Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079403.492ON27527513930.0
KAFR0G036903.492ON3632412716e-27
TBLA0C044803.492ON802931549e-11
NDAI0G009403.492ON6562211531e-10
Suva_7.4183.492ON8311781477e-10
Smik_6.2263.492ON839791405e-09
YGR130C3.492ON816791388e-09
Skud_7.4413.492ON807751343e-08
SAKL0F02772g3.492ON7731561334e-08
NCAS0E008103.492ON6921101317e-08
KNAG0B008103.492ON757751317e-08
NCAS0F035503.492ON4411841263e-07
TPHA0D042503.492ON629771263e-07
NDAI0B058603.492ON6811891245e-07
KAFR0C019603.492ON563951236e-07
CAGL0I10516g3.492ON813691236e-07
Kpol_480.143.492ON699731202e-06
TDEL0D056003.492ON700781183e-06
KLTH0F14828g3.492ON8361581165e-06
ZYRO0D09988g3.492ON994681131e-05
Kwal_55.212293.492ON7871531014e-04
KLLA0D16236g3.492ON8711521005e-04
AFR310C3.492ON62392780.23
CAGL0E01903g3.46ON429135740.64
CAGL0J03124g7.251ON87372693.2
Kwal_0.2141.400ON74764684.9
Ecym_13908.857ON44555675.2
Ecym_23818.691ON303125666.7
KAFR0E042904.355ON54837667.3
KLTH0F09570g2.334ON59741667.8
NOTE: 1 genes in the same pillar as KNAG0A07940 were not hit in these BLAST results
LIST: Ecym_1237

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07940
         (275 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...   541   0.0  
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...   108   6e-27
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    64   9e-11
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    64   1e-10
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    61   7e-10
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    59   5e-09
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    58   8e-09
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    56   3e-08
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    56   4e-08
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    55   7e-08
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    55   7e-08
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    53   3e-07
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    53   3e-07
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    52   5e-07
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    52   6e-07
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    52   6e-07
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    51   2e-06
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    50   3e-06
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    49   5e-06
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    48   1e-05
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    44   4e-04
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    43   5e-04
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    35   0.23 
CAGL0E01903g Chr5 (190465..191754) [1290 bp, 429 aa] {ON} simila...    33   0.64 
CAGL0J03124g Chr10 (299422..302043) [2622 bp, 873 aa] {ON} highl...    31   3.2  
Kwal_0.214 s0 complement(106526..108769) [2244 bp, 747 aa] {ON} ...    31   4.9  
Ecym_1390 Chr1 complement(811179..812516) [1338 bp, 445 aa] {ON}...    30   5.2  
Ecym_2381 Chr2 (738252..739163) [912 bp, 303 aa] {ON} similar to...    30   6.7  
KAFR0E04290 Chr5 (866166..867812) [1647 bp, 548 aa] {ON} Anc_4.3...    30   7.3  
KLTH0F09570g Chr6 complement(828282..830075) [1794 bp, 597 aa] {...    30   7.8  

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/275 (95%), Positives = 262/275 (95%)

Query: 1   MWSMLLGKKRKSSPISNPHSSYNTLKPEELGYKQKFPKKYAREIHFPAELTENEMRQRAI 60
           MWSMLLGKKRKSSPISNPHSSYNTLKPEELGYKQKFPKKYAREIHFPAELTENEMRQRAI
Sbjct: 1   MWSMLLGKKRKSSPISNPHSSYNTLKPEELGYKQKFPKKYAREIHFPAELTENEMRQRAI 60

Query: 61  LQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKVPKIPYSEYGQCNEAEFRN 120
           LQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKVPKIPYSEYGQCNEAEFRN
Sbjct: 61  LQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKVPKIPYSEYGQCNEAEFRN 120

Query: 121 PVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEE 180
           PVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEE
Sbjct: 121 PVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEE 180

Query: 181 YNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETE 240
           YNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENR             AEKNKIYKETE
Sbjct: 181 YNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKETE 240

Query: 241 RLNFAIRKHQDKNRQGILPDDASHDTVTVEETVYV 275
           RLNFAIRKHQDKNRQGILPDDASHDTVTVEETVYV
Sbjct: 241 RLNFAIRKHQDKNRQGILPDDASHDTVTVEETVYV 275

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score =  108 bits (271), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 124/241 (51%), Gaps = 13/241 (5%)

Query: 15  ISNPHSSYNTLKPEELGYKQ----KFPKKYAREIHFPAELTENEMRQRAILQDLDEKEQH 70
           I+NP+S +N L    +GYK     +  +K A++I FP  L ENE  Q   L +L  KE +
Sbjct: 65  ITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKDIDFPRSLRENEEAQTNFLNELKTKENN 124

Query: 71  LDHLKKSQRVVYIDK------PVEKEDVVREPVDIQKVPKIP---YSEYGQCNEAEFRNP 121
           L  LK SQ +VYID+         K  ++ +P++I  VPKIP   +++     + E +N 
Sbjct: 125 LKFLKDSQNLVYIDEDDISYEGDSKYKIIEKPINIYSVPKIPSYVFTKVPGNKKKELKNS 184

Query: 122 VATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEY 181
           +ATP+  E+V++ +  +G    +SKE+FDNIQ +   H+  L     K +++ A+K+ EY
Sbjct: 185 LATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKINEY 244

Query: 182 NKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETER 241
           + Q++ L+ +I  E   +  L  K     D ++ +               K ++Y E E 
Sbjct: 245 DTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGEIEA 304

Query: 242 L 242
           +
Sbjct: 305 I 305

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 55/93 (59%), Gaps = 5/93 (5%)

Query: 2   WSMLLGKKRKSSPISNPHSSYNTLKPEELGYKQKFPK-KYAREIHFPAELTENEMRQRAI 60
            ++ L KK    P  +  S Y+ + P++LGYK   P  K A++I FP  L ENE+RQ  +
Sbjct: 69  MNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKL 128

Query: 61  LQDLDEKEQHLDHLKKSQRVVYID----KPVEK 89
              L EKE  LD+L+KSQ+++ ++    +PV K
Sbjct: 129 FAQLTEKESQLDYLQKSQKLIKVEPIGQRPVSK 161

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 120 NPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179
           NP ATP+ PE +V  ++ N  +   SK ++D +  +I  HN  +      +N +   K E
Sbjct: 376 NPKATPKNPELLVKTRY-NNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNE 434

Query: 180 EYNKQLAVLDDQIKS 194
           E+N  +  LD +IKS
Sbjct: 435 EFNNSINELDLKIKS 449

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 46/221 (20%)

Query: 7   GKKRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDL 64
            +K K  P  +  S+Y     +E+G+K K PK   +A++I FP+ LT+NE RQ+  L  L
Sbjct: 86  NEKTKRFPTVSATSNYTNRTSKEMGFK-KIPKDKNFAKDIFFPSYLTQNEQRQQIELTKL 144

Query: 65  DEKEQHLDHLKKSQRVVYIDK--------------------PVEKEDVVREPVDIQKVPK 104
            + E+ L + K SQ ++ + K                    P+EK      P+D +  P 
Sbjct: 145 VKLEKDLQYKKDSQNIIDLTKQPSQSQSPSPLDDSANAEKPPLEK------PIDPKLTPM 198

Query: 105 IPY-------------SEYGQCNEAEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDN 151
           + +             ++     E + RNP ATP + EE+V  K         SK I+D 
Sbjct: 199 VSFQLSTPPVNNKNKKTQVVPEEEEKERNPKATPNSKEEIVKTKKFG----ILSKSIYDQ 254

Query: 152 IQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQI 192
           +Q D   H  +L S + +  ++   KM+EY  +L  LD++I
Sbjct: 255 LQYDQQQHEQYLASYKAEMQEKYDVKMQEYENELKSLDEKI 295

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 78/178 (43%), Gaps = 26/178 (14%)

Query: 96  PVDIQKVPKIPYSEYGQCNEAEF--------------------RNPVATPETPEEVVIYK 135
           P+D  K PK+P+ E  Q     F                     NPVATPE PE +V  K
Sbjct: 367 PIDPSKAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIVKTK 426

Query: 136 HLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSE 195
                +   SK ++D I  D   H AWL+    +   +   K  EY ++L  L +QI   
Sbjct: 427 E----HGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEI 482

Query: 196 KAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERLNFAIRKHQDKN 253
           + +M  LR +  + I++N+NR              +K  I+K+TE  N   +K ++KN
Sbjct: 483 ENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTE--NMKKQKLEEKN 538

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDE 66
           K +  P  +  S Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ  +L +L+ 
Sbjct: 74  KNRKFPTVSATSPYSKQQPQDLGYK-NIPKDVKRAKDIKFPTYLTKNEERQYQLLTELEL 132

Query: 67  KEQHLDHLKKSQRVV 81
           KE+HL +LKK Q++ 
Sbjct: 133 KEKHLKYLKKCQKIT 147

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDE 66
           K +  P  +  S+Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ  +L +L+ 
Sbjct: 77  KNRKFPTVSATSAYSKQQPKDLGYK-NIPKNAKRAKDIRFPTYLTQNEERQYQLLTELEL 135

Query: 67  KEQHLDHLKKSQRVVYIDK 85
           KE+HL +LKK Q++  + K
Sbjct: 136 KEKHLQYLKKCQKITDLTK 154

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 73/167 (43%), Gaps = 24/167 (14%)

Query: 96  PVDIQKVPKIPYSE--------------------YGQCNEAEFRNPVATPETPEEVVIYK 135
           P+D  K PK+P+ E                      + N A   NPVATPE PE +V  K
Sbjct: 376 PIDPSKAPKVPFQERPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTK 435

Query: 136 HLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSE 195
                +   SK ++D I  D   H AWL     +   +   K +EY ++L  L +QI   
Sbjct: 436 E----HGYLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEV 491

Query: 196 KAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERL 242
           + +M  +R++    I++++NR              +K  I+K+TE +
Sbjct: 492 EDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNKKLMIFKDTENM 538

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%), Gaps = 3/79 (3%)

Query: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDE 66
           K +  P  +  S+Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ  +L +L+ 
Sbjct: 76  KNRKFPTVSATSAYSKQQPKDLGYK-NIPKNAKRAKDIRFPTYLTQNEERQYQLLTELEL 134

Query: 67  KEQHLDHLKKSQRVVYIDK 85
           KE+HL +LKK Q++  + K
Sbjct: 135 KEKHLKYLKKCQKITDLTK 153

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 76/177 (42%), Gaps = 26/177 (14%)

Query: 97  VDIQKVPKIPYSE--------------------YGQCNEAEFRNPVATPETPEEVVIYKH 136
           +D  K PK+P+ E                      +   A   NPVATPE PE +V  K 
Sbjct: 354 IDPSKAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKE 413

Query: 137 LNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEK 196
               +   SK ++D I  D   H AWL     K  D+   K +EY ++L  L +QI   +
Sbjct: 414 ----HGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIE 469

Query: 197 AAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERLNFAIRKHQDKN 253
            +M  +R +    I++++NR              +K  I K+TE  N   +K Q+KN
Sbjct: 470 NSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTE--NMKNQKLQEKN 524

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDE 66
           K K  P  +  S+Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ  +L +L+ 
Sbjct: 76  KNKKFPTVSATSAYSKQQPKDLGYK-NIPKNAKRAKDIRFPTYLTKNEERQYQLLTELEL 134

Query: 67  KEQHLDHLKKSQRVV 81
           KE+HL +LK+ Q++ 
Sbjct: 135 KEKHLKYLKECQKIT 149

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 71/169 (42%), Gaps = 24/169 (14%)

Query: 94  REPVDIQKVPKIPYSEYGQCNEAEF--------------------RNPVATPETPEEVVI 133
           + P+D  K PK+P+ E  +                           NPVATPE PE +V 
Sbjct: 342 KAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVK 401

Query: 134 YKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIK 193
            K     +   SK ++D I  D   H AWL   + K   +       Y+++L  L +QI 
Sbjct: 402 TKE----HGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQID 457

Query: 194 SEKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERL 242
             + +M  +R++    I++++NR              +K  I+K+TE +
Sbjct: 458 EIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENM 506

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 72/156 (46%), Gaps = 12/156 (7%)

Query: 93  VREPVDIQKVPKIPYSEYGQCNEAEFRN-----PVATPETPEEVVIYKHLNGTNKAY-SK 146
           + +P+D  K P++P+           R+     P+ATP+ PE +V       T+K Y SK
Sbjct: 317 LAQPIDPNKAPRVPFKAKTGVFALWTRSDKQDQPLATPQDPEYIV------RTDKGYMSK 370

Query: 147 EIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQ 206
            I+D ++ D   H   L +   +  D+     +EYN +L +L  QI   +A M  LR   
Sbjct: 371 AIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDT 430

Query: 207 QRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERL 242
           +  I ++E+              + KN I+KETE +
Sbjct: 431 KEKIKVSESELSKKMLDLNATHISSKNVIFKETENI 466

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 4   MLLGKKRKSSPISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQ 62
           ++  K  K+       ++  T    +LGYK     K+ A++I  P  L   + +QR  L 
Sbjct: 55  LIAAKNVKAKKFPTVSATSGTASAADLGYKVIDSAKRRAKDISVPRYLKNTDEKQRKKLD 114

Query: 63  DLDEKEQHLDHLKKSQRVVYIDK 85
            L+ KE HL +LK SQ++V + K
Sbjct: 115 KLEFKENHLQYLKDSQKIVDVRK 137

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 55/110 (50%), Gaps = 12/110 (10%)

Query: 91  DVVREPVDIQKVPKIPYS------EYGQCNEAEFR--NPVATPETPEEVVIYKHLNGTNK 142
           +VV  P+D    P +P+S      +  +  EA  +  NPVA+P   EE+V        +K
Sbjct: 230 NVVEPPIDPALAPMVPFSLATPNQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSK 289

Query: 143 AYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQI 192
           A    ++D IQ D   H  WL   E K N++   KM+EY K L  +D+Q+
Sbjct: 290 A----VYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKKSLQDMDNQM 335

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 61/113 (53%), Gaps = 11/113 (9%)

Query: 7   GKKRKSSPISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQDLD 65
            +K +  P  +  S+Y    P++ G+   K  + +A++I+FP  LTENE RQ+A L  L+
Sbjct: 88  NEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFPNYLTENEQRQQAELLILE 147

Query: 66  EKEQHLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKVPKIPYSEYGQCNEAEF 118
           +KE+ L +L+ SQ ++ + K        +EP   +K P    S   + +EA F
Sbjct: 148 KKEKDLKYLQDSQNIIDLTKK-------QEP---KKAPTPVASTTEEIDEATF 190

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 8   KKRKSSPISNPHSSYNTLKPEELGY-KQKFPKKYAREIHFPAELTENEMRQRAILQDLDE 66
           ++ K  P  +  S YN+    ELG+ K    ++ AR+I FP  L ENE RQR IL+DL++
Sbjct: 68  QRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIVFPEYLLENEDRQRLILKDLEK 127

Query: 67  KEQHLDHLKKSQRVV 81
           +EQ L HL++ Q V+
Sbjct: 128 REQTLLHLQRCQSVL 142

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 45/87 (51%), Gaps = 10/87 (11%)

Query: 120 NPVATPETPEEVVI---YKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCAT 176
           NP AT +TPE ++    Y H++         +F+ +  D   H A +   + +   + A 
Sbjct: 297 NPQATEDTPELLLKLPKYGHVSAA-------VFNKVLYDDKVHKAEMADYQREQESKFAK 349

Query: 177 KMEEYNKQLAVLDDQIKSEKAAMNNLR 203
           K++EY ++LA +DD+  S  A MN+ +
Sbjct: 350 KLQEYEQKLAQVDDRKLSVLAKMNDAK 376

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 81/184 (44%), Gaps = 23/184 (12%)

Query: 47  PAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKV-PKI 105
           P  L   E +Q+  L +L  KEQ+L  LK SQR++            R     Q + PK+
Sbjct: 99  PEFLKGKEEKQKNDLFNLQMKEQNLQRLKNSQRII-------TSSTARTYPQQQNIYPKV 151

Query: 106 PYSE-------------YGQCNEAEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNI 152
            Y               +   N    + P+ATP+ PE  ++ +     NK  SKE +D +
Sbjct: 152 YYEHSKKRTPPTEQEQFHRGMNPPSPKYPIATPQNPE--ILVQLTENQNKIVSKETYDRL 209

Query: 153 QRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDL 212
            +    H+AWL S   +       + + Y KQ+ VLD++I+  +   N L     R  ++
Sbjct: 210 VQVQSEHDAWLKSYNAENMANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEI 269

Query: 213 NENR 216
           N+N+
Sbjct: 270 NKNK 273

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 44/77 (57%), Gaps = 1/77 (1%)

Query: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK-KYAREIHFPAELTENEMRQRAILQDLDEK 67
           K K  P ++  S++N + P E+GY       K A++I FP  L +NE RQ  +L +L  K
Sbjct: 57  KEKKFPTTSATSNFNKMVPGEMGYSSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIK 116

Query: 68  EQHLDHLKKSQRVVYID 84
           E  L  L+KS RV+ +D
Sbjct: 117 EHKLHELQKSSRVLVLD 133

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 122 VATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEY 181
           VA+PE PE +V     N  +KA    ++D +  +   H+ WL +     +++  TK +EY
Sbjct: 315 VASPENPEYLVRTNEYNIVSKA----VYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEY 370

Query: 182 NKQLAVLDDQIKS--EKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKET 239
             +L  L  Q+    EK  ++N++++Q+  I++ E +              +K K+ KET
Sbjct: 371 EDKLVELQKQLDDIEEKKKISNMKKQQK--IEIMEYQLVKNVLDVQSKYNVDKGKVIKET 428

Query: 240 ERLNF 244
           E +  
Sbjct: 429 ELMKL 433

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 91/189 (48%), Gaps = 25/189 (13%)

Query: 47  PAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVYIDKPVEKEDV---VREPVDIQKVP 103
           P  L EN+ +Q  ILQD+  +E + +HLK  Q+++     +E +D+   +++  D +  P
Sbjct: 290 PNFLIENDSKQHRILQDIITRETNFNHLKNLQKIIS-QSELESQDLTPTMQKIKDSKIYP 348

Query: 104 KIPYSEYGQC------------NEAEF------RNPVATPETPEEVVIYKHLNGTNKAYS 145
           K+ Y  +               N+  +       NP+AT   PE ++    LN      +
Sbjct: 349 KVYYKNFNMTKHPPNINQQLSQNQKIYPPFNPQLNPIATTTNPEILI---KLNDDKTIIT 405

Query: 146 KEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRK 205
           K+ +D +     +H  W+++  G++++   TK + Y ++L  L++QI      ++ +++ 
Sbjct: 406 KQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKD 465

Query: 206 QQRAIDLNE 214
             +  +LN+
Sbjct: 466 TLKNKELND 474

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (56%), Gaps = 4/95 (4%)

Query: 14  PISNPHSSYNTLKPEELGYKQKFPKK-YAREIHFPAELTENEMRQRAILQDLDEKEQHLD 72
           P+ +  S+YNT   +   YK   PKK +AR+I FP+ L +NE RQ  IL DL  K+  LD
Sbjct: 77  PLVSATSTYNTDTKD--VYKDLDPKKNFARDIKFPSRLIDNENRQNQILLDLKIKQDALD 134

Query: 73  HLKKSQRVVYI-DKPVEKEDVVREPVDIQKVPKIP 106
            LK S +V+ + D P + ++   E  D   VP+ P
Sbjct: 135 RLKDSLQVIDVEDLPRDDKEKGEEEKDSDPVPEQP 169

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 1/69 (1%)

Query: 14  PISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQDLDEKEQHLD 72
           P  +  S+     P+ELG+K      K A++I FP  LTENE RQ+ IL++L+ KE  L 
Sbjct: 124 PTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKELELKEGKLQ 183

Query: 73  HLKKSQRVV 81
           +LK SQ+++
Sbjct: 184 YLKDSQKII 192

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 74/177 (41%), Gaps = 30/177 (16%)

Query: 92  VVREPVDIQKVPKIPYSEYGQC--------------------------NEAEFRNPVATP 125
            V  P    KVP+IPY+E  +                           ++++   P+ATP
Sbjct: 363 TVETPQPYDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATP 422

Query: 126 ETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQL 185
           E PE +   +         SK I+D +  D  NH  WL   +     +   KMEEYN +L
Sbjct: 423 ENPELIAKTEEYG----YMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNEL 478

Query: 186 AVLDDQIKSEKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERL 242
             L  +I     +M NL+++    I+++EN               +KNKI+KETE +
Sbjct: 479 EELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENI 535

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 7   GKKRKSSPISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQDLD 65
            KK +  P  +  S ++ + P ELGYK      K A++I FP+ L  NE RQ  I+ DL+
Sbjct: 56  AKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKDISFPSFLIANERRQGGIITDLE 115

Query: 66  EKEQHLDHLKKSQ 78
            KE +L +L+ SQ
Sbjct: 116 LKEANLKYLRNSQ 128

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 59/126 (46%), Gaps = 4/126 (3%)

Query: 119 RNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKM 178
           +NP+++PE PE V+  K     +   SK ++D +Q D   H  WL + E    ++   K 
Sbjct: 354 KNPMSSPENPEYVIKTKQ----HGYLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKK 409

Query: 179 EEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKE 238
            EY   LA +  +I +    M+ L+ K  + I++ E +               KNKI+KE
Sbjct: 410 TEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKE 469

Query: 239 TERLNF 244
           TE +  
Sbjct: 470 TELMKL 475

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (62%), Gaps = 3/78 (3%)

Query: 4   MLLGKKRKSS--PISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAI 60
           +L  ++R++   P ++  S+Y   +PEELGYK+    +K A++I FP  L E E +Q  +
Sbjct: 50  VLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVYLEEIEKKQLEL 109

Query: 61  LQDLDEKEQHLDHLKKSQ 78
           L++L+ KE HL +LK  Q
Sbjct: 110 LRELEVKEAHLRYLKDCQ 127

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 1/106 (0%)

Query: 136 HLNGTNKAY-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKS 194
           H+  T   Y +K I+D I      HN W+   +     +   K  E N+++  L  QIK 
Sbjct: 350 HVVKTKDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLRAQIKE 409

Query: 195 EKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETE 240
            K  M  LR      I+++EN               +KN+++K+TE
Sbjct: 410 IKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTE 455

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 74/158 (46%), Gaps = 10/158 (6%)

Query: 92  VVREPVDIQKVPKIPYSE--YGQCNEAEFRN-PVATPETPEEVVIYKHLNGTNKAY-SKE 147
           V  +P DI++ P++P++   +     ++ R  PVA+P  PE +V +      +K Y SK 
Sbjct: 344 VPEKPKDIKETPRVPFATGIFALWTRSDKRGQPVASPNDPEFIVKF------DKGYMSKA 397

Query: 148 IFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQ 207
           ++D ++ +   H   +     + + +   K  EY  +L  L  QI   +A M  L++   
Sbjct: 398 LYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTT 457

Query: 208 RAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERLNFA 245
             I+++E +             + KN I+KETE +  A
Sbjct: 458 EKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAA 495

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 3   SMLLGKKRKSSPISNPHSSYNTLKPEELGYKQ-KFPKKYAREIHFPAELTENEMRQRAIL 61
           S+   +KRK        +S +     ++GYK     ++ A++I  P  L  N+ RQR  L
Sbjct: 50  SLAAAQKRKMQKFPTVSASVSAHSSSDMGYKVIDAARRRAKDIAVPRYLQGNDERQRRRL 109

Query: 62  QDLDEKEQHLDHLKKSQRVVYI 83
             L+ KE  L + K SQR+V +
Sbjct: 110 DKLERKEDALKYKKDSQRIVDV 131

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 14  PISNPHSSYNTLKPEELGYKQKF-PKKYAREIHFPAELTENEMRQRAILQDLDEKEQHLD 72
           P  +P+S ++ + P+ELGY+      + A++I FP  L ENE RQ  +L +++ +EQ L 
Sbjct: 91  PTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIYLRENEARQDQLLTEVEIREQKLA 150

Query: 73  HLKKSQRV 80
           ++K SQ V
Sbjct: 151 YIKNSQIV 158

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 76/174 (43%), Gaps = 21/174 (12%)

Query: 92  VVREPVDIQKVPKIP-----------YSEYGQCNEAEFR--NPVATPETPEEVVIYKHLN 138
           V   PVD   VP++            +S +G+  +++ R  NP+ATPE PE +++     
Sbjct: 446 VTSPPVDYAAVPRVVTFPEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPE-ILVKTDRE 504

Query: 139 GTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAA 198
           G     SK ++D ++ +   H+ WL         +   K  +Y+ +L  L  +++  + +
Sbjct: 505 GF---LSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEES 561

Query: 199 MNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKETERLNFAIRKHQDK 252
           M  ++      I++   R              +KN I+ ET+    AI+  +DK
Sbjct: 562 MQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETK----AIQDQKDK 611

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 69/153 (45%), Gaps = 10/153 (6%)

Query: 92  VVREPVDIQKVPKIPYSE--YGQCNEAEFRN-PVATPETPEEVVIYKHLNGTNKAY-SKE 147
            +++P +I+  P++P++   +     ++ R  PVA+P+ PE +V +      +K Y SK 
Sbjct: 316 TLQKPKNIKDTPRVPFATGIFALWTRSDKRGQPVASPDDPEFIVKF------DKGYMSKA 369

Query: 148 IFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQ 207
           ++D ++ +   H   +     +  D+   K +EY   L  L  QI   +A M  L+    
Sbjct: 370 LYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTT 429

Query: 208 RAIDLNENRXXXXXXXXXXXXXAEKNKIYKETE 240
             I+++                  KN I+KETE
Sbjct: 430 DKINISAAELSARMIESNAKHSNTKNVIFKETE 462

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 29  ELGYKQ-KFPKKYAREIHFPAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVYIDKPV 87
           E+G+K     +K A++I  P  L  N+ RQR  L  L+ KE  L + K SQ++V +   V
Sbjct: 75  EMGFKVIDAARKRAKDIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKVKGEV 134

Query: 88  EKEDVV 93
            K   V
Sbjct: 135 GKSSTV 140

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 67/152 (44%), Gaps = 16/152 (10%)

Query: 121 PVATPETPEEVVIYKHLNGTNKAY-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179
           PVATPE PE +V       T + Y SK ++D +Q D   H A L     + +++  TK +
Sbjct: 444 PVATPEDPELIV------RTQEGYVSKSVYDKLQYDEDQHQAKLALYSKEQDERYETKAQ 497

Query: 180 EYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRXXXXXXXXXXXXXAEKNKIYKET 239
           EY +++  +  +I    A M  +R + +  + L +                 K  +YK+T
Sbjct: 498 EYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQT 557

Query: 240 ERL-NFAIRKHQDKNRQGILPDDASHDTVTVE 270
           E + N  I   +DK        + +H TV  E
Sbjct: 558 EEIKNQTISDKEDK--------EVAHQTVQSE 581

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 25  LKPEELGYKQKFPK--KYAREIHFPAELTENEMRQRAILQDLDEKEQHLDHLKKSQRVVY 82
           L PE++GY     K  K A++I  P+ L + E  Q+  L  L++KE+ L + +KSQ++V 
Sbjct: 92  LDPEQMGYSVVTDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVD 151

Query: 83  IDKPVE 88
           + KP E
Sbjct: 152 LTKPQE 157

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 45/92 (48%), Gaps = 7/92 (7%)

Query: 121 PVATPETPEEVVIYKHLNGTNKAY-SKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179
           P  TPE PE V++      TN+ Y SK ++D +  +   H   L++ +  A        +
Sbjct: 279 PNGTPEEPEVVLL------TNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQ 332

Query: 180 EYNKQLAVLDDQIKSEKAAMNNLRRKQQRAID 211
            Y K++A LD +I   +A +  L+ + +  ID
Sbjct: 333 HYEKEIADLDAEISKLRADITALQAETEGQID 364

>CAGL0E01903g Chr5 (190465..191754) [1290 bp, 429 aa] {ON} similar
           to uniprot|Q12383 Saccharomyces cerevisiae YOL125w
          Length = 429

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 60/135 (44%), Gaps = 27/135 (20%)

Query: 10  RKSSPISNPHSSY--NTLKPEELGYKQKFPKKYAREIHF-------PAELTENEMRQ--- 57
           R   P+   H+ +  N  K   +  K K  +  A + +F       PAEL ENE+     
Sbjct: 50  RVPCPLDPSHTVWKHNLKKHVRICNKAKITQATAAQPYFIKDLNRGPAELVENELNNANL 109

Query: 58  ----RAILQDLDEKEQHLDHLKK-----SQRVVYIDKPVEK-----EDVVREPVDIQKVP 103
               + +L+ L+E E+  + +KK     S R++ +   ++K       +++   D++ +P
Sbjct: 110 IESVQLLLEALNEYEEPQEQIKKNEFMESNRLIELSNTIKKHAKQQSSLIQNLFDVELIP 169

Query: 104 KIPYSEYGQCNEAEF 118
                E+G C  AEF
Sbjct: 170 SGKIMEFG-CGRAEF 183

>CAGL0J03124g Chr10 (299422..302043) [2622 bp, 873 aa] {ON} highly
           similar to uniprot|Q01217 Saccharomyces cerevisiae
           YER069w ARG5
          Length = 873

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 13/72 (18%)

Query: 58  RAILQ---DLDEKEQ----HLDHLKKSQRVVYIDKPVEKEDVVREPVDIQKVPKIPYSEY 110
           R +LQ   D+  K Q    +L  L+K+Q V Y D+P+E   +VR        PKIP  E 
Sbjct: 383 RNVLQRDADIASKAQSAATYLRELEKAQFVSYSDEPLEALAIVRTE------PKIPKLEK 436

Query: 111 GQCNEAEFRNPV 122
             C+ + + N V
Sbjct: 437 FLCSNSAWLNNV 448

>Kwal_0.214 s0 complement(106526..108769) [2244 bp, 747 aa] {ON}
           YLR176C (RFX1) - DNA binding protein, homologous to
           mammalian RFX1-4 proteins [contig 82] FULL
          Length = 747

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 6   LGKKRKSSPISNPHSSYNTLKPEELGYKQKFPKKYAREIHF-PAELTENEMRQRAILQDL 64
           LG     SPI  P  +  +L     G++Q+FP  +A + HF PA   +N  ++R IL   
Sbjct: 139 LGPGYLPSPIPQPMLNEKSLDLHR-GFQQQFPVFHAPQPHFAPAMEADNSQKKRRILDYP 197

Query: 65  DEKE 68
           D ++
Sbjct: 198 DPRQ 201

>Ecym_1390 Chr1 complement(811179..812516) [1338 bp, 445 aa] {ON}
           similar to Ashbya gossypii AFR444C
          Length = 445

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 5/55 (9%)

Query: 96  PVDIQKVPKIPYSEYGQCNEAEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFD 150
           P++++ V K+ Y       E  FR    T ETPE    Y+ L GT++++S  I +
Sbjct: 10  PLELKAVLKLKY-----LREPLFRTAKDTSETPELKRCYELLEGTSRSFSAVIME 59

>Ecym_2381 Chr2 (738252..739163) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL096W
          Length = 303

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 56/125 (44%), Gaps = 10/125 (8%)

Query: 78  QRVVYIDK----PVEKEDVVREPVDIQKVPKIPYSEYGQCNEAEFRNPVATPETPEEVVI 133
            RV+ +D     P+ K+D   E  +++++P   Y   G+ ++ E   P A+   P   V 
Sbjct: 22  SRVIPVDATWYLPIFKKDGRSEFRNVERIPNAVYFHLGEVSDNE---PKASRMLPTLDVF 78

Query: 134 YKHLN--GTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKMEEYNKQLAVLD-D 190
              ++  G     +  ++D I     +  AW+L+  G +     T   +Y K+   +D D
Sbjct: 79  NGAMSKLGIKSDDTLVVYDRINNFSASRVAWVLTTLGHSKVYLMTGFNQYVKEGYTVDHD 138

Query: 191 QIKSE 195
           ++ S+
Sbjct: 139 KVLSD 143

>KAFR0E04290 Chr5 (866166..867812) [1647 bp, 548 aa] {ON} Anc_4.355
           YJR131W
          Length = 548

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%)

Query: 125 PETPEEVVIYKHLNGTNKA--YSKEIFDNIQRDICNH 159
           PET E ++I  HL G  K   + +EI ++  ++ C H
Sbjct: 433 PETVESIMILYHLTGNQKYREWGQEIMESFDKNTCVH 469

>KLTH0F09570g Chr6 complement(828282..830075) [1794 bp, 597 aa] {ON}
           similar to uniprot|P30777 Saccharomyces cerevisiae
           YGL142C GPI10 Integral membrane protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           putative alpha 1 2 mannosyltransferase required for
           addition of the third mannose onto the GPI core
           structure human PIG-Bp is a functional homolog
          Length = 597

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 100 QKVPKIPYSEYGQCNEAEFRNP--VATPETPEEVVIYKHLN 138
           + +PK  Y  +      E R+P  V T E PE +VI++HL+
Sbjct: 514 ENIPKFVYKNFPPVFRKELRSPGKVYTHEWPEYLVIFQHLD 554

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,155,554
Number of extensions: 1389525
Number of successful extensions: 4114
Number of sequences better than 10.0: 76
Number of HSP's gapped: 4204
Number of HSP's successfully gapped: 98
Length of query: 275
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 167
Effective length of database: 41,097,471
Effective search space: 6863277657
Effective search space used: 6863277657
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)