Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079503.493ON1821828371e-115
CAGL0L08448g3.493ON1731825281e-68
YPR149W (NCE102)3.493ON1731825262e-68
Smik_16.4023.493ON1731825151e-66
KNAG0B008003.493ON1821825073e-65
Skud_16.4443.493ON1731824993e-64
CAGL0I10494g3.493ON1721834803e-61
TDEL0D056103.493ON1751824708e-60
Suva_16.4783.493ON1661824621e-58
Kpol_1017.63.493ON1871894589e-58
NDAI0G009303.493ON1761824561e-57
KAFR0C019703.493ON1791844492e-56
NDAI0B058803.493ON1821844465e-56
TPHA0D032803.493ON1841844352e-54
NCAS0E008003.493ON1741824326e-54
YGR131W (FHN1)3.493ON1741824117e-51
TBLA0D029603.493ON1891784111e-50
KAFR0G037003.493ON1861864066e-50
ZYRO0D09966g3.493ON1781833988e-49
Smik_6.2273.493ON1741193961e-48
Suva_7.4193.493ON1741193841e-46
NCAS0F035603.493ON1831693822e-46
KLLA0D16280g3.493ON1691823673e-44
SAKL0F02750g3.493ON1701453587e-43
Skud_7.4423.493ON1741823527e-42
TBLA0C044903.493ON1861693475e-41
Kwal_55.212383.493ON1701823022e-34
KLTH0F14850g3.493ON1711833022e-34
AFR312W3.493ON1681192901e-32
Ecym_12363.493ON1691732727e-30
KAFR0F003402.61ON311100740.27
Suva_14.423.60ON86431682.4
TBLA0I005403.16ON42049654.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07950
         (182 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   327   e-115
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   207   1e-68
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   207   2e-68
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   202   1e-66
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   199   3e-65
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   196   3e-64
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   189   3e-61
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   185   8e-60
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   182   1e-58
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   181   9e-58
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   180   1e-57
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   177   2e-56
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   176   5e-56
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   172   2e-54
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   171   6e-54
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   162   7e-51
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   162   1e-50
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   160   6e-50
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   157   8e-49
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   157   1e-48
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   152   1e-46
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   151   2e-46
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   145   3e-44
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   142   7e-43
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   140   7e-42
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   138   5e-41
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   120   2e-34
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   120   2e-34
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   116   1e-32
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   109   7e-30
KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61 Y...    33   0.27 
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    31   2.4  
TBLA0I00540 Chr9 complement(94703..95965) [1263 bp, 420 aa] {ON}...    30   4.1  

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  327 bits (837), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 163/182 (89%), Positives = 163/182 (89%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             IMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 181 TV 182
           TV
Sbjct: 181 TV 182

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  207 bits (528), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 124/182 (68%), Gaps = 9/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLA+ D  LR+VNFVF+VIC+GLIS L+ T+  HSSR+NYCMF AAYGI TDS YGV AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F+E L+WPL+L  LDFLNF F LTAGCVLAVGIRAHSC N  YR  NKI+QGSE RCR+ 
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             IMSL+NIF+NG F        G++F +R+R      GVP++S
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAF--------GTKFIRRRRNNA-EVGVPSVS 171

Query: 181 TV 182
            V
Sbjct: 172 QV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  207 bits (526), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 109/182 (59%), Positives = 124/182 (68%), Gaps = 9/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLALAD  LR++NF+FLVI +GLIS+LLNTQH HSSR+NYCMF  AYGI TDS YGV AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F EPL+WPL+L  LDFLNFVFT TAG VLAVGIRAHSC N +Y + NKI QGS  RCRQ 
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             +MS+ N+ +NG FGS         FSKR+RT  V  GVP IS
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-------FSKRRRTGQV--GVPTIS 171

Query: 181 TV 182
            V
Sbjct: 172 QV 173

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  202 bits (515), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 107/182 (58%), Positives = 122/182 (67%), Gaps = 9/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLALAD  LR++NF+FLVI + LIS+LLNTQ  HSSR+NYCMF  AYGI TDS YGV AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F EPL+WPL+L  LDFLNFVFT TAG VLAVGIRAHSC N +Y + NKI QGS  RCRQ 
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             +MS+ N+ +NG FGS         FSKR+RT  V  GVP IS
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGS-------FSKRRRTGQV--GVPTIS 171

Query: 181 TV 182
            V
Sbjct: 172 QV 173

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  199 bits (507), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 118/182 (64%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML +AD  LRL+NF FLVIC+  IS L+NTQ  H SR+NYCMF AAYGI TD  YG++AN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           FWEPL+WPL+L  LDFLNF FTLTAG VLAVGIRAHSCKNV YR +N I+QGSENRCR  
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             +MS +N+ +NG F +A S     R            GVP+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 181 TV 182
            V
Sbjct: 181 QV 182

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  196 bits (499), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 105/182 (57%), Positives = 123/182 (67%), Gaps = 9/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLA AD  LR++NF+FLVI +GLIS+LLNTQ  +SSR+N+CMF AAYGI TDS YGV AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F+EPL+WPL+L  LDFLNFVFT TAG VLAVGIRAHSC N +Y + N I QGS  RCRQ 
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             +MS+ N+ +NG FGS         FSKR+RT  V  GVP IS
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-------FSKRRRTGQV--GVPTIS 171

Query: 181 TV 182
            V
Sbjct: 172 QV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  189 bits (480), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 120/183 (65%), Gaps = 12/183 (6%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++AD  LR+VN VFL+IC+GL S+L+NT+  HSSR+N+C+F AAYGI TDS YG+ AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAY-RNKNKIVQGSENRCRQ 119
           F+EPL+WPL+L  LDFLNFVFT TAG VLAVGIRAHSC N  Y   + KIVQGS  RCRQ
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179
                              IMS+V++ +NG FG           +K +R      GVP+I
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFG-----------AKLRRKHHTEVGVPSI 169

Query: 180 STV 182
           S V
Sbjct: 170 SQV 172

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  185 bits (470), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 116/182 (63%), Gaps = 7/182 (3%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLA+ D  LRLVNF FLVI +GL+  L++++ GHSSR+N+CMF AA+GI TDSFYG++AN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
            WE  +WP++L ALDFLNF FT +A   LAVGIR HSCKN  Y + N I QGS  RCR  
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             IMSL+ I TNGPF S   + + SR  +RK  Q    GVP IS
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSS--RTTLTSR--RRKSAQ---VGVPTIS 173

Query: 181 TV 182
            V
Sbjct: 174 QV 175

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  182 bits (462), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 116/182 (63%), Gaps = 16/182 (8%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           MLA  D  LR++NF+FLVI +GLIS+LLNTQ G+SSRINYCMF  AY I TDS YGV AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F+EPL+WPL+L +LDFLNFVFT TA       IRAHSC+N  Y   N I QGS NRCR+ 
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             +MS+ N+ +NG FGS         FSKR+RT  V  GVP IS
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-------FSKRRRTGQV--GVPTIS 164

Query: 181 TV 182
            V
Sbjct: 165 QV 166

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  181 bits (458), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 116/189 (61%), Gaps = 9/189 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML+LAD  +R +NF F VICMGLI +LL T+ GHSSR+NYCMF   + + TDSFYG++AN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FW-EPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
            W  P +WP++L A DFLNF FT TAG VL+VGIR HSCKN  Y + NKI+QGS +RCR+
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQ----- 174
                              +MS +N+ +NG  G   S+P   R        GVP      
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGF--STPSIGRRRHHTANIGVPGASSPQ 178

Query: 175 -GVPNISTV 182
            GVPNIS V
Sbjct: 179 VGVPNISQV 187

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  180 bits (456), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 92/182 (50%), Positives = 118/182 (64%), Gaps = 6/182 (3%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++AD  LRL+N +FLVIC+GL SALLNTQ GH+SRINYCMFT  Y + TDSF+G++AN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F+E LS+P +L  LDFLNF FT  AG VLA GIR+HSC N +Y ++NKI QGS NRCR+ 
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                              MS +++  NG F +  +S       +R+R      GVP+IS
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAFSNTFTSR------RRRRNGAAEVGVPSIS 174

Query: 181 TV 182
            V
Sbjct: 175 QV 176

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  177 bits (449), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 121/184 (65%), Gaps = 7/184 (3%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGH-SSRINYCMFTAAYGITTDSFYGVVA 59
           ML +AD  LRL+N VFL+I + L SAL+NTQ+GH +SR+NYCMF  A+G+  DS YG+ A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
           NF++ L+WPLLL  LDFLNF FT +A   LAVGIRAHSC N +Y + NKIV+GS  RCR+
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRF-SKRKRTQGVPQGVPN 178
                              IMS +N+F NG F S+GS    SRF S+RK+      GVPN
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAF-SSGS----SRFISRRKKHATDVGGVPN 175

Query: 179 ISTV 182
           IS V
Sbjct: 176 ISQV 179

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  176 bits (446), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 97/184 (52%), Positives = 116/184 (63%), Gaps = 4/184 (2%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML+  D  LR++N +FLV+ M  ISALLNTQ  +SSRIN+CMF AA+G+ TDSF+GV  N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FWEPL-SWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
            ++ L SWP+LL   DFLNFVFT TAG VLAV IRAHSCKN  Y N N I QGSENRCR 
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQ-GVPN 178
                              IMS +N+ +NG FGS   +  GSR  +R    G  + GVP 
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSG--TWAGSRSKRRTNRSGANEVGVPT 178

Query: 179 ISTV 182
           IS V
Sbjct: 179 ISQV 182

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  172 bits (435), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 89/184 (48%), Positives = 108/184 (58%), Gaps = 2/184 (1%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML LAD  LR VNF F VIC+GL+ +LL TQ+ HSSR+NYC+F   + + TD+FYG +AN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FWE-PLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
            W  PL+WP++L   DFLNF FT TAG VLAVG R HSC N +Y + N I QGS +RCR+
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQ-GVPN 178
                              IMS +N+FTNG  GS                   PQ GVPN
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 179 ISTV 182
           IS V
Sbjct: 181 ISQV 184

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  171 bits (432), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 111/182 (60%), Gaps = 8/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML +AD  LR++N VFLVIC+GL SALLNT+  ++SRINYCMFT AY +TTDS YG+ AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F++ L+ P L   LDFLNF FT  AG VLA GIRAHSCK+  Y N NKI QG +NRCR+ 
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             IMS +N+  NG F             +R+R      GVP+IS
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAF--------TQHIGRRRRRNAAEIGVPSIS 172

Query: 181 TV 182
            V
Sbjct: 173 QV 174

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  162 bits (411), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 110/182 (60%), Gaps = 8/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML+ AD  +R++N VFL+I +GLIS L+ TQ  HSSR+N+CMF A YG+ TDS YG +AN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           FW  L++P +L  LDFLNF+FT  A   LAVGIR HSCKN  Y  +NKI+QGS +RC Q 
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                              ++ + +  NG FGS       + FS+R+  +    G+P IS
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGS------NTGFSRRRARR--QMGIPTIS 172

Query: 181 TV 182
            V
Sbjct: 173 QV 174

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  162 bits (411), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 87/178 (48%), Positives = 107/178 (60%), Gaps = 4/178 (2%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGH-SSRINYCMFTAAYGITTDSFYGVVA 59
           ML L D   R+ NF F VI  G+I  LLNT+HGH SSR+NYCMF  A+G+ +DSFYG++A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NFW-EPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCR 118
           N   EP ++P +L A DFLNFVFT TAG VLAVGIR HSC N  YR +N I+QGSE RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 QXXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGS--RFSKRKRTQGVPQ 174
           +                   +++LV  FT G  G  G         F +R RT+  PQ
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQ 178

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  160 bits (406), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 119/186 (63%), Gaps = 4/186 (2%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGH-SSRINYCMFTAAYGITTDSFYGVVA 59
           MLA+AD  LRLVNF F+VI M  I+ LLNT+ GH S+R+NYCMF  A+GI TDS YG+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
           NF+E L+WP++L   DFLNFVF  TAG VLAVGIRAH+C N AYRN NKIV+GSE RCR 
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVP---QGV 176
                              + S++   + GPFGS  S   GSR  +R    GVP    GV
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 177 PNISTV 182
           P +S V
Sbjct: 181 PTVSEV 186

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  157 bits (398), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 111/183 (60%), Gaps = 6/183 (3%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQ-HGHSSRINYCMFTAAYGITTDSFYGVVA 59
           MLAL D  LR VNF F VI +GL+  L+ ++ HGH+SR+N+CMF AA+GI  DSFYG++A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
           N + P ++P++L  LDFLNFVFT TA   LAVGIR HSC N  Y + NKI QGS +RCR+
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179
                              +MS +++ +NG              S+R+RTQ    GVP I
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNG-----AFGSSSGFSSRRRRTQQANVGVPTI 175

Query: 180 STV 182
           S V
Sbjct: 176 SQV 178

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  157 bits (396), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 89/119 (74%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML+ AD  +R++N VFL+I +GLIS L++TQ  HSSR+N+CMFTAAYG+ TDS YG +AN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
           FW  L++P +L ALD LNF+FT  A   LAVGIR HSCKN  Y  +NKI Q S +RC Q
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  152 bits (384), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 91/119 (76%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++AD  +R++N +FL+I +GL+S L+++Q  HSSR+N+CMF AAYG+ TDSFYG +AN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
            W  L++P+++  LDFLNF+FT  AG  LAVGIR HSC N  Y + NKI QGS +RC Q
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  151 bits (382), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/169 (49%), Positives = 104/169 (61%), Gaps = 7/169 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML+  D  LR  N +FLV+ +  IS LL+TQ+  SSR+NYCMF AA+G+ TDSF+G+ AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FWEPLS-WPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
             + LS WP++L   DFLNFVFT TAG VLAVGIR HSC N  Y   NKI+QGS  RCR 
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKR 168
                              IMS +++ +NG FGS      GS  S+RKR
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGS------GSFMSRRKR 163

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  145 bits (367), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 78/182 (42%), Positives = 109/182 (59%), Gaps = 13/182 (7%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++ D  LR VNFVFL+I +GL+  L+ TQ   SSR+N+ +F A +GI  DS Y ++AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F   L+WP++L +LDFLN+VFT +A   LAVGIR  SC N ++ + NKI +GS++RCR+ 
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                             I+S+VN  T+G FG+          S  ++TQ    GVP IS
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGT----------SSNRKTQ---VGVPTIS 167

Query: 181 TV 182
            V
Sbjct: 168 QV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  142 bits (358), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 68/145 (46%), Positives = 90/145 (62%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++ D  LRLVNF FLVI +GL  +L+ TQ  HS R+N+ +FTAA+ + TDSFY V AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
            +   +WP+LL   DFLNFVFT +A   LAVGIR HSC N +Y   N I QGS +RCR+ 
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNI 145
                             ++S++N+
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINV 145

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  140 bits (352), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 83/182 (45%), Positives = 108/182 (59%), Gaps = 8/182 (4%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML+ AD  +R+V+ VFL+I +GLI  L+ TQ   SSR+N+CMF AAYG+ TDSFYG +AN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           FW  L++P +L  LDFLNF+FT  A   LAVGIR HSCKN  Y  +N I QGS +RC Q 
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                              +S+  +  NG FG   ++  G R ++R+       GVP IS
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGF--NTGYGRRRARRQ------MGVPTIS 172

Query: 181 TV 182
            V
Sbjct: 173 QV 174

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  138 bits (347), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 94/169 (55%), Gaps = 2/169 (1%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQ-HGHSSRINYCMFTAAYGITTDSFYGVVA 59
           ML+     LR++NF FLVI  G+I  L+ ++   HS R+NYCMF A + + TDSFY + A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFW-EPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCR 118
           NFW  P +WP+LL + DFLNF FT TAG VL+VGIR HSC N  Y   NKI QGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 QXXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRK 167
                               + S + ++ NG F          R S+R+
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRR 169

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  120 bits (302), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 100/182 (54%), Gaps = 12/182 (6%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++ D  LR  NFVFL+I +GL  +L  T+  ++ ++N+ +F AA+G+  D+ Y + AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F   L+WPLL+   DFLNFVFT  A   LAV IR HSC N  Y + NK+ QGS +RCR+ 
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
                              +SLVN+F+ G F ++         S RK       GVP IS
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTS---------SGRKSAN---VGVPTIS 168

Query: 181 TV 182
            V
Sbjct: 169 QV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  120 bits (302), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 103/183 (56%), Gaps = 13/183 (7%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSS-RINYCMFTAAYGITTDSFYGVVA 59
           ML++ D  LR +NF FLVI +GL  +L  T   H++ ++N+ +FTAA+G+  DS Y + A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
           NF   L+WPLL+   DFLNFVFT  A   LAV IR HSC N  Y + N + QGS +RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 XXXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNI 179
                               +SLVN+ + G FG AGSS         +RT  V  GVP I
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFG-AGSS---------RRTGNV--GVPTI 168

Query: 180 STV 182
           S V
Sbjct: 169 SQV 171

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  116 bits (290), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (63%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++ D  LR VNFVFL+I +GL  +L++ Q    SR+N+ +FTA + + TDSFY +VAN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119
           F    +WP++  ALD LN +FT  A   L   I AHSC N  + + N I + S +RCR+
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  109 bits (272), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 87/173 (50%), Gaps = 9/173 (5%)

Query: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60
           ML++ D  LR  NF+FL+I + L  +L+N Q+   SR+N+ +FTA + +  DS Y V+AN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQX 120
           F   L+WP+LL   D LN +FT  A   L   I  HSC N  +   N I +G E RCR+ 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 XXXXXXXXXXXXXXXXXXIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVP 173
                             ++S +NI + G F S          S RK   GVP
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSG---------SGRKTGGGVP 164

>KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61
           YDL218W
          Length = 311

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 9/100 (9%)

Query: 4   LADIFLRLVNFVFLVICMGLISALLNTQHGHSS-RINYCMFTAAYGITTDSFYGVVANFW 62
           + +  LR + F    I +GLI+  L++ H H S R N+ +   A G+    FY +   F 
Sbjct: 22  IPNSILRFLQFASTSIVLGLIAFALHSYHNHGSRRANFALAVGAIGV----FYCLAVFFL 77

Query: 63  EPLSWPLLLGALDFL-NFVFTLTAGCVLAVGIRA---HSC 98
             ++  L+LG +  +   + TL   C   V  +    HSC
Sbjct: 78  TLIAPQLVLGGIFLIAEIIMTLLFLCGFIVAAKVFGQHSC 117

>Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W
           (REAL)
          Length = 864

 Score = 30.8 bits (68), Expect = 2.4,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 150 PFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180
           P+     SP+G++ S  K+ QG+P    N+S
Sbjct: 436 PYSKQSQSPLGAQPSSAKQNQGIPNHAQNLS 466

>TBLA0I00540 Chr9 complement(94703..95965) [1263 bp, 420 aa] {ON}
           Anc_3.16 YNL323W
          Length = 420

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 8/49 (16%)

Query: 62  WEPLSWPLLLGALDFL-NFVFTLTAGCVLAVGIRA-------HSCKNVA 102
           W P+  P  +  + F+  F+F +  GC LA+  R        H CKN A
Sbjct: 66  WNPVYTPQTVLPIYFIIAFIFVIVGGCTLAISSRVDEIVIYYHECKNSA 114

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,610,225
Number of extensions: 518109
Number of successful extensions: 1440
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1415
Number of HSP's successfully gapped: 37
Length of query: 182
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 79
Effective length of database: 41,670,801
Effective search space: 3291993279
Effective search space used: 3291993279
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 62 (28.5 bits)