON1851683267e-38
Kwal_55.212483.496ON2221383131e-35
KLLA0E03983g3.496ON1911423051e-34
KLTH0F14938g3.496ON2291413071e-34
CAGL0L08426g3.496ON1401392662e-29
NCAS0F035703.496ON2301412419e-25
TDEL0D056403.496ON1241372286e-24
TBLA0D029403.496ON71471681e-15
Ecym_12333.496ON87901631e-14
KAFR0G037103.496ON79691455e-12
ZYRO0F07480g8.682ON2361321395e-10
AFR315C3.496ON77641281e-09
Kpol_1013.98.682ON2611431352e-09
NCAS0C013108.682ON2571381317e-09
TPHA0D012908.682ON2181331308e-09
YPL159C (PET20)8.682ON2531531282e-08
SAKL0H06380g8.682ON2191511272e-08
Suva_16.1518.682ON2531651246e-08
Smik_6.3568.682ON2531371238e-08
Skud_16.1238.682ON2551651193e-07
TDEL0A062708.682ON2421491184e-07
KLLA0D06061g8.682ON2491341184e-07
TBLA0B038008.682ON3241311186e-07
Kwal_26.88288.682ON2231641132e-06
CAGL0M02101g8.682ON2671341097e-06
Kpol_1072.128.682ON2221431062e-05
KNAG0J017608.682ON2581351052e-05
NDAI0K013208.682ON2581361035e-05
KLTH0D11396g8.682ON2251371009e-05
TDEL0E007103.62ON4761521011e-04
KLLA0A07447g3.62ON486147920.001
TPHA0G015708.682ON255135910.001
Smik_14.363.62ON524166830.021
Suva_14.443.62ON525155830.022
Skud_14.423.62ON524147800.049
Kpol_1066.443.62ON479145780.092
YNL295W3.62ON524174770.12
Ecym_23908.682ON227137750.17
ZYRO0C02244g3.62ON460185740.29
KAFR0H023808.682ON22027690.95
TBLA0B085103.62ON501146701.1
TBLA0B027208.798ON50237701.2
NCAS0A099403.62ON49428682.0
CAGL0M03685g3.62ON493145672.4
Kwal_23.52773.62ON470156662.8
TPHA0P012603.62ON494153655.0
TPHA0I006008.798ON50628645.4
Kpol_1020.213.58ON64021638.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07960
         (177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...   370   e-133
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...   161   4e-50
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...   160   1e-49
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...   159   3e-49
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...   157   2e-48
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...   145   6e-44
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...   143   3e-43
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...   140   8e-41
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...   136   1e-39
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...   130   7e-38
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...   125   1e-35
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...   122   1e-34
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...   122   1e-34
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...   107   2e-29
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    97   9e-25
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    92   6e-24
TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...    69   1e-15
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    67   1e-14
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    60   5e-12
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    58   5e-10
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    54   1e-09
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    57   2e-09
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    55   7e-09
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    55   8e-09
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    54   2e-08
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    54   2e-08
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    52   6e-08
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    52   8e-08
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    50   3e-07
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    50   4e-07
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    50   4e-07
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    50   6e-07
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    48   2e-06
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    47   7e-06
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    45   2e-05
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    45   2e-05
NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {O...    44   5e-05
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    43   9e-05
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    44   1e-04
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    40   0.001
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    40   0.001
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    37   0.021
Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W (...    37   0.022
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    35   0.049
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    35   0.092
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    34   0.12 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    33   0.17 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    33   0.29 
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    31   0.95 
TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa] ...    32   1.1  
TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.7...    32   1.2  
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    31   2.0  
CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa] ...    30   2.4  
Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa] ...    30   2.8  
TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {...    30   5.0  
TPHA0I00600 Chr9 (122877..124397) [1521 bp, 506 aa] {ON} Anc_8.7...    29   5.4  
Kpol_1020.21 s1020 complement(47536..49458) [1923 bp, 640 aa] {O...    29   8.0  

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {ON}
           Anc_3.496 YPR151C
          Length = 177

 Score =  370 bits (949), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 177/177 (100%), Positives = 177/177 (100%)

Query: 1   MKQSGVGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRP 60
           MKQSGVGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRP
Sbjct: 1   MKQSGVGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRP 60

Query: 61  VMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNG 120
           VMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNG
Sbjct: 61  VMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNG 120

Query: 121 TWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFDLLLGVKATQKK 177
           TWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFDLLLGVKATQKK
Sbjct: 121 TWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFDLLLGVKATQKK 177

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score =  161 bits (408), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 97/146 (66%), Gaps = 1/146 (0%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSN-KLMAISHPEHDTEGT 90
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+   K +      ++    
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRKSLQTLLTMNEKTNA 114

Query: 91  EGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPE 150
           E    D +     LFG    GGI + G NGTWKY P +P ++LPFNWWS SS+ ME +PE
Sbjct: 115 EAKTIDEKKHKNILFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYFPE 174

Query: 151 WSSVPKHVVKGLKPFDLLLGVKATQK 176
           W +VP ++++ LKPFD  L ++ T K
Sbjct: 175 WKNVPPYMMRKLKPFDKALQMRLTHK 200

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score =  160 bits (405), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 100/149 (67%), Gaps = 13/149 (8%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNK------LMAISHPEH 85
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+  K      L +   P  
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLASDEKPAT 121

Query: 86  DTEGTEGT-HRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLA 144
           + + TE + H++        FG    GGI + G NGTWKY P +P ++LP+NWWS SS+ 
Sbjct: 122 EAKATEKSEHKNV------FFGERGTGGIMSGGVNGTWKYNPTVPNELLPYNWWSTSSMG 175

Query: 145 MEVYPEWSSVPKHVVKGLKPFDLLLGVKA 173
           ME +PEW +VP ++++ LKPFD  L ++A
Sbjct: 176 MEYFPEWKNVPSYMMRKLKPFDRALQLQA 204

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {ON}
           YPR151C (REAL)
          Length = 203

 Score =  159 bits (403), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 100/152 (65%), Gaps = 13/152 (8%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNK------LMAISHPEH 85
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+  K      L A   P  
Sbjct: 53  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKKSLQMLLTADEAPIT 112

Query: 86  DTEGTEGT-HRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLA 144
           + + TE + H++       LFG    GGI + G NGTWKY P +P ++LPFNWWS SS+ 
Sbjct: 113 EAKTTEKSKHKNI------LFGERGTGGIMSGGVNGTWKYNPTVPNELLPFNWWSTSSMG 166

Query: 145 MEVYPEWSSVPKHVVKGLKPFDLLLGVKATQK 176
           ME +PEW ++P ++ + LKPFD  L ++   K
Sbjct: 167 MEYFPEWRNIPSYMTRKLKPFDKPLQIQLKHK 198

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score =  157 bits (398), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 95/138 (68%), Gaps = 5/138 (3%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNK---LMAISHPEHDTE 88
           FR LPKVP T+YLE REL +DILYSGYRPVMYPV+ENPLFR+  +    M ++  E    
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRDSLQMLLAPDEAPAA 121

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148
             + T +D       LFG    GGI++ G NGTWKY P +P ++LPFNWWS SS+ ME +
Sbjct: 122 EAKATEKDMH--KNVLFGERGTGGISSGGVNGTWKYNPTVPNELLPFNWWSTSSMGMEYF 179

Query: 149 PEWSSVPKHVVKGLKPFD 166
           PEW +VP ++++ LKPFD
Sbjct: 180 PEWKNVPSYMMRKLKPFD 197

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
           Anc_3.496 YPR151C
          Length = 196

 Score =  145 bits (367), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 71/146 (48%), Positives = 95/146 (65%), Gaps = 14/146 (9%)

Query: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89
           S+F+ LP+VP T+YLE+ +L  DIL+SGYRP+ YPV+ENPLFRN NK        +D   
Sbjct: 49  SIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRNINKY------NNDFLS 102

Query: 90  TEGTHRDSQTV----NTELF----GNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSAS 141
           T+ T   +  V    N E F    G    GGI + G NGTWKY P +P+ +LP+NWWS S
Sbjct: 103 TQETQEKNNPVLPQKNHEAFSVLTGEKGTGGIMSGGVNGTWKYNPTVPENLLPYNWWSTS 162

Query: 142 SLAMEVYPEWSSVPKHVVKGLKPFDL 167
            + ME YPEW++VP+  +K LKPF++
Sbjct: 163 IMGMEYYPEWNNVPRRFLKTLKPFEV 188

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
           (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score =  143 bits (361), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 73/160 (45%), Positives = 97/160 (60%), Gaps = 23/160 (14%)

Query: 25  NGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRN----------- 73
           + D   +FR LP+VP T++LE+  L  DIL+SGYRP+ YPV+ENPLFRN           
Sbjct: 29  SSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRNTGNTKNIFGQD 88

Query: 74  -----SNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKI 128
                SN   A    EHD   T      SQ  NT L G+   GGI + G NGTW++ P++
Sbjct: 89  LVNAESNSNDASLLQEHDKNIT------SQEFNT-LSGDRGTGGIKSGGVNGTWRFNPRV 141

Query: 129 PQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFDLL 168
           P K+LP++WWS S + ME YPEW ++P+ VVK LKP+ L+
Sbjct: 142 PSKLLPYSWWSTSIMGMEYYPEWKNIPRKVVKDLKPYQLV 181

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score =  140 bits (352), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 74/149 (49%), Positives = 97/149 (65%), Gaps = 1/149 (0%)

Query: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNS-NKLMAISHPEHDTE 88
           ++FR +PKVPMTKYLET+EL++D+LYSGYRP+MYPV+ENPLFR +  K  + S P   T 
Sbjct: 127 NIFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFRLTLKKNSSSSFPFSTTS 186

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148
            +    +  Q    +   ++  GGI T G NGTW+Y+P+IP  +LP   WS S + ME Y
Sbjct: 187 SSSSEKKKPQQEQMKKHYDDEYGGIMTGGINGTWRYSPRIPNNLLPNKIWSMSIMGMEYY 246

Query: 149 PEWSSVPKHVVKGLKPFDLLLGVKATQKK 177
           PEW  VP ++VK LKPFD   G     KK
Sbjct: 247 PEWKGVPFNIVKNLKPFDKSRGTVEVMKK 275

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar to
           uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
           Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 253

 Score =  136 bits (343), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 93/146 (63%), Gaps = 3/146 (2%)

Query: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFR--NSNKLMAISHPEHDT 87
            +FR LPKVP T++LE REL +DIL+SGYRPV YPV+ENP F      K +A        
Sbjct: 21  DIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRKGLAGETSAKKE 80

Query: 88  EGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEV 147
              E    + +  +  + G    GGI + G NGTW+Y P+IP K+LP+N WS+S++AME 
Sbjct: 81  YKNEAERENEKEEHNVMAGPRGTGGIVSGGVNGTWRYNPRIPTKLLPYNLWSSSTMAMEY 140

Query: 148 YPEWSSVPKHVVKGLKPFDL-LLGVK 172
           YPEW +VPK +   LKPFD+ ++ VK
Sbjct: 141 YPEWLNVPKTIANKLKPFDMPIVSVK 166

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 185

 Score =  130 bits (326), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 72/168 (42%), Positives = 106/168 (63%), Gaps = 10/168 (5%)

Query: 6   VGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPV 65
           + +R  ST    S  R   + D   +FR +P+VP T++LE+REL +DIL+SGYRPVMYPV
Sbjct: 2   MSKRLFSTATIRSFKRKCCSSD---IFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPV 58

Query: 66  RENPLFRNSNK---LMAISHPEHDTEGTEGTHRDSQTVNTELF----GNNNCGGINTLGC 118
           +ENPLF+   +   L       H++   +G  ++ +  + E +    G   CGGI + G 
Sbjct: 59  KENPLFKERTRNGELTDELQSRHNSGLRQGRTQEEEKESGEEYSVIAGPRGCGGIASGGA 118

Query: 119 NGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPFD 166
           +GTW+   K+P K+LP++WWS +S+ ME +PEW  VP+HVV+ LKPFD
Sbjct: 119 SGTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVRKLKPFD 166

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {ON}
           YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score =  125 bits (313), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 6/138 (4%)

Query: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSN-KLMAI-SHPEHDTE 88
           +FR LPKVP T+YLE  EL +DILYSGYRPV+YPV+ENPLF+ +  K   +   P  DT 
Sbjct: 22  IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKETGWKTQRLREEPGSDTA 81

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148
            T       ++    + G    GGI + G NGTW+Y P+IP K+LPF+ WS++S+AME +
Sbjct: 82  LTAA----KESSKNAMAGPQGTGGIGSGGVNGTWRYNPRIPSKLLPFSLWSSTSMAMEYH 137

Query: 149 PEWSSVPKHVVKGLKPFD 166
           PEW +VP+ VV  L+PF+
Sbjct: 138 PEWLAVPRTVVNKLRPFN 155

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar to
           gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g and
           weakly similar to YPR151C uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 191

 Score =  122 bits (305), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 88/142 (61%), Gaps = 9/142 (6%)

Query: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGT 90
           M+R+LP+VP T++L  +EL  DIL+SGYRP++ P+R+NPLF+   K + +   E +  G 
Sbjct: 11  MYRQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQAKVKELEV---EREKNGG 67

Query: 91  EGTHRDSQTVNTE-----LFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAM 145
            G  +      +E     + G N  GGI + G NGTW+Y P+IP K+L    WS+S++ M
Sbjct: 68  -GKLKSKAAFASEPEHPFMAGPNGTGGILSGGVNGTWRYNPRIPNKLLQSALWSSSAMGM 126

Query: 146 EVYPEWSSVPKHVVKGLKPFDL 167
           E YPEW+ VP  V   LKP+ L
Sbjct: 127 EFYPEWNDVPNKVSASLKPYQL 148

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
           {ON} weakly similar to uniprot|Q06524 Saccharomyces
           cerevisiae YPR151C SUE1 Mitochondrial protein required
           for degradation of unstable forms of cytochrome c
          Length = 229

 Score =  122 bits (307), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 67/141 (47%), Positives = 86/141 (60%), Gaps = 12/141 (8%)

Query: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGT 90
           +FR LPKVP T+YLE  EL +DILYSGYRPV+YPV+ENPLF+ +              G 
Sbjct: 22  IFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAG------WKTQRLRGE 75

Query: 91  EGTHRDSQTVNTELFGNNNCGGINTLGCNG-----TWKYAPKIPQKMLPFNWWSASSLAM 145
            G  R S TV      N   G + T G        TW+Y P+IP K+LP+N WS +S+AM
Sbjct: 76  RGA-RKSSTVPQSSEMNAMAGPLGTGGIGSGGVNGTWRYNPRIPSKLLPYNLWSCTSMAM 134

Query: 146 EVYPEWSSVPKHVVKGLKPFD 166
           E +PEW +VP+ VV  L+PF+
Sbjct: 135 EYHPEWLAVPRTVVNKLRPFE 155

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
           to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score =  107 bits (266), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 10/139 (7%)

Query: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89
            +FR+LPKVPMT+YLE R L++D+LY+GYRP++YP+RENPL  +SN  +  +H  +    
Sbjct: 6   EIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSN--VRETH-YYGESS 62

Query: 90  TEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYP 149
            E   +D + VN  L+G    GGI+T+G     + A     K+      S S + ME YP
Sbjct: 63  NELQKKDEEPVNELLYGPEGRGGISTMGVR---RMADPSKVKL----GLSYSIMGMEYYP 115

Query: 150 EWSSVPKHVVKGLKPFDLL 168
           EW  VP+ VVK +KP++++
Sbjct: 116 EWEKVPRDVVKRIKPYEVM 134

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 97.4 bits (241), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 79/141 (56%), Gaps = 35/141 (24%)

Query: 30  SMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEG 89
           ++FR+LPKVPMT+YLET++L+K+IL++GY+P+MYPVRENPLF+       +   + D + 
Sbjct: 116 NIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK-------LKIKQEDAKR 168

Query: 90  TEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYP 149
             G  + +                  LG + + KY             WS S L ++ YP
Sbjct: 169 ENGNEKRA------------------LGSSVSHKYK----------GIWSTSILGLQDYP 200

Query: 150 EWSSVPKHVVKGLKPFDLLLG 170
           EW++VP + +K LKPFD  L 
Sbjct: 201 EWNNVPWNNIKNLKPFDEELA 221

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {ON}
           Anc_3.496 YPR151C
          Length = 124

 Score = 92.4 bits (228), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 70/137 (51%), Gaps = 47/137 (34%)

Query: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGT 90
           +FR LP+VP T++LET+ L+ DIL+SGYRPVMYPVRENPLF                   
Sbjct: 30  LFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLF------------------- 70

Query: 91  EGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLP-FNWWSASSLAMEVYP 149
                                        GT   AP   +  LP ++ WS +++ +E +P
Sbjct: 71  ---------------------------GRGTKTEAPASLESNLPRYDLWSTTTMGLERFP 103

Query: 150 EWSSVPKHVVKGLKPFD 166
           EWS+VP+ VV+ L+PFD
Sbjct: 104 EWSNVPREVVRKLRPFD 120

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score = 69.3 bits (168), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 37/47 (78%)

Query: 27 DGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRN 73
          + +S+ R LP+VP T+YLE   L  DI +SGYRPVMYPV+ENPLFRN
Sbjct: 11 NSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
           Ashbya gossypii AFR315C
          Length = 87

 Score = 67.4 bits (163), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 11/90 (12%)

Query: 31  MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGT 90
           + R LP+VP T+YL   EL  DI +SGYRP++YPV++NPLFR+S  ++       ++   
Sbjct: 9   ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRSSKNIL-------ESSIG 61

Query: 91  EGTHRDSQTVNTELFGNNNCGGINTLGCNG 120
           +G  RD    N      N C G +++  +G
Sbjct: 62  KGLGRDKDKGNA----GNGCSGASSVRGHG 87

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 60.5 bits (145), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 6/69 (8%)

Query: 28 GRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDT 87
          G  + + LP+VP TKYL+  +L  DILY+GYRPV+YP++ENPL    N  +A      + 
Sbjct: 4  GSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGELA------NE 57

Query: 88 EGTEGTHRD 96
          + T+   RD
Sbjct: 58 QFTDIQQRD 66

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 58.2 bits (139), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 39/132 (29%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTH 94
           LP+VP T YL  R+++  ILYSGYRP         LF N ++L               T 
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRP---------LFLNPDEL--------------KTS 124

Query: 95  RDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSV 154
           +D         GN N G          +++A K+ +++   + W++S+   E+YPEW  V
Sbjct: 125 QDG--------GNANNGA-------RLYEFAMKL-EELGEQSLWTSSATGQEIYPEWDYV 168

Query: 155 PKHVVKGLKPFD 166
           P  V + LKPF+
Sbjct: 169 PMEVQRKLKPFN 180

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 53.9 bits (128), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 31 MFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMA-ISHPEHDTEG 89
           FR LP+VP T++L   ++  DIL+S +RP+ YPV +NPL R    L++ ++ P   T+ 
Sbjct: 6  FFRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIRRRPALLSFLADPAESTKR 65

Query: 90 TEGT 93
           +G+
Sbjct: 66 DDGS 69

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 60/143 (41%), Gaps = 41/143 (28%)

Query: 24  YNGDGRSM-FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISH 82
           ++GD   + +  LPKVP T+ L  RE+    LYSGYRP+                     
Sbjct: 100 FSGDNTKLDYSWLPKVPSTENLNHREIRTSALYSGYRPIY-------------------- 139

Query: 83  PEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASS 142
                            +N++  G N   G    G N T+    +I  K+   + W +S+
Sbjct: 140 -----------------INSKGSGKNKLSGTMKNGVNSTFY---EIAMKLENPSPWMSSA 179

Query: 143 LAMEVYPEWSSVPKHVVKGLKPF 165
             ME+Y EW  VP  V+K LKPF
Sbjct: 180 TGMELYSEWDHVPLDVLKDLKPF 202

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 60/138 (43%), Gaps = 30/138 (21%)

Query: 29  RSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTE 88
           R  +  LPKV     L   E++ DILYSGYRP         LF N   L           
Sbjct: 84  RFDYSTLPKVEPITNLRHNEISTDILYSGYRP---------LFLNFKDL----------- 123

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWW-SASSLAMEV 147
             E + R ++      FGN+N   +  +        +P+        N+W S S+  MEV
Sbjct: 124 --ENSSRKAE------FGNSNNSTLYEIAMKLD-DLSPEAISGSTSSNFWHSTSATGMEV 174

Query: 148 YPEWSSVPKHVVKGLKPF 165
           + EW +VP  ++K LKPF
Sbjct: 175 FDEWDNVPNSILKNLKPF 192

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 54.7 bits (130), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 57/133 (42%), Gaps = 37/133 (27%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTH 94
           LPKVP T  +  RE+  + LYSGYRP+    ++  L  + N                   
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLLGDVN------------------- 135

Query: 95  RDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSV 154
             +Q  N+ ++                 ++A K+ +   P + W  S+  +E Y EW  V
Sbjct: 136 STAQDANSSIY-----------------EFAMKLNELSEP-SPWMMSATGLESYSEWDYV 177

Query: 155 PKHVVKGLKPFDL 167
           P  V+K LKP+DL
Sbjct: 178 PSKVIKKLKPYDL 190

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 62/153 (40%), Gaps = 43/153 (28%)

Query: 13  TVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFR 72
           T K+ S  R  +    RS F  LP+VP T +L+  ++  ++LYSGYRP            
Sbjct: 81  TKKEHSDVRGSHLKKKRSDFSWLPRVPSTSHLKQSDMTTNVLYSGYRP------------ 128

Query: 73  NSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKM 132
                                          LF N N   +     +  +++A K+    
Sbjct: 129 -------------------------------LFINPNDPKLKEDTGSTLYEFAMKLEDLN 157

Query: 133 LPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPF 165
            P + W +S+  +E + EW ++P  ++K LKPF
Sbjct: 158 EPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 62/151 (41%), Gaps = 57/151 (37%)

Query: 20  SRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPV-MYPV----RENPLFRNS 74
           +++E +G  R  +  LPK P T++L+ RE++ D+ YSGYRP+ + P      E+ L+  +
Sbjct: 68  TQVELSGKKRHDYSWLPKAPSTEHLKLREISTDVFYSGYRPIFLNPASPKESESTLYEFA 127

Query: 75  NKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLP 134
            KL A+  P                                            IP     
Sbjct: 128 MKLEALGDP--------------------------------------------IP----- 138

Query: 135 FNWWSASSLAMEVYPEWSSVPKHVVKGLKPF 165
              W +S+   E Y EW +VP  V+K LKPF
Sbjct: 139 ---WVSSATGTEFYGEWDNVPTEVIKKLKPF 166

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 70/165 (42%), Gaps = 48/165 (29%)

Query: 1   MKQSGVGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRP 60
           ++QS    +  ST  + S SR       R  F  LP+VP T +L+  ++  ++LYSGYRP
Sbjct: 74  IEQSEAIAKTDSTNIRASHSR-----KKRRDFSWLPRVPSTSHLKHSDMTTNVLYSGYRP 128

Query: 61  VMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNG 120
           +      NP   N  KL      + DT  T                              
Sbjct: 129 IFI----NP---NDPKL------KEDTGST------------------------------ 145

Query: 121 TWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPF 165
            +++A K+     P + W +S+  +E + EW ++P  ++K LKPF
Sbjct: 146 LYEFAMKLDDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 52.0 bits (123), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 56/137 (40%), Gaps = 43/137 (31%)

Query: 29  RSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTE 88
           RS F  LPKVP T +L+  ++  ++LYSGYRP                            
Sbjct: 97  RSDFSWLPKVPSTSHLKQSDMTTNVLYSGYRP---------------------------- 128

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148
                          LF N N   +     +  +++A K+     P + W +S+  +E +
Sbjct: 129 ---------------LFINPNDPKLKEDTGSTLYEFAMKLEDLNEPLSPWISSATGLEFF 173

Query: 149 PEWSSVPKHVVKGLKPF 165
            EW ++P  +++ LKPF
Sbjct: 174 SEWDNIPSELLRNLKPF 190

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 65/165 (39%), Gaps = 48/165 (29%)

Query: 1   MKQSGVGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRP 60
           +KQS    +  ST  + S  R       R  F  LP+VP T +L+  ++  ++LYSGYRP
Sbjct: 74  IKQSEQIAKNDSTSIRASHPR-----KKRRDFSWLPRVPSTSHLKHTDMTTNVLYSGYRP 128

Query: 61  VMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNG 120
                                                      LF N N   +     + 
Sbjct: 129 -------------------------------------------LFINPNDPKLKEDTGST 145

Query: 121 TWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPF 165
            +++A K+     P + W +S+  +E + EW ++P  ++K LKPF
Sbjct: 146 LYEFAMKLEDLNEPLSPWISSATGLEFFSEWENIPSELLKNLKPF 190

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 66/149 (44%), Gaps = 47/149 (31%)

Query: 22  LEYNGDGRSMFRR----LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKL 77
           +E +G GR   R     LP+VP T  L+ R+++  +LYSGYRP         LF N    
Sbjct: 79  VEISGRGRKQQRHDYSWLPRVPSTGNLKPRDMSMKVLYSGYRP---------LFIN---- 125

Query: 78  MAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGT-WKYAPKIPQKMLPFN 136
                P+     +EG+                       G  GT +++A K+ +++   +
Sbjct: 126 -----PDEIKTSSEGS-----------------------GTGGTLYEFAMKL-EELGDQS 156

Query: 137 WWSASSLAMEVYPEWSSVPKHVVKGLKPF 165
            W  S+  +E Y EW S+P  + K LKPF
Sbjct: 157 PWVTSATGLEYYREWDSIPGELQKKLKPF 185

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 52/134 (38%), Gaps = 55/134 (41%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMY---PVRENPLFRNSNKLMAISHPEHDTEGTE 91
           LP+VP T+++   E   D+LYSGYRP++      +EN L + + KL  +S P        
Sbjct: 112 LPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQFAMKLEKLSEP-------- 163

Query: 92  GTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEW 151
                                               +P        W +S+   E + EW
Sbjct: 164 ------------------------------------VP--------WVSSATGQEFFSEW 179

Query: 152 SSVPKHVVKGLKPF 165
            +VP  ++K LKPF
Sbjct: 180 DNVPSEIIKDLKPF 193

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 35/131 (26%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTH 94
           LPKVP  K L+ R++  ++LYSGYRP+    +            A++ P +  +     +
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPLSIDFK------------ALNDPTNIYDPYSSPN 214

Query: 95  RDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSV 154
                                 G +  +++A ++ Q +     W +S+  +EVY EW S+
Sbjct: 215 ----------------------GSSTLYEFAMQL-QSLSEIFPWMSSAAGLEVYSEWDSI 251

Query: 155 PKHVVKGLKPF 165
           P  V+K LKP 
Sbjct: 252 PIEVLKKLKPL 262

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 65/164 (39%), Gaps = 52/164 (31%)

Query: 6   VGRRALSTVKKGSGSRLEYNGDGRSM---FRRLPKVPMTKYLETRELAKDILYSGYRP-V 61
           VG+ A    ++ S  R+     G+ +   F  LPK P T +L+ R+++  +LYSGYRP V
Sbjct: 53  VGQSAEPASEQSSKKRVAVELKGKQLKTDFSWLPKAPSTDHLKQRDVSTTLLYSGYRPFV 112

Query: 62  MYPVRENPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGT 121
           + P                     D + T+ T                            
Sbjct: 113 LAPA--------------------DQKQTDST---------------------------L 125

Query: 122 WKYAPKIPQKMLPFNWWSASSLAMEVYPEWSSVPKHVVKGLKPF 165
           +++A K+     P  W S S+   E Y EW  VP  V+K L+PF
Sbjct: 126 YEFAMKLESLGDPLPWIS-SATGTEFYGEWDGVPADVIKQLRPF 168

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 55/134 (41%), Gaps = 45/134 (33%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTE 91
           +  LP+V      + + ++ ++LYSGYRP+ + V                 P++  EG  
Sbjct: 113 YSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDV----------------EPKNSQEG-- 154

Query: 92  GTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPEW 151
                                  TL     +++A K+ +     + W +S+   E+Y EW
Sbjct: 155 ----------------------KTL-----YEFAMKLEEFQEAMSPWVSSATGSEMYAEW 187

Query: 152 SSVPKHVVKGLKPF 165
            +VP  V+K LKPF
Sbjct: 188 DNVPGDVIKDLKPF 201

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 59/143 (41%), Gaps = 40/143 (27%)

Query: 23  EYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISH 82
           + N D    +  LPKVP  K L  +++  DI YSG+RP+                +  + 
Sbjct: 85  QLNNDLVVDYSWLPKVPSNKRLTHQDITTDIFYSGFRPLS---------------IDPTE 129

Query: 83  PEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASS 142
            E+  E +   +  S T+++ +       G N++                     W++S+
Sbjct: 130 LENKDEDSSTWYEVSLTLDSPV----PPSGHNSI---------------------WTSSA 164

Query: 143 LAMEVYPEWSSVPKHVVKGLKPF 165
             ME Y EW SVP+ V+  L PF
Sbjct: 165 TGMERYREWHSVPEEVINSLTPF 187

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 53/135 (39%), Gaps = 34/135 (25%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTE 91
           +  LP VP T+++E  ++  ++LYSGYR         PLF +S  L              
Sbjct: 93  YHPLPSVPSTQHIEANDMCTELLYSGYR---------PLFLDSTALE------------- 130

Query: 92  GTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKML-PFNWWSASSLAMEVYPE 150
                       L          +    G+  Y  +I  K+  P   W+ S+  +E Y E
Sbjct: 131 ---------RGLLAAKEQASFTQSASPTGSTFY--EIAMKLEDPACIWANSATGLEKYTE 179

Query: 151 WSSVPKHVVKGLKPF 165
           W ++P  V   LKPF
Sbjct: 180 WDNIPYSVANSLKPF 194

>NDAI0K01320 Chr11 complement(297117..297893) [777 bp, 258 aa] {ON}
           Anc_8.682 YPL159C
          Length = 258

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 44/136 (32%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTE 91
           F RLPK+     L  ++++  +LYSGYRP+  P   N  F+                   
Sbjct: 91  FSRLPKITPPSNLRHQDISMKLLYSGYRPLFIP---NGSFQQ------------------ 129

Query: 92  GTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQ--KMLPFNWWSASSLAMEVYP 149
                         G  N G   TL     +++A K+ +  K      W  S+  +E + 
Sbjct: 130 --------------GQKNNGS--TL-----YEFAMKLDEFKKDKNSTIWDTSATGVETFT 168

Query: 150 EWSSVPKHVVKGLKPF 165
           EW +VP+ V++ LKPF
Sbjct: 169 EWDNVPESVIRNLKPF 184

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 47/137 (34%)

Query: 29  RSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTE 88
           ++ F  LPK P T +L+ R+++  +LYSGYRP +    E                     
Sbjct: 79  KTDFSWLPKAPSTDHLKHRDVSTTLLYSGYRPFVLNSSEQ-------------------- 118

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148
                    QT +T                   +++A K+     P  W S S+   E Y
Sbjct: 119 --------KQTDST------------------LYEFAMKLEALGDPLPWIS-SATGTEFY 151

Query: 149 PEWSSVPKHVVKGLKPF 165
            EW ++P  V+K L+PF
Sbjct: 152 GEWDNIPADVIKKLRPF 168

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 24/152 (15%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMY-------PVRENPLFRNSNKLMAISHPEHDT 87
           LP+VP T Y+   E+  + L++GYRP+           R N L    N   + ++ +  +
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLFLGNSSLRPETRTNAL---DNFFTSFANLKVTS 131

Query: 88  EGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEV 147
           E       + Q V  EL    +   +N     G  +  P IP        W AS   M V
Sbjct: 132 ESKNSAEEEVQDVIEEL--KRDSAQLNLKNSKGKNR-KPIIP--------WDASISGM-V 179

Query: 148 YPEWS--SVPKHVVKGLKPFDLLLGVKATQKK 177
           Y + S   VPK VV  LKPF ++   +A + K
Sbjct: 180 YNDHSFKDVPKSVVSKLKPFKMVKLERAGESK 211

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 65/147 (44%), Gaps = 34/147 (23%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTEGTH 94
           +P+VP T YL   +L  + L++GY+P+   +  +PL  N+N ++         +G   + 
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF--LGNSPLESNNNDVLL--------DGLFSSI 139

Query: 95  RDSQTVNTELFGNNNCGGINTLGCNGTWK-----------YAPKIPQKMLPFNWWSASSL 143
           R  +  N ++   NN   I+        K            APKIP        W AS  
Sbjct: 140 R--KLKNAQINSENNTVEIDVSDMLDDLKKDNQEYQRLHEKAPKIP--------WDASIS 189

Query: 144 AMEVYPE--WSSVPKHVVKGLKPFDLL 168
            + VY +  +  VP+ VV  LKPF L+
Sbjct: 190 GL-VYNDEPFKGVPRSVVSKLKPFKLV 215

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 53/135 (39%), Gaps = 42/135 (31%)

Query: 32  FRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHPEHDTEGTE 91
           +  LPK P T +L + E   D+ YSGYRP+   V         N+L +    E +   T 
Sbjct: 103 YSSLPKAPTTHHLHSSEFNTDLFYSGYRPLSIDV---------NQLAS----EQENPCT- 148

Query: 92  GTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNW-WSASSLAMEVYPE 150
                             C  I+          +  I +K L  +  W  S+   E+Y E
Sbjct: 149 ------------------CYEIS---------LSMDIVKKNLKVSTPWLFSATGSELYKE 181

Query: 151 WSSVPKHVVKGLKPF 165
           W ++PK V+  LK F
Sbjct: 182 WDNIPKSVLDNLKCF 196

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 71/166 (42%), Gaps = 23/166 (13%)

Query: 26  GDGRSMFRR------LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPL-FRNSNKLM 78
           G+GRS   R      +PKV  T +++ +E+  + L++GYRP+       P   R      
Sbjct: 96  GNGRSRESRPSLHLLVPKVASTDHIQNKEVHTEGLFAGYRPLFLGNSSFPSDARKGKNFH 155

Query: 79  AISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGI-----NTLGCNGTWKYAPKIPQKML 133
            +     + +  + + +D +    E+  + +   +     N    + + K  P IP    
Sbjct: 156 ELGDVLPNIQVIDASEKDGKLNMQEIIEDLHKSSLRDSIHNMEQHSSSHKRKPVIP---- 211

Query: 134 PFNWWSASSLAMEVYPE--WSSVPKHVVKGLKPFDLLLGVKATQKK 177
               W AS   M VY +  +  VPK VV  +KPF L+   + +Q K
Sbjct: 212 ----WDASISGM-VYNDMPFKHVPKSVVLRMKPFKLMRIERKSQMK 252

>Suva_14.44 Chr14 (73757..75334) [1578 bp, 525 aa] {ON} YNL295W
           (REAL)
          Length = 525

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 71/155 (45%), Gaps = 29/155 (18%)

Query: 28  GRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVM-----YP--VRENPLFRNSNKLMAI 80
           G ++   +PKV  T ++  +E+  + L++GYRP+      +P  VR+   F + ++++  
Sbjct: 105 GSNLHLLVPKVASTDHIPKKEVNTEGLFAGYRPLFLGNSSFPSDVRKGKNFHDLDEVLP- 163

Query: 81  SHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGI-----NTLGCNGTWKYAPKIPQKMLPF 135
                + +  + + +D +    E+  +     +     N    + + K  P IP      
Sbjct: 164 -----NIQLVDASEKDGKLNVQEIIEDLQRTSLRESISNMEQSSSSHKRRPVIP------ 212

Query: 136 NWWSASSLAMEVYPE--WSSVPKHVVKGLKPFDLL 168
             W AS   M VY +  +  +PK+VV  LKPF L+
Sbjct: 213 --WDASISGM-VYNDMPFKHIPKNVVSKLKPFKLV 244

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 65/147 (44%), Gaps = 13/147 (8%)

Query: 28  GRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLF----RNSNKLMAISHP 83
           G ++   +PKV  T+Y+  +E+  + L++GYRP+      N  F    R      A+   
Sbjct: 104 GSNLHLLVPKVASTEYIPIKEVHTEGLFAGYRPLFLG---NSSFSSDMRKGKNFHALDDG 160

Query: 84  EHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSL 143
             + +  + + +D +    E+  +       +L  N + K       K  P   W AS  
Sbjct: 161 LPNIQVIDASEKDGKLDVQEIIEDLQK---TSLIENVSDKEQFSSSHKRKPVIPWDASIS 217

Query: 144 AMEVYPE--WSSVPKHVVKGLKPFDLL 168
            M VY +  +  VPK+V+  +KPF L+
Sbjct: 218 GM-VYNDMPFKYVPKNVISKMKPFKLM 243

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 34.7 bits (78), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 62/145 (42%), Gaps = 23/145 (15%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMY---PVRENPLFRNSNKLMAISHPEHDTEGTE 91
           LP+VP T+ +   E+  D L++GYRP+     P+ +       ++ +A      D +   
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLFLGNCPIDDAEKGSELDRFLA---SFSDLKLLN 130

Query: 92  GTHRDSQTVNTELFGNNNCGGI-----NTLGCNGTWKYAPKIPQKMLPFNWWSASSLAME 146
               DS+ V  E    +    I       +G N   +  P +P        W AS   + 
Sbjct: 131 NEDSDSKEVKIEDILEDIQNDIRNATNEDIGDNSRTR-KPVVP--------WDASISGL- 180

Query: 147 VYPE--WSSVPKHVVKGLKPFDLLL 169
           +Y +  + ++P  VV  LKPF L++
Sbjct: 181 IYNDRPFKNIPNEVVSKLKPFKLIV 205

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 77/174 (44%), Gaps = 33/174 (18%)

Query: 22  LEYNG----DGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVM-----YP--VRENPL 70
           L YN      G ++   +P+V  T Y+  +E+  + L++GYRP+      +P   R+   
Sbjct: 94  LAYNSRSKISGSNLHLLVPRVASTDYISNKEVHTEGLFAGYRPLFLGNSGFPSDARKGKN 153

Query: 71  FRNSNKLMAISHPEHDTEGTEGTHRDS----QTVNTELFGNNNCGGINTL-GCNGTWKYA 125
           F   + ++       + +  + + +D     Q +  +L   +    I+++     + K  
Sbjct: 154 FHELDDVLP------NIQVVDASEKDGKLNVQEIIEDLQRTSLRESIHSMEQLPSSHKRK 207

Query: 126 PKIPQKMLPFNWWSASSLAMEVYPE--WSSVPKHVVKGLKPFDLLLGVKATQKK 177
           P IP        W AS   M VY +  +  VPK+++  +KPF LL   + +Q K
Sbjct: 208 PVIP--------WDASISGM-VYNDMPFKYVPKNIILKMKPFKLLRIERKSQAK 252

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 51/137 (37%), Gaps = 59/137 (43%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENP------LFRNSNKLMAISHPEHDTE 88
            P  P T++L+  ++A D+LYSGYRP+    R +P      ++  + +L A+  P     
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPLSLR-RADPKEAQSKIYELAMRLEAVEDP----- 142

Query: 89  GTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVY 148
                                                       LP   W  ++    +Y
Sbjct: 143 --------------------------------------------LP---WVKNATGRVLY 155

Query: 149 PEWSSVPKHVVKGLKPF 165
            EW +VP+ V++ L+P+
Sbjct: 156 DEWDNVPQSVIRNLRPY 172

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {ON}
           similar to gnl|GLV|KLLA0A07447g Kluyveromyces lactis
           KLLA0A07447g and weakly similar to YNL295W
           uniprot|P48564 Saccharomyces cerevisiae YNL295W
           Hypothetical ORF
          Length = 460

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 79/185 (42%), Gaps = 29/185 (15%)

Query: 2   KQSGVGRRALSTVKKGSGSRLEYNGDGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPV 61
           K +G G  A  T K    S+ E + +   +   +P+VP T Y+   E+  + L++GYRP+
Sbjct: 28  KDNGDGNSADQT-KDEKNSKDETDNNKAHLV--VPRVPPTDYISAPEIQTEGLFAGYRPL 84

Query: 62  MY---PVRE----NPLFRNSNKLMAISHPEHDTEGTEGTHRDSQTVNTELFGNNNCGGI- 113
                P+ +     PL    N   + ++ +   E       + Q V  +L      G + 
Sbjct: 85  FLGNSPINDKNGSTPL---DNFFTSFANLKVVEESEVVGEVNVQEVIEDLRRGIPSGQMS 141

Query: 114 NTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPE--WSSVPKHVVKGLKPFDLLLGV 171
           N+ G N      P IP        W AS   M VY +  +  VP +VV  LKPF ++   
Sbjct: 142 NSKGKNR----KPIIP--------WDASISGM-VYNDDPFKHVPNNVVSKLKPFKMVRLE 188

Query: 172 KATQK 176
           K + K
Sbjct: 189 KKSDK 193

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 31.2 bits (69), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPV 61
           LP+VP T  ++ ++L  ++L+S YRP+
Sbjct: 91  LPRVPSTSNMDRKQLNTELLFSAYRPL 117

>TBLA0B08510 Chr2 complement(2036557..2038062) [1506 bp, 501 aa]
           {ON} Anc_3.62 YNL295W
          Length = 501

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 12/146 (8%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAISHP----EHDTEGT 90
           +P+V  T+ + + E+  D L++GYRP+          R ++ L    H       + E  
Sbjct: 90  VPRVASTEDIPSHEVQVDGLFAGYRPLFLGESSIKRRRKASPLDKFFHSVETHTRNRESG 149

Query: 91  EGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQKMLPFNWWSASSLAMEVYPE 150
           + T      ++     +           +   K  P+ P  ++P   W AS   +  Y +
Sbjct: 150 KSTLGIQDIIDNLRKDHEEENLEIEEHSDKNTKVEPRKP--VIP---WDASVSGI-FYKD 203

Query: 151 WS--SVPKHVVKGLKPFDLLLGVKAT 174
            S  +VPKHV+  LKP+ + L VK T
Sbjct: 204 QSFKNVPKHVMNKLKPYKVYLPVKKT 229

>TBLA0B02720 Chr2 (626800..628308) [1509 bp, 502 aa] {ON} Anc_8.798
           YOR320C
          Length = 502

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 28  GRSMFRRLPKVPMTKYLETRELAKDILYSG--YRPVM 62
           G+ ++  LP +P T YL  + L +DI+ SG  Y P+ 
Sbjct: 269 GQMIYNHLPSLPDTLYLNAKNLGQDIISSGPLYSPIF 305

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 35 LPKVPMTKYLETRELAKDILYSGYRPVM 62
          +PKVP T Y+ + E+  + L++GY+P+ 
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPLF 97

>CAGL0M03685g Chr13 complement(413333..414814) [1482 bp, 493 aa]
           {ON} weakly similar to uniprot|P48564 Saccharomyces
           cerevisiae YNL295w
          Length = 493

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 63/145 (43%), Gaps = 34/145 (23%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPV----MYPVRENPLFRNSNKLMAISHPEHDTEGT 90
           +P V  T +L  +E+  + L++G +P+    +  ++  P F ++  L+            
Sbjct: 94  VPSVSSTDHLTDQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLL------------ 141

Query: 91  EGTHRDSQTVNTELFGNNNCGGINTLG------CNGTWKYAPKIPQKMLPFNWWSASSLA 144
                   + N  +   ++ GG  +L        +  W       +K++P   W AS   
Sbjct: 142 --------SKNFRVINASDDGGEKSLDEFLESVKDNDWNIDNSEQKKVIP---WQASISG 190

Query: 145 MEVYPE-WSSVPKHVVKGLKPFDLL 168
           +E   + +S++PKHV+  L+P+ L+
Sbjct: 191 IEYEDKSFSNIPKHVLSKLRPYKLI 215

>Kwal_23.5277 s23 complement(1088250..1089662) [1413 bp, 470 aa]
           {ON} YNL295W - Hypothetical ORF [contig 8] FULL
          Length = 470

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 64/156 (41%), Gaps = 35/156 (22%)

Query: 27  DGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRNSNKLMAI----SH 82
           D R      PKV  T +L+  E+  + L++G +P+          R +N L  I    + 
Sbjct: 72  DNRRSIYLFPKVHSTDHLKQDEVHTEGLFAGNKPLFLGDLSPGPKRPNNALEGIFGTLTK 131

Query: 83  PEHDTEGTEGTHRDSQTVNTELFGNNNCGGINTLGCNGTWKYAPKIPQK--------MLP 134
            +  TE ++G   + Q++  +L   +                 P++P K        ++P
Sbjct: 132 IKRATEDSKGQEINIQSILKDLQSED-----------------PEVPAKDSDIAEKAVIP 174

Query: 135 FNWWSASSLAMEVYPE--WSSVPKHVVKGLKPFDLL 168
              W AS   M VY +  +  VP+ VV  LKPF L 
Sbjct: 175 ---WDASISGM-VYNDEPFKHVPRAVVSKLKPFKLF 206

>TPHA0P01260 Chr16 complement(252274..253758) [1485 bp, 494 aa] {ON}
           Anc_3.62 YNL295W
          Length = 494

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 58/153 (37%), Gaps = 40/153 (26%)

Query: 35  LPKVPMTKYLETRELAKDILYSGYRPVM-----------YPVRENPLFRNSNKLMAISHP 83
           +PKV  T  L + E+  + L++GYRP+              V +N  F  S   + +S P
Sbjct: 89  VPKVASTDNLSSAEIQTEGLFAGYRPLFLGNSSLETNSKLDVLDN--FFTSFANLKVSAP 146

Query: 84  EHDTEGTEGTHRDSQTVNTELFGNNNCGGINTL------GCNGTWKYAPKIPQKMLPFNW 137
           E +T+                    N G I  +      G     + +    +   P   
Sbjct: 147 ESETDSY------------------NSGQIKDVIDDLQNGLESEQEQSSLTRENRKPIIP 188

Query: 138 WSASSLAMEVYPE--WSSVPKHVVKGLKPFDLL 168
           W AS   M VY +  +  +PK VV  L PF L+
Sbjct: 189 WDASIGGM-VYSDKAFKDLPKSVVSKLSPFKLV 220

>TPHA0I00600 Chr9 (122877..124397) [1521 bp, 506 aa] {ON} Anc_8.798
           YOR320C
          Length = 506

 Score = 29.3 bits (64), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 9/28 (32%), Positives = 21/28 (75%)

Query: 28  GRSMFRRLPKVPMTKYLETRELAKDILY 55
           G+ ++  LP +P T +L+++++A DI++
Sbjct: 266 GQMIYNHLPSLPHTLFLDSKDIADDIIH 293

>Kpol_1020.21 s1020 complement(47536..49458) [1923 bp, 640 aa] {ON}
           complement(47536..49458) [1923 nt, 641 aa]
          Length = 640

 Score = 28.9 bits (63), Expect = 8.0,   Method: Composition-based stats.
 Identities = 10/21 (47%), Positives = 15/21 (71%)

Query: 84  EHDTEGTEGTHRDSQTVNTEL 104
           + DT+G E +H D +T+NTE 
Sbjct: 112 DEDTDGNESSHADERTLNTEF 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,899,808
Number of extensions: 873854
Number of successful extensions: 2238
Number of sequences better than 10.0: 67
Number of HSP's gapped: 2230
Number of HSP's successfully gapped: 84
Length of query: 177
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 75
Effective length of database: 41,785,467
Effective search space: 3133910025
Effective search space used: 3133910025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)