Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079253.484ON64643367e-43
YGR035C4.178ON11643640.31
TBLA0A107004.385ON58722650.33
Smik_10.2985.133ON34930582.8
NOTE: 11 genes in the same pillar as KNAG0A07925 were not hit in these BLAST results
LIST: Kpol_YGOB_YPR145C-A KAFR0G03675 Skud_16.440 Smik_16.397 YPR145C-A NCAS0F03520 Suva_16.475 Agos_YGOB_YPR145C-A TPHA0D04205 NDAI0B05820 Cgla_YGOB_Anc_3.484

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07925
         (64 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07925 Chr1 complement(1264926..1265120) [195 bp, 64 aa] {ON}    134   7e-43
YGR035C Chr7 complement(557072..557422) [351 bp, 116 aa] {ON} Pu...    29   0.31 
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    30   0.33 
Smik_10.298 Chr10 complement(464213..465262) [1050 bp, 349 aa] {...    27   2.8  

>KNAG0A07925 Chr1 complement(1264926..1265120) [195 bp, 64 aa]
          {ON}
          Length = 64

 Score =  134 bits (336), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 64/64 (100%), Positives = 64/64 (100%)

Query: 1  MAEQSRIMTSLTANPSFLRMKIPFCKIGSTSTESNKHKNHPSKITRYDLLARDLEYSRRH 60
          MAEQSRIMTSLTANPSFLRMKIPFCKIGSTSTESNKHKNHPSKITRYDLLARDLEYSRRH
Sbjct: 1  MAEQSRIMTSLTANPSFLRMKIPFCKIGSTSTESNKHKNHPSKITRYDLLARDLEYSRRH 60

Query: 61 HPLK 64
          HPLK
Sbjct: 61 HPLK 64

>YGR035C Chr7 complement(557072..557422) [351 bp, 116 aa] {ON}
          Putative protein of unknown function, potential Cdc28p
          substrate; transcription is activated by paralogous
          transcription factors Yrm1p and Yrr1p along with genes
          involved in multidrug resistance
          Length = 116

 Score = 29.3 bits (64), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 8/43 (18%)

Query: 16 SFLR------MKIPFCKIGSTST--ESNKHKNHPSKITRYDLL 50
          SF+R      M  P   + +T T  +S+ H + PSKITRYDL+
Sbjct: 27 SFMRAIVSSLMVKPITSLTNTVTCRQSSHHNSSPSKITRYDLI 69

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 29.6 bits (65), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 14/22 (63%)

Query: 17  FLRMKIPFCKIGSTSTESNKHK 38
           +LR K+P C+ G T  ESN  K
Sbjct: 530 YLRDKVPLCEAGGTGNESNGAK 551

>Smik_10.298 Chr10 complement(464213..465262) [1050 bp, 349 aa] {ON}
           YJR019C (REAL)
          Length = 349

 Score = 26.9 bits (58), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 20/30 (66%)

Query: 17  FLRMKIPFCKIGSTSTESNKHKNHPSKITR 46
           F++++ P   +  T  ES+ HK+HP +I++
Sbjct: 210 FVKVRPPITTVEHTVDESSLHKHHPYRISK 239

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.128    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,417,061
Number of extensions: 191282
Number of successful extensions: 651
Number of sequences better than 10.0: 10
Number of HSP's gapped: 651
Number of HSP's successfully gapped: 10
Length of query: 64
Length of database: 53,481,399
Length adjustment: 37
Effective length of query: 27
Effective length of database: 49,238,757
Effective search space: 1329446439
Effective search space used: 1329446439
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)