Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079303.491ON45245215410.0
KAFR0G036803.491ON4152646848e-85
NDAI0B058503.491ON4732935372e-62
Skud_16.4433.491ON4202785332e-62
KLLA0E04621g3.491ON3892785102e-59
Suva_16.4773.491ON4232725097e-59
Smik_16.4013.491ON4272805098e-59
TDEL0D055903.491ON3442744941e-57
KLTH0F14806g3.491ON3582784872e-56
NCAS0F035403.491ON4442654924e-56
YPR148C3.491ON4352784844e-55
SAKL0F02794g3.491ON3972804798e-55
TBLA0D029803.491ON4432894784e-54
TPHA0D032703.491ON3882804701e-53
Kwal_55.212273.491ON3762784586e-52
Kpol_1017.73.491ON3782774482e-50
ZYRO0D10010g3.491ON3822794385e-49
Ecym_12383.491ON3932933844e-41
CAGL0L08492g3.491ON3852873722e-39
AFR309C3.491ON3642913684e-39
Kwal_47.181487.221ON3232371462e-09
KLLA0E04511g7.221ON3021121415e-09
NDAI0A026607.221ON3642391363e-08
KLTH0A03894g7.221ON3231221302e-07
KNAG0D017607.221ON342661283e-07
SAKL0F08162g7.221ON3302371266e-07
CAGL0L00891g7.221ON341661241e-06
Ecym_43777.221ON333641222e-06
TDEL0H022407.221ON338661194e-06
ZYRO0D16522g7.221ON358831186e-06
Kpol_478.227.221ON3501061178e-06
Smik_9.1507.221ON3262331142e-05
Kpol_1070.197.221ON311731132e-05
KAFR0I019507.221ON330661142e-05
TPHA0C012307.221ON305661123e-05
ADL115W7.221ON333661113e-05
Suva_9.1597.221ON325661096e-05
NCAS0A133807.221ON3291001096e-05
Skud_9.1287.221ON329661097e-05
YIL041W (GVP36)7.221ON326661097e-05
TBLA0D042007.221ON331641034e-04
TPHA0B027507.221ON363671034e-04
TBLA0B015807.221ON386621025e-04
TBLA0I011902.472ON83588800.29
TPHA0C007108.341ON93454705.3
TPHA0E010007.375ON512100687.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07930
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   598   0.0  
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   268   8e-85
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   211   2e-62
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   209   2e-62
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   201   2e-59
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   200   7e-59
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   200   8e-59
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   194   1e-57
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   192   2e-56
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   194   4e-56
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   191   4e-55
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   189   8e-55
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   188   4e-54
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   185   1e-53
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   181   6e-52
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   177   2e-50
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   173   5e-49
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   152   4e-41
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   147   2e-39
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   146   4e-39
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    61   2e-09
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    59   5e-09
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     57   3e-08
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    55   2e-07
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    54   3e-07
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    53   6e-07
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    52   1e-06
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    52   2e-06
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    50   4e-06
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    50   6e-06
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    50   8e-06
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    49   2e-05
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    48   2e-05
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    49   2e-05
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    48   3e-05
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    47   3e-05
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    47   6e-05
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    47   6e-05
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    47   7e-05
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    47   7e-05
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    44   4e-04
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    44   4e-04
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    44   5e-04
TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {O...    35   0.29 
TPHA0C00710 Chr3 complement(135151..137955) [2805 bp, 934 aa] {O...    32   5.3  
TPHA0E01000 Chr5 complement(204170..205708) [1539 bp, 512 aa] {O...    31   7.3  

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/452 (70%), Positives = 319/452 (70%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA 60
           MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA
Sbjct: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA 60

Query: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKTQ 120
           KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKTQ
Sbjct: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKTQ 120

Query: 121 DFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKRXXXXXXXXXXXXXX 180
           DFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR              
Sbjct: 121 DFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKREEEAEAAEEEDEAD 180

Query: 181 XXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEI 240
                          IDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEI
Sbjct: 181 DGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEI 240

Query: 241 DFKTVHKLCTRVQDSRLEFDTLRHXXXXXXXXXXARRXXXXXXXXXXXXXSGEPVRKRKS 300
           DFKTVHKLCTRVQDSRLEFDTLRH          ARR             SGEPVRKRKS
Sbjct: 241 DFKTVHKLCTRVQDSRLEFDTLRHKLKLKELEKEARRQVMEEVAEQQAEASGEPVRKRKS 300

Query: 301 RAHGAQGGRXXXXXXXXXXXXXXNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 360
           RAHGAQGGR              ND                                   
Sbjct: 301 RAHGAQGGRKSTTEEAEKTSASENDSSKKSGKASGKSKKGKETAEEPQTEPKEAPPAAEA 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFVSNITAAVEKMTELTDSSELISLVKLF 420
                                           FVSNITAAVEKMTELTDSSELISLVKLF
Sbjct: 361 KEEPPAKETAPAKESNEAEEEENKLLERLEDEFVSNITAAVEKMTELTDSSELISLVKLF 420

Query: 421 QNIQLVHYRQCVQELEASMKSLDELEAESLFE 452
           QNIQLVHYRQCVQELEASMKSLDELEAESLFE
Sbjct: 421 QNIQLVHYRQCVQELEASMKSLDELEAESLFE 452

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  268 bits (684), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 178/264 (67%), Gaps = 24/264 (9%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA 60
           MFSNF+ DK+T++I+ AAQSAQ  I++TIL+PD QTKL F KT R++QEKVG I + EI+
Sbjct: 1   MFSNFNFDKITNSISTAAQSAQQKINDTILTPDVQTKLHFKKTARFWQEKVGQIPDKEIS 60

Query: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKTQ 120
           KLPEGY  L+ K +A+EK+LKRLL+VTKT+E+EGYDYPPN++ESLN WW  D  K KK Q
Sbjct: 61  KLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSDLKKSKKHQ 120

Query: 121 DFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKRXXXXXXXXXXXXXX 180
           +   SS +N SF +AI KA  DS+ IL DLKE+Q+    E ++ +               
Sbjct: 121 E--KSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPEEEVEEEDDDEFL--- 175

Query: 181 XXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEI 240
                              N++  F   SNCYKNID+SKAEMD+MIVKEFN KL  ++  
Sbjct: 176 -------------------NLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINN 216

Query: 241 DFKTVHKLCTRVQDSRLEFDTLRH 264
           DFK V KL T+VQDSRLEFDTLRH
Sbjct: 217 DFKKVSKLRTKVQDSRLEFDTLRH 240

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 48/54 (88%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN  AAVE MTELT++SE+I+LVKLFQN QL+HY+QCVQE+E +MK LD+LE
Sbjct: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQLE 415

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  211 bits (537), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/293 (41%), Positives = 168/293 (57%), Gaps = 39/293 (13%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTI-LSPDAQTKLQFLKTTRYFQEKVGTISEDEI 59
           MFS+FSLDK+T++I NAAQ A +T++N I  + D QTKL     TR FQE++GTI +  I
Sbjct: 1   MFSSFSLDKITNSIGNAAQKATNTLNNAINTATDPQTKLSIKSQTRLFQEQLGTIHD--I 58

Query: 60  AKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN----EDENK 115
           +KLP+ Y+ L+ K++++EK +KR+L+V+KTFE+EGYDYPPN+TES + WWN       ++
Sbjct: 59  SKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHR 118

Query: 116 KKKT------------------------QDFGDSSILNRSFAIAIGKAVLDSQYILSDLK 151
           KK+                          D   SS L RSFA AI K+ +D   I   L 
Sbjct: 119 KKQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLS 178

Query: 152 EQQKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNC 211
            Q+    T+E  +K                                + N+I AF  WSNC
Sbjct: 179 IQE--TATKETTIKDENEAQEEDDEDAGEEEEEDDDDDED------IQNLIKAFESWSNC 230

Query: 212 YKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           YKNIDQ K+EMDSM+ KEFN KL D++  +FK V+ L  +V DSRL+FDT+RH
Sbjct: 231 YKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRH 283

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 48/54 (88%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVS+  +AVE MTE+T+SS +I L+KLFQN QLV+YRQCVQE+EA++K+L+EL+
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELD 471

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  209 bits (533), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 167/278 (60%), Gaps = 29/278 (10%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56
           FS FSL+K+T +I  AA   QDT++N + S      D +T+L     TR+ QE +GT+S+
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLGTVSD 64

Query: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED-- 112
             I+KLP  YQ L++KS+++EKV +R+L+V+KTFE+EGYDYPPN+TES++ WW  N+D  
Sbjct: 65  --ISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKDGW 122

Query: 113 ------ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166
                 EN  KK     D + L RSFA AI KA +D +     LK+ +K  G ++K    
Sbjct: 123 FGSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKA-GLKKK---- 177

Query: 167 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226
                                         D++N+I  F  WS CYKNID+ KAEMDS +
Sbjct: 178 -------SESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTM 230

Query: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           +KEFN+KL  ++  DFK VH+L  +V+DSRL+FDT+R+
Sbjct: 231 IKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRY 268

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 46/54 (85%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN T AVE M E+TDSS+++ LVKLFQN QLV++RQCVQE+EA++K L+ LE
Sbjct: 366 FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSLE 419

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  201 bits (510), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 165/278 (59%), Gaps = 20/278 (7%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISED 57
           MFS  SL+ +T +I+NAAQ  Q+   + I      D +T+L  LK     QE +GT+ + 
Sbjct: 1   MFSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHD- 59

Query: 58  EIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NEDE-- 113
            I++LP  Y+ L++KS+A+EK+ KRLL+VTKTFE+EGYDYPPN+TES N WW  N+D   
Sbjct: 60  -ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIF 118

Query: 114 --NKKK-----KTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166
             +KKK     + ++  ++ +L RSFA A+ KA  DS  IL  LK ++     EE +   
Sbjct: 119 SFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQ--- 175

Query: 167 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226
                                         D++N+I AF  W+ C  +IDQSKAEMDS++
Sbjct: 176 -EGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLM 234

Query: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           VKEFN KL+ ++E DFK  H+L  +VQD+RL FDTLRH
Sbjct: 235 VKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRH 272

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 43/56 (76%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVS  +  VE + ELTDSSE+ISLVKLF N QL+HY+QCV+ LE  ++ L+ L++E
Sbjct: 332 FVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSE 387

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  200 bits (509), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 111/272 (40%), Positives = 165/272 (60%), Gaps = 25/272 (9%)

Query: 8   DKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISEDEIAKL 62
           +K+T +I  AA   QDT+++ + +      D QT+L     TR+ QE +GT+S+  I+KL
Sbjct: 6   NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD--ISKL 63

Query: 63  PEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED-------- 112
           P  YQ L++KS+++EKV KR+L+V+KTFE+EGYDYPPN+TES++ WW  N+D        
Sbjct: 64  PPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKKT 123

Query: 113 ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKRXXXXXX 172
           E+  KK     D + L RSFA AI KA +D +    +L++ +K    ++K+ K+      
Sbjct: 124 EHASKKKDSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQETA 183

Query: 173 XXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQ 232
                                    ++N+I  F  WS CYKNID+ KAEMDSM+VKEFN+
Sbjct: 184 EQEEEEEEEEEEEDDED--------LSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNK 235

Query: 233 KLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           KL  ++  DFK VH+L  +V++SRL+FDT+R+
Sbjct: 236 KLEKLINEDFKKVHELRRKVEESRLKFDTMRY 267

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 47/54 (87%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN TAAVE M E+TDSSE++SLVKLFQN QLV++RQC QE+EA++K L+ +E
Sbjct: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGME 422

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  200 bits (509), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 167/280 (59%), Gaps = 27/280 (9%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56
           FS+FSL+K+T +I  AA    DT++N + +      D QT+L     TR+ QE +GTIS+
Sbjct: 5   FSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTISD 64

Query: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN------ 110
             I+KLP  YQ L++KS+++EKV KR+L+V+KTFE+EGYDYPPN+TES++ WW+      
Sbjct: 65  --ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW 122

Query: 111 ------EDENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKV 164
                 E  NKKK +    D + L RSFA AI KA +D ++   +L+  +K       ++
Sbjct: 123 FGSKKSEITNKKKGSN--HDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKA------EL 174

Query: 165 KRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDS 224
           K+                              D++N+I  F  WS CYKNID+ K EMDS
Sbjct: 175 KKKRESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDS 234

Query: 225 MIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           M+VKEFN+KL  ++  DFK VH+L  +V+ SRL+FDT+R+
Sbjct: 235 MMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRY 274

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 46/54 (85%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN TAAVE M E+ DSSE++ L+KLFQN QLV++RQCVQE+EA++K L+ LE
Sbjct: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 426

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  194 bits (494), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 114/274 (41%), Positives = 156/274 (56%), Gaps = 49/274 (17%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS-PDAQTKLQFLKTTRYFQEKVGTISEDEIA 60
            SNFSL+K+T T+ NAA   QDT+++ I +  D Q KL     TRY QE +GTI  D+ +
Sbjct: 5   LSNFSLNKITDTLANAAHKTQDTLNSAIANVSDPQAKLSLKARTRYLQETLGTI--DDKS 62

Query: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED------ 112
           KLP  YQ L++KS+A+EK  KR+L+VT+TFE+EGYDYPPN+TES++ WW  N+D      
Sbjct: 63  KLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGWFGTK 122

Query: 113 --ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKRXXXX 170
             E  K  + D G  + L RSF+ AI KA  D   + ++L+E       +E         
Sbjct: 123 KPEKTKNDSSD-GSDAFLPRSFSQAISKAANDCNSVFTNLQEHGDEDEEDED-------- 173

Query: 171 XXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEF 230
                                      ++N+   F  WS CYKNID+ K EMDSMI KEF
Sbjct: 174 ---------------------------VSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEF 206

Query: 231 NQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           N KL  ++  DFK VH    +V++SRL+FDT+R+
Sbjct: 207 NTKLEKIINEDFKKVHASRKKVEESRLKFDTVRY 240

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 47/56 (83%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVSN TAAVE M E+T+S+E++ L KLFQN QLV++RQCVQE+EAS+K L  LE++
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGALESD 342

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  192 bits (487), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 160/278 (57%), Gaps = 47/278 (16%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58
           F  FSL+KLT++ITN A   QDT+   I +    D Q KL       Y QE +GTI  ++
Sbjct: 5   FGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI--ED 62

Query: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDE----- 113
           I+KLP  YQ L++K +++EKV +R+LVVTKT+E+EGYDYPPN++ESL+ WW+ ++     
Sbjct: 63  ISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGLFG 122

Query: 114 -----NKKKKTQDFGDS--SILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166
                 K+KK +   DS  +++ RSFA AI KA  DS  +++ LK       TEE+K   
Sbjct: 123 FVSSSKKEKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALK-------TEEQKA-- 173

Query: 167 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226
                                         D+ ++I  F  WS C  N+DQSKAEMD+++
Sbjct: 174 ---------------------SAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALM 212

Query: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           VKEFN KLT  +E  FK    L  +V+DSRL+FDT+R+
Sbjct: 213 VKEFNHKLTAFVEEKFKNARTLRKKVEDSRLKFDTMRY 250

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 46/56 (82%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVSN T AVE M E+TDS+E+I+LVKLF N QL++Y+QCVQ LE S+ SL+ELE +
Sbjct: 301 FVSNTTEAVETMGEITDSAEIINLVKLFHNFQLIYYKQCVQNLETSINSLNELEGD 356

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  194 bits (492), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 152/265 (57%), Gaps = 23/265 (8%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSP-DAQTKLQFLKTTRYFQEKVGTISEDEI 59
           MFSNFSLDK+T+++  AAQ   DT+ N I +  D  TKL      R FQE +GT+ +  I
Sbjct: 1   MFSNFSLDKITNSLATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHD--I 58

Query: 60  AKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENKKKKT 119
           + LPE Y  L+ +++A+EK L+R+L+V+KTFE+EGYDYPPN++ES + WW+    KKK+ 
Sbjct: 59  STLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQ 118

Query: 120 QDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKRXXXXXXXXXXXXX 179
           +       L RSFA AI  +  D   I      Q    G +E K +              
Sbjct: 119 EKEDKKGFLPRSFAQAISNSAEDCVEIY-----QHVNDGDDEDKEENANNEEENEEEDEE 173

Query: 180 XXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLE 239
                             + N+I  F  W+ CYKNIDQ KAEMDSM++KEFN KL  +L 
Sbjct: 174 DED---------------VKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLN 218

Query: 240 IDFKTVHKLCTRVQDSRLEFDTLRH 264
            +FK VH L  RV+DSRL+FDT+R+
Sbjct: 219 EEFKKVHTLRKRVKDSRLKFDTVRY 243

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 48/54 (88%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVS+  +AVE M E+TDSSE+I LVKLFQN QLV+YRQCVQE+EA++K+L+ELE
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNELE 443

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  191 bits (484), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 116/278 (41%), Positives = 167/278 (60%), Gaps = 20/278 (7%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56
           FS FSL+K+T +I  AA   QDT++N + +      D QT+L     TR+ QE +GT+S+
Sbjct: 5   FSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLGTVSD 64

Query: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW--NED-- 112
             I+KLP  YQ L++KS+++EKV KR+L+V+KTFE+EGYDYPPN+TES++ WW  N+D  
Sbjct: 65  --ISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGW 122

Query: 113 ------ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166
                 E+  KK     D + L RSFA AI KA +D +    +L+  +K    ++K+  +
Sbjct: 123 FGSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKKKESIK 182

Query: 167 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226
                                          ++N+I  F  WS CYKNID+ KAEMDSM+
Sbjct: 183 TAQTTEAQGADHNEEDEEDEEDEEDDED---LSNLIKVFDSWSTCYKNIDEGKAEMDSMM 239

Query: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           VKEFN+KL  ++  DFK VH L  +V++SRL+FDT+R+
Sbjct: 240 VKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 37/54 (68%), Positives = 47/54 (87%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN TAAVE M E+TDSSE++ L+KLFQN QLV++RQCVQE+EA++K L+ LE
Sbjct: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGLE 434

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  189 bits (479), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 158/280 (56%), Gaps = 48/280 (17%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58
           FS+FSLDKLT++I++AA   QD +   I +    D Q KL       Y QE +G I  D+
Sbjct: 5   FSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI--DD 62

Query: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNED------ 112
           I+KLP  YQ L++K +++EK+ +R+LVVTKTFE+EGYDYPPN++ES++ WW  +      
Sbjct: 63  ISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGLLS 122

Query: 113 -------ENKKKKTQDFGDS-SILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKV 164
                  E  + K ++  ++   L RSFA A+ KA  DS  +L  LK++QK         
Sbjct: 123 FMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQK--------- 173

Query: 165 KRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDS 224
                                           D+N++I+ F  WS C + IDQ KAEMDS
Sbjct: 174 --------------------EPPQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDS 213

Query: 225 MIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           ++ KEFN+KL  ++  DFK VH L  +V++SRL+FDTLR+
Sbjct: 214 LMAKEFNKKLDKLINEDFKKVHSLRKKVEESRLKFDTLRY 253

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 45/56 (80%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVS+ T AVE M E+TDSSE++SLVKLF   QL+++RQCVQELEAS K LD L+ E
Sbjct: 342 FVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDNE 397

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  188 bits (478), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 156/289 (53%), Gaps = 52/289 (17%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS-----PDAQTKLQFLKTTRYFQEKVGTISE 56
           FSNFSLDKL  ++ +AAQ  QDT+ N I +      D QT+L  L    Y QE +G I  
Sbjct: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQI-- 87

Query: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW------- 109
           +EI+KLP  Y  L+ K++A+EK++KR+L+VT TFE+EGYDYPPN++ES++ WW       
Sbjct: 88  NEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAF 147

Query: 110 ---NEDENKKKKTQDFGDSS-----------ILNRSFAIAIGKAVLDSQYILSDLKEQQK 155
              N++ N K K+      +            L RSF  AI KA  DS  IL++L   +K
Sbjct: 148 LRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNNEK 207

Query: 156 TRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNI 215
               + K                                      +I  F  WS C KNI
Sbjct: 208 LEFAKTKTEDEEYEDDEDIQL------------------------LIKVFDSWSLCNKNI 243

Query: 216 DQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           D+SK + D +I+K+FN+KLT +L+++FK V  L  +VQD+RL+FDT+R+
Sbjct: 244 DKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 46/56 (82%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVS+ +AAVE M E+T+SS+++ L+KLFQN QL+HY+QC++E+E +MK L +L  E
Sbjct: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTHE 443

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  185 bits (470), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 114/280 (40%), Positives = 158/280 (56%), Gaps = 40/280 (14%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHN----------TILSPDAQTKLQFLKTTRYFQEK 50
           MFSNFSLDKLT +I+N A   Q+   N          TIL+ D  TKL     +RY QE+
Sbjct: 1   MFSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILN-DPNTKLSIRARSRYIQEQ 59

Query: 51  VGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN 110
           +GT+ +DEI+KLP+ Y  L+ K++++EK+LKRLL+VT TF  EGYDYPPN+TES++ WW 
Sbjct: 60  LGTL-DDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA 118

Query: 111 EDENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILS------DLKEQQKTRGTEEKKV 164
           EDE  + K       + L RSFA A+ KA  DS+ I         L+   K  GT+++  
Sbjct: 119 EDETTENK-------NFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSPKNTGTKDENP 171

Query: 165 KRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDS 224
           +                                +  +  AF   SN + NID  K EMD+
Sbjct: 172 EAGAEEEVEADDDEEDED---------------LVTLGKAFKALSNSFTNIDNGKNEMDT 216

Query: 225 MIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           MIV EFN+KL  +LE++FK V +L   V++SRL+FDT+R+
Sbjct: 217 MIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRY 256

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 48/54 (88%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN ++AVEKM ELTDS++++ LVKLFQN QLV+YRQCVQE+E ++K++ +LE
Sbjct: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  181 bits (458), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 106/278 (38%), Positives = 153/278 (55%), Gaps = 47/278 (16%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58
           F  FS +KLT T+TNAA   QDT+   I +    D Q  L       Y QE +GTI  ++
Sbjct: 5   FGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI--ED 62

Query: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNED------ 112
           I+KLP  YQ L++K +++EK  +R+LVVTKTFE+EGYDYPPN++ESL+ WW+ +      
Sbjct: 63  ISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFG 122

Query: 113 ------ENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKR 166
                 ++K  ++     S+++ RSFA AI KA  DS  +L+ LK+Q++    +E+    
Sbjct: 123 LMSSSKKDKGAESAAAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDEDE 182

Query: 167 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMI 226
                                          +  +I  F  WS C   IDQ KAEMD+++
Sbjct: 183 D------------------------------ITPLIKMFSAWSECQYKIDQGKAEMDALM 212

Query: 227 VKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
            KEFNQKL  ++E  FK    L  +V+DSRL+FDT+R+
Sbjct: 213 AKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMRY 250

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 48/56 (85%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVSN T AVE M E+TDS+EL++LVKLF N QLV++RQCVQ+LEAS+ +L+ELE E
Sbjct: 319 FVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGE 374

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  177 bits (448), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 107/277 (38%), Positives = 149/277 (53%), Gaps = 41/277 (14%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILS---------PDAQTKLQFLKTTRYFQEKV 51
           MFS FS+DKLT +I+N A   Q+ + N + +          D  TKL      R+ QEK+
Sbjct: 1   MFSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKL 60

Query: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE 111
           GTI+ D+ +KLP  Y  L+ K++A+EK LKRLL VTKT+E EGYDYPPN+TESL+ WW  
Sbjct: 61  GTIN-DQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTN 119

Query: 112 DENKKKKTQDF----GDSSILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVKRX 167
           D+N     ++      + S L RSFA AI  A  D+    S++     T     K  +  
Sbjct: 120 DDNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAA---SNVNSVTNTIKLNHKDDEEE 176

Query: 168 XXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSMIV 227
                                        D++ +  + G   NCY+NID  K EMD +IV
Sbjct: 177 EEDDEEWS---------------------DLHKIFESLG---NCYRNIDNGKTEMDKLIV 212

Query: 228 KEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
            EFN KL D++  +FK VH+L   V++SRL+FDT+R+
Sbjct: 213 NEFNNKLKDLINTEFKNVHQLRKSVENSRLKFDTMRY 249

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 47/54 (87%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN   AVEKM ELTD+S++I+LVKL+QN QLV+Y+QC+QE+E+++K L+ LE
Sbjct: 324 FVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  173 bits (438), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 149/279 (53%), Gaps = 52/279 (18%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58
           FS+FS   L  +I NAA   QD + N + +    D QT+L     TRY +E +G +  DE
Sbjct: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV--DE 62

Query: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN-------- 110
           I+KLP  Y  L+ KS+A+EK  KR+L+VT+TFE+EGYDYPPN+ ES + WW+        
Sbjct: 63  ISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFG 122

Query: 111 ---EDENKKKKTQDFGDS--SILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVK 165
              +DE+ + K Q  G S   ++ RSFA AI KA  +           Q ++ +E+K++ 
Sbjct: 123 STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAY------QNSQKSEKKQID 176

Query: 166 RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQSKAEMDSM 225
                                          D  N++  F   S CY+NID+ K EMD  
Sbjct: 177 EDE----------------------------DDVNLVEMFNTLSICYRNIDEGKDEMDKS 208

Query: 226 IVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           I +EFN KL  +L  DFK +H L  +V++SRL+FDT+R+
Sbjct: 209 IAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRY 247

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 46/54 (85%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN + AVE MT + + SE++ L+KLFQN+QLV+YRQCVQE+EAS+K L++LE
Sbjct: 328 FVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  152 bits (384), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 140/293 (47%), Gaps = 61/293 (20%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNT----------ILSPDAQTKLQFLKTTRYFQEKV 51
           FSNFSLDK+ STI  AA   Q  ++ T          I   D QT L         QE +
Sbjct: 5   FSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQLQETL 64

Query: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNE 111
           GTI +  I+KLP  YQ L+ K +A EKV  R+LVV+KTFE++GYDYPPN+ ES++ WW  
Sbjct: 65  GTIKD--ISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWWGS 122

Query: 112 DENKKKKTQDFGDSS--------------------ILNRSFAIAIGKAVLDSQYILSDLK 151
              K      FG  S                     +  SFA AI KA  DS  IL +L 
Sbjct: 123 SSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILKELN 182

Query: 152 EQQKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNC 211
           E+Q    +   + +                               D+++++     W+  
Sbjct: 183 EEQLVNPSNGAETEDE-----------------------------DVDSLMPILEAWAEA 213

Query: 212 YKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
             NID++K +MD  ++ EFN+KL  ++  DF  V  L  +V++SRL+FDTLR+
Sbjct: 214 QSNIDEAKQQMDQFMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRY 266

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 42/56 (75%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448
           FVSN T AV  MT++TDS  L +LVKLF N QL+++++CVQEL+AS+  ++ L  E
Sbjct: 333 FVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTVE 388

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  147 bits (372), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 147/287 (51%), Gaps = 69/287 (24%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIA 60
           MF  F+L+ +T +I+   QS     +      D +TKL     TR+ QE +G  +E +I+
Sbjct: 1   MF-KFNLESITQSISEGTQSLVQQFN------DPKTKLSIKAKTRFLQEAIG--NERDIS 51

Query: 61  KLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWW----------- 109
           KLP  Y  L++K +++EKVLKR+L+VTKT+E+EGYDYPPN++ESL+ WW           
Sbjct: 52  KLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISEL 111

Query: 110 ---------NEDENKKKKTQDFGDSSILNR---SFAIAIGKAVLDSQYILSDLKEQQKTR 157
                    N ++   + ++   D  + +    SFA AI +A  DSQ I   ++ + +  
Sbjct: 112 TKNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDE 171

Query: 158 GTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYKNIDQ 217
             +                                     ++ ++  F +WS+C+  I  
Sbjct: 172 KED-------------------------------------IDELVKIFKIWSDCFYEISD 194

Query: 218 SKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           SK EMD M++KEFN KL D L+ +F+ +H L  +V++SRL FDT+R+
Sbjct: 195 SKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRY 241

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 43/54 (79%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN T AVE MTE++++SEL+SL+KLFQ  QL +++ CV+ LE S+K L+ ++
Sbjct: 331 FVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAID 384

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  146 bits (368), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 149/291 (51%), Gaps = 64/291 (21%)

Query: 2   FSNFSLDKLTSTITNAAQSAQDTIHNT----------ILSPDAQTKLQFLKTTRYFQEKV 51
           F   SLDKL +T+ NAAQ  Q  +  T          I   D +T L      R  QE +
Sbjct: 5   FGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETL 64

Query: 52  GTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN- 110
           G  S  +I++LP  Y  L+ K +A+E+V K++LVV+KTFE+EGYDYPPN TES++ WWN 
Sbjct: 65  G--SAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNT 122

Query: 111 -----------------EDENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLKEQ 153
                            + E+K+K+     D      SFA A+ +A   SQ I+ +LKEQ
Sbjct: 123 STKETRFLKFGKGGTDKQKEDKQKQAAGSSDPP----SFAHALHRAAKGSQGIIQELKEQ 178

Query: 154 QKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSNCYK 213
            +    +E ++                                D+ ++I  FG W++   
Sbjct: 179 AEEEQEQEVEIDE------------------------------DVESLIKMFGTWADAQY 208

Query: 214 NIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRH 264
           N+D +K EMD  +VKEFN+KL  +LE++FK  H L  +V++SRL FDTL++
Sbjct: 209 NMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKY 259

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/54 (64%), Positives = 43/54 (79%)

Query: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446
           FVSN   AVE MT + D+++LISLVKLFQN QLV++R+CVQELE S+ SL  LE
Sbjct: 308 FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 95/237 (40%), Gaps = 65/237 (27%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G +++  I++LP+ Y  L+ K + M+ V +  L VT+ +E E YDYP NV 
Sbjct: 59  TQRLMQEKLGQVTD--ISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVR 116

Query: 103 ESLNHW----------------WNEDENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYI 146
           +S+N +                 NE ++         D   LN     A+ K  L S   
Sbjct: 117 DSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGPHKDPKTLN----YALSKVALTSSEY 172

Query: 147 LSDLKEQQKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFG 206
           L+      K+ G E+ +V                                      S+  
Sbjct: 173 LN------KSPGAEDSEVS-------------------------------------SSLL 189

Query: 207 LWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
            +S+    I Q++   D++I  +FN+KL   L  D     K    V++ RL++D  R
Sbjct: 190 KYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIAR 246

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 66/112 (58%), Gaps = 12/112 (10%)

Query: 2   FSNFS--LDKLTSTITNAAQSAQ-DTIHNTILSPDAQTKLQFL--KTTRYFQEKVGTISE 56
           F +FS  + +L+++++  AQ AQ D         D +T L  L   T R  QEK+G +++
Sbjct: 5   FDSFSKKVQELSTSVSQKAQEAQLDQKFK-----DLKTNLPLLANSTQRMLQEKLGQVTD 59

Query: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHW 108
             I++LP+ Y +L+ + E ++ + +  L VTK +E E YDYP NV ES++ +
Sbjct: 60  --ISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEF 109

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +S+    I Q + + D+MI  +FN+ + + LE D +T  K    V+  RL++D +R
Sbjct: 172 YSDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVR 227

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 102/239 (42%), Gaps = 40/239 (16%)

Query: 32  PDAQTKLQFLKTTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFE 91
           PD  +  Q   T R  QE++G +++  I++LPE Y +L+ K + ++ V    L VT TFE
Sbjct: 34  PDINSLAQ--STQRMVQERLGQVTD--ISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFE 89

Query: 92  LEGYDYPPNVTESLNHWWNEDENKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYILSDLK 151
            + YDYP    ES+               +F  S++ ++   ++   +  ++Q IL++  
Sbjct: 90  HQSYDYPNVARESV--------------IEFSKSAV-SKVEELSHATSASEAQQILTNNS 134

Query: 152 EQQKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGL---- 207
            Q K   T    + +                              D NN  S F L    
Sbjct: 135 NQIKEPKTLNYALSKASLISSEQLNKQFSTD--------------DDNNSNSDFKLVSSI 180

Query: 208 ---WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
              +S+    I Q++ + D +I ++FN  L + L   F+   K+   VQ+ RL++D  R
Sbjct: 181 LLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVAR 239

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 63/122 (51%), Gaps = 17/122 (13%)

Query: 2   FSNFS------LDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFL---------KTTRY 46
           F+NF+      L +L+S ++  AQ AQ       LS     + Q L          T R 
Sbjct: 3   FNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQRTQDLTTQLPSFAQSTQRL 62

Query: 47  FQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLN 106
            QEK+G +++  I++LP+ Y  L+ K + +  V +  L VT+ +E E YDYP NV +S+N
Sbjct: 63  VQEKLGQVTD--ISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 107 HW 108
            +
Sbjct: 121 EF 122

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G +++  I++LP+ Y  L+++ +A++ V +  L VT  +E E YDYP  V 
Sbjct: 40  TQRLVQEKLGQVTD--ISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVR 97

Query: 103 ESLNHW 108
           +S+N W
Sbjct: 98  DSVNEW 103

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 92/237 (38%), Gaps = 66/237 (27%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I++LP+ Y  L+ + + +  V +  L VT+ +E E YDYP NV 
Sbjct: 59  TQRLVQERLGQVTD--ISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVR 116

Query: 103 ES--------------LNHWWNEDE--NKKKKTQDFGDSSILNRSFAIAIGKAVLDSQYI 146
           +S              L+H  + DE  N         D   LN     A+ K  L S   
Sbjct: 117 DSVNEFSKTVSSKLHELSHASSTDEAQNILISPGPAKDPKTLN----YALSKVALTSSEY 172

Query: 147 LSDLKEQQKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFG 206
           LS    + +T  T                                            A  
Sbjct: 173 LSKSGHEDETIAT--------------------------------------------ALL 188

Query: 207 LWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
            +S+    I Q++ + D++I  +FN+KL + L  D     K    V++ RL++D  R
Sbjct: 189 KYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIAR 245

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G +++  I++LP+ Y  L+ K + ++ V +  L VT  +E E YDYP  V+
Sbjct: 40  TQRMVQEKLGQVTD--ISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVS 97

Query: 103 ESLNHW 108
           ES+N +
Sbjct: 98  ESVNEF 103

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 43/64 (67%), Gaps = 2/64 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G I++  I+++PE Y  ++++ + +  + +  L VT+ +E E YDYP +V+
Sbjct: 59  THRMVQEKLGQITD--ISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVS 116

Query: 103 ESLN 106
           ES+N
Sbjct: 117 ESVN 120

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +S+    I Q++ + D +I   FN++L + L  +F    +    V + RL++D  R
Sbjct: 190 YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I++LP  Y  L+ K + ++ + +  L VT  +E E YDYP  VT
Sbjct: 40  TQRLVQERLGQVTD--ISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVT 97

Query: 103 ESLNHW 108
           ES+N +
Sbjct: 98  ESVNDF 103

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +S+    + Q++ + D+MI   FN++L D LE +FK   K    V+  RL++D  R
Sbjct: 172 YSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 3/83 (3%)

Query: 27  NTILSPDAQTKLQFLKTT-RYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLV 85
           +T +S  AQ   Q +  T RY QEK+G  ++  I+++P+ Y  L  K +A++ +    L 
Sbjct: 18  STTVSGKAQEFSQGIPVTHRYMQEKLGHATD--ISEMPQEYIDLTTKVDAIKLIYNHFLQ 75

Query: 86  VTKTFELEGYDYPPNVTESLNHW 108
           VT+ ++ E YDYP  + ES+N +
Sbjct: 76  VTQVYDNESYDYPKYINESINEF 98

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 31/56 (55%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +S+    + Q++   DS++   FN KL + ++ + K  H++   V++ RL +D  R
Sbjct: 167 YSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRAHRVRRDVENKRLTYDASR 222

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 24/106 (22%)

Query: 10  LTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIAKLPEGYQRL 69
           LTSTI   AQS                      T R  +EK+G +  D+I+ LP+ Y  L
Sbjct: 24  LTSTIPTVAQS----------------------THRMVKEKLGQV--DDISPLPQEYLDL 59

Query: 70  QEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNEDENK 115
           + K +  + V +  L +T  +E E YDYP   +ES+N + +   NK
Sbjct: 60  ELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVNEFTDSIGNK 105

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 91/233 (39%), Gaps = 57/233 (24%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I++LP  Y  L+EK + ++ +    L VT  +E   YDYP  + 
Sbjct: 35  TQRMVQERLGQVTD--ISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 103 ESLNHWWNEDENKKKKTQDFGDSS----IL--------NRSFAIAIGKAVLDSQYILSDL 150
           ES+N +     +K  +      +S    IL         ++   A+ K  L+S   L+  
Sbjct: 93  ESVNEFSRSVASKLTELTHATSASEAQNILVAPGPIKEPKTLNYALSKVALNSSECLN-- 150

Query: 151 KEQQKTRGTEEKKVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDMNNMISAFGLWSN 210
               K   TEE+ +                                      SA   +S+
Sbjct: 151 ----KMLPTEEQPLA-------------------------------------SALLQFSD 169

Query: 211 CYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
               I Q++ + D++I  +FN+ L + L  +     K    V   RL +D  R
Sbjct: 170 VQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 2/73 (2%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G +++  I++LP+ Y  L+ + + ++ V +  L +T  +E E YDYP  V+
Sbjct: 39  TQRLVQEKLGNVTD--ISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVS 96

Query: 103 ESLNHWWNEDENK 115
           +S+N +     NK
Sbjct: 97  DSVNDFSKVFANK 109

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +S+    I Q++   D++I  +FN++L + LE+D     K    VQ  RL++D  R
Sbjct: 171 FSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVAR 226

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G +++  I++LP+ Y  L++K ++++ + +  L VT  +E E YDYP  + 
Sbjct: 40  TQRLVQEKLGQVTD--ISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIK 97

Query: 103 ESLNHW 108
           +S+N +
Sbjct: 98  DSVNDF 103

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +SN    I Q++ + D++I  +FN+ L D L       +K    VQ+ RL++D  R
Sbjct: 173 FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QEK+G +++  I++LP+ Y  L+++ + ++ V +  L +T  ++ E YDYP  V+
Sbjct: 39  TQRLVQEKLGNVTD--ISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVS 96

Query: 103 ESLNHW 108
           +S+N +
Sbjct: 97  DSVNDY 102

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 43/66 (65%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I+++PE Y  L+++ +  + +    L V++ +E E YDYP +++
Sbjct: 59  TQRRVQERLGQVTD--ISQMPEEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHIS 116

Query: 103 ESLNHW 108
           +S+N +
Sbjct: 117 DSVNDF 122

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 29/56 (51%)

Query: 208 WSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLR 263
           +S+    I Q++ + D++I   FN++L + L   F    +   +V   RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I++LP  Y  L++K + ++ +    L VT  +E   YDYP  + 
Sbjct: 35  TQRMVQERLGQVTD--ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 103 ESLNHW 108
           ES+N +
Sbjct: 93  ESVNEF 98

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 13/100 (13%)

Query: 6   SLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTISEDEIAKLPEG 65
           +L +L+ST++   Q     + N   S           T R  QE++G +++  I++LPE 
Sbjct: 14  TLSELSSTVSQKTQELSTNLPNLAQS-----------TQRMVQERLGQVTD--ISQLPEE 60

Query: 66  YQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESL 105
           Y  L+ K ++++++    L V+  +E + YDYP    ESL
Sbjct: 61  YLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESL 100

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%)

Query: 203 SAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTL 262
           SA   +SN    I Q++ + D +I ++FN  L   L  +     K+   VQ  RL++D  
Sbjct: 169 SALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIA 228

Query: 263 R 263
           R
Sbjct: 229 R 229

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I++LP  Y  L++K + ++ +    L VT  +E   YDYP  + 
Sbjct: 35  TQRMVQERLGQVTD--ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 103 ESLNHW 108
           ES+N +
Sbjct: 93  ESVNEF 98

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  QE++G +++  I++LP  Y  L++K + ++ +    L VT  +E   YDYP  + 
Sbjct: 35  TQRMVQERLGQVTD--ISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYIN 92

Query: 103 ESLNHW 108
           ES+N +
Sbjct: 93  ESVNEF 98

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 40/64 (62%), Gaps = 2/64 (3%)

Query: 45  RYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTES 104
           R  QEK+G I++  I+++P  Y  L+++ + ++  ++ LL VT+ +E   YD+P +  ES
Sbjct: 41  RLAQEKLGQITD--ISQMPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQES 98

Query: 105 LNHW 108
           +  W
Sbjct: 99  VQDW 102

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 43  TTRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVT 102
           T R  +EK+G   +  I+ LP+ Y  L+ K + M+++ +  L VT  +E E YDYP    
Sbjct: 35  TQRLMKEKLGQAKD--ISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFG 92

Query: 103 ESLNHWW 109
           ES   +W
Sbjct: 93  ES---FW 96

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 2/62 (3%)

Query: 47  FQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLN 106
            QEK G +++  I+ LP+ Y  L+++ ++++ V    L +T  +E E YDYP +V +S+ 
Sbjct: 1   MQEKFGQVTD--ISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSIT 58

Query: 107 HW 108
            +
Sbjct: 59  EF 60

>TBLA0I01190 Chr9 complement(254681..257188) [2508 bp, 835 aa] {ON}
           Anc_2.472 YMR089C
          Length = 835

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (55%), Gaps = 10/88 (11%)

Query: 44  TRYFQEKVGTISEDEIAKLP-EGYQR----LQEKSEAMEKVLKRLL---VVTK--TFELE 93
           T+ F E+   I + E+ ++  E +QR    L+EKSEA+EKV + LL   V+T+    EL 
Sbjct: 729 TKPFSEETADIVDAEVQRITNECHQRCVNLLKEKSEAVEKVAQLLLKKEVLTREDMIELL 788

Query: 94  GYDYPPNVTESLNHWWNEDENKKKKTQD 121
           G    P   ++ + + NE + KK K Q+
Sbjct: 789 GKRPFPERNDAFDKYLNEKQTKKIKEQE 816

>TPHA0C00710 Chr3 complement(135151..137955) [2805 bp, 934 aa] {ON}
           Anc_8.341 YLR138W
          Length = 934

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 1   MFSNFSLDKLTSTITNAAQSAQDTIHNTILSPDAQTKLQFLKTTRYFQEKVGTI 54
           ++SN +L+KLT  ++NA+  +   I      P    K      +RY+  KVG I
Sbjct: 711 IYSNQNLNKLTRIVSNASSKSFGAIKTAFSPPPPDEKRNDNNKSRYYAYKVGDI 764

>TPHA0E01000 Chr5 complement(204170..205708) [1539 bp, 512 aa] {ON}
           Anc_7.375 YER090W
          Length = 512

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 8/100 (8%)

Query: 44  TRYFQEKVGTISEDEIAKLPEGYQRLQEKSEAMEKVLKRLLV-----VTKTFELEGYDYP 98
            RYF+ K     +D + K+PE Y  L +   A + V +R  +     +++T   EGY   
Sbjct: 139 VRYFEPKTARPLKD-VLKVPEAYLMLCDTIIAFDHVFQRFQIIHNINISQTTLSEGYSLA 197

Query: 99  PNVTESLNHWWNEDENKKKKTQDFGDSSILNRSFAIAIGK 138
            NV E++ +   +D +     +       LN+ F   +GK
Sbjct: 198 TNVIENIINILRDDSSPIPYPKQ--GPIKLNQDFESNVGK 235

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,003,792
Number of extensions: 1109071
Number of successful extensions: 4028
Number of sequences better than 10.0: 67
Number of HSP's gapped: 4118
Number of HSP's successfully gapped: 115
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)