Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A079203.483ON57857830400.0
KAFR0G036703.483ON57257626700.0
Kpol_480.193.483ON57457726540.0
TDEL0D055203.483ON57357726350.0
NCAS0F035103.483ON57557726180.0
Smik_16.3963.483ON57257625960.0
SAKL0F02970g3.483ON57357725940.0
KLLA0B10868g3.483ON57457625890.0
TPHA0D042003.483ON57457525850.0
NDAI0B058103.483ON57757625820.0
Suva_16.4743.483ON57257625820.0
YPR145W (ASN1)3.483ON57257625800.0
CAGL0I10648g3.483ON57457525790.0
Kwal_55.211873.483ON57357525770.0
Skud_16.4393.483ON57257625680.0
TBLA0C044303.483ON58057925660.0
Suva_7.4103.483ON57257525560.0
Skud_7.4353.483ON57257525510.0
KLTH0F14630g3.483ON57357625500.0
Smik_6.2203.483ON57257525490.0
YGR124W (ASN2)3.483ON57257525310.0
ZYRO0B04136g3.483ON57257724950.0
AFR303W3.483ON57157524730.0
Ecym_12443.483ON57357523810.0
ZYRO0A00528g8.875ON5121031412e-08
TPHA0C049508.875ON525991278e-07
Skud_7.311singletonON81891141e-06
Kpol_455.78.875ON5181051242e-06
NDAI0K001808.875ON5221091224e-06
Skud_13.468.875ON5191041207e-06
ADL350C8.875ON508891198e-06
KNAG0J002008.875ON5151021181e-05
KAFR0L021108.875ON514951162e-05
NCAS0C001908.875ON5171051162e-05
YML096W8.875ON525951143e-05
Suva_13.528.875ON519991144e-05
TDEL0B004408.875ON516941134e-05
Smik_13.398.875ON521961135e-05
TBLA0C063008.875ON518941118e-05
KLLA0D10285g8.875ON5151131101e-04
SAKL0D00352g8.875ON515871091e-04
Ecym_81558.875ON513831072e-04
Kwal_27.97058.875ON515991054e-04
CAGL0H06963g8.875ON51793990.002
KLTH0E16412g8.875ON51595970.003
TPHA0F005704.104ON519109770.87
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A07920
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...  1175   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...  1033   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...  1026   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...  1019   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...  1013   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1004   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...  1003   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...  1001   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...  1000   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   999   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...   999   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...   998   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...   998   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   997   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   993   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   993   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...   989   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...   987   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   986   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...   986   0.0  
YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...   979   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   965   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   957   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   921   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    59   2e-08
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    54   8e-07
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    49   1e-06
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    52   2e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    52   4e-06
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    51   7e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    50   8e-06
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    50   1e-05
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    49   2e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    49   2e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    49   3e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   4e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    48   4e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    48   5e-05
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    47   8e-05
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    47   1e-04
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    47   1e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    46   2e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    45   4e-04
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    43   0.002
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    42   0.003
TPHA0F00570 Chr6 complement(133791..135350) [1560 bp, 519 aa] {O...    34   0.87 

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score = 1175 bits (3040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/578 (97%), Positives = 566/578 (97%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVEDA 578
           QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVEDA
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVEDA 578

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/576 (84%), Positives = 529/576 (91%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA FRHEDV +FK +ALQLSKRIRHRGPDWSGN++KNSTIM HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCG+Y L VNGEIYNHIQLRE+ P+Y++K+LSDCEPIIP+YL+ D+DAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYD+KKDRI+AARDPIG+TTLYMGRSSM PKTVFFASELKCL DDCD+I+AFPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TPNW+DE KIP+TPVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETE AN+ELD  +Y E    EG HLAGIDDEG+L ++ WSRLHSFAIGLPG
Sbjct: 241 SLIASIAARETEAANRELDASQYAE----EGSHLAGIDDEGHLRTSGWSRLHSFAIGLPG 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL+AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFLDLCMNIDP DKLINQKEGRIEKYILRKAFDT D+P  KPYLP+EILW
Sbjct: 417 LEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWID LKDTAE VISDEMFA PK+HWG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           QPTAAETVMRWIPKADWGCAEDPSGR+A+IHE+H++
Sbjct: 537 QPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ 572

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score = 1026 bits (2654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/577 (83%), Positives = 526/577 (91%), Gaps = 4/577 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA ++HE+ +AFKPRALQLSKRIRHRGPDWSGN++KNSTI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCGDY+L VNGEIYNHIQLRE CP+Y+YK+LSDCEPIIP+YLK+D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAKKDRI+AARDPIGITTLYMGR+S  PKTVFFASELKCLTDDCD+I+AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY++P+W+DE +IP+ PV  K IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETEKA KE+D   YD    +E  HL GIDD+GNL +A WSRLHSFAIGLP 
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYD----SEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL+AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTM+WG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMNIDP +K+IN  EGRIEKYILRKAFDT DEPD KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISDE+F+ PK HWG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577
           Q TAAETVMRWIPKADWGCAEDPSGR+AKIHEQH+ D
Sbjct: 537 QKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHIGD 573

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score = 1019 bits (2635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/577 (82%), Positives = 530/577 (91%), Gaps = 4/577 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA  +HEDVQA+K +ALQLSKRIRHRGPDWSGN+++N+T++ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCG+Y L VNGEIYNHI+LREE  +Y++ +LSDCEPIIP+Y KYD+D PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAK+DRI+AARDP+GITTLYMGR+S+ PKTVFFASELKCLTDDCDNI+AFPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDET+IPS PVD K IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETEKAN E+D +KYD    +E  HLAGIDD GNL SA WSRLHSFAIGLPG
Sbjct: 241 SLIASIAARETEKANAEIDAQKYD----SEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPG 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+VKRVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMNIDPKDK+IN++EGR+EKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISD++FAAPK+ WG DVPTTKEAFWYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577
           Q TAA+TVMRW+PKADWGCAEDPSGRFA+IH+QHV++
Sbjct: 537 QKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN 573

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score = 1013 bits (2618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/577 (83%), Positives = 524/577 (90%), Gaps = 5/577 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA FRHEDV+A+KP+ALQL+KRIRHRGPDWSGN++KN+TI+AHERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCG+Y L VNGEIYNHIQ+REEC +YQ+K+LSDCEPIIP+YLKYDLDAPKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAK+DRIVAARDPIGITTLYMGR S  P+TV+FASELKCLTDDCD+I+AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+ P+WLDE +IPSTPVDLK IR TLEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGH-HLAGIDDEGNLLSATWSRLHSFAIGLP 299
             IA+IAARETEKA +++D     E E  E H HL G+DDEG+L +  WSRLHSFAIGLP
Sbjct: 241 SLIASIAARETEKAMQDVDV----EDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLP 296

Query: 300 GAPDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRK 359
            APDL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRK
Sbjct: 297 NAPDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRK 356

Query: 360 IKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAW 419
           IKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAW
Sbjct: 357 IKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAW 416

Query: 420 GLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEIL 479
           GLEARVPFLDKEFL LCMNIDPKDK+I+Q  G+IEKYILRKAFDT D+P+ KPYLP+EIL
Sbjct: 417 GLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEIL 476

Query: 480 WRQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALF 539
           WRQKEQFSDGVGYSWIDGLKDTAE VISD MF  PK HWG DVPTTKEA+WYRLKFDAL+
Sbjct: 477 WRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALY 536

Query: 540 PQPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           PQ TAA+TVMRWIPKADWGCAEDPSGR+AKIHE+HV+
Sbjct: 537 PQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVD 573

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1004 bits (2596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/576 (82%), Positives = 516/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+HEDV  +KP+ALQLSKRIRHRGPDWSGN IKNSTI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSP  DY+L VNGEIYNHIQLREECPEYQ+K+LSDCEPIIPMYLK+D+DAPK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARET  A  ++DP  YD    ++  HLAG+DD+G L +A W+ LHSFAIGLP 
Sbjct: 241 SLIASIAARETANATNDVDPSTYD----SKARHLAGVDDDGKLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLDKEFL LCMNIDP +K+I  KEGRIEKYILRKAFDT  EPD KPYLPEEILW
Sbjct: 417 LEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAETVISDEMFA+PKA WG D+P+TKEAFWYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q T A+TVMRWIPKADWGCAEDPSGR+A+IHE+H++
Sbjct: 537 QKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID 572

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/577 (82%), Positives = 515/577 (89%), Gaps = 4/577 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA ++HE VQ FKP+ALQLSKRIRHRGPDWSGN++KN+TI+AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  GDY L VNGEIYNHI+LREE   Y +K+LSDCEPIIP+Y KYD+D PK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAKKDRI+AARDPIGITTLYMGRSS  P TVFFASELKCL DDCD I AFPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRYYTP+WLDE +IP TP+D K IR++LE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKANK+LDP  YD++++    HLAG+DD+GNL +A WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDK----HLAGVDDKGNLHAAGWSRLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD++FLD+CMNIDP +K+INQ EGRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 417 LEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISDE FA PK  WG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQH+++
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN 573

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/576 (82%), Positives = 517/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA+FR+ DVQA+KP+ALQLSKRIRHRGPDWSGNI+KNSTI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  G Y L+VNGEIYNHI LREEC  Y +K+LSDCEPIIP+Y KYD+DAPKHLDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYD+KKDRI+AARDPIGITTLYMGRSS  PK+V+F+SELKCLTDDCD IIAFPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRY+TP+WLDE++IP+TPVD K +R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEK N ELDP  YD    ++ H LAG+D++G+L +A WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYD----SDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD++FL LCMNIDP DK+I   EG+IEKYILRKAFDT DEPD+KPYLPEEILW
Sbjct: 417 LEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKD AE+ ISDE FA PKA WG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQHV+
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVD 572

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/575 (81%), Positives = 518/575 (90%), Gaps = 4/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIF  ++HE+ +AFKPRALQLSKRIRHRGPDWSGN++KNSTIMAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  GD+IL VNGEIYNHIQ+RE+ P+YQ+K+LSDCEPIIP+Y+KY  +APKHLDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD+I+AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYYTP+W+DE +I + P+DL +IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETEKA K        +   +  + L GIDD GNL S+ WSRLHSFAIGLPG
Sbjct: 241 SLIASIAARETEKAMKT----ASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPG 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL+AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLIAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFLDLCMNIDP +K+INQKEGRIEKYILRKAFDT DEP+ KPYLP+EILW
Sbjct: 417 LEARVPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISDE+F  P+ HWG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           QPTAA TVMRWIPKADWGCAEDPSGR+AKIHEQH+
Sbjct: 537 QPTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/576 (81%), Positives = 515/576 (89%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+HEDV AFKPRALQLSKRIRHRGPDWSGN+IKN+TI+AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCG+Y L VNGEIYNHIQ+RE+ P+Y +K+LSDCEPIIP+YLK+D+D PKHLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYD+K+DRI+AARDPIGITTLYMGR+S  P+TVFFASELKCLTDDCD+IIAFPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+WLDE +IP   +DL  IR +LE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETEKAN +      +  +E    HL G+DDEG+L +  WS+LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRV NLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD++FL LCMNIDPK+K+INQ EGRIEKYILRKAFDT D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISD MF  PK HWG D+PTTKEA+WYRLKFDAL+P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q TAA+TVMRWIPKADWGCAEDPSGR+AKIHE+HV 
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVN 576

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  999 bits (2582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/576 (81%), Positives = 514/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+HEDV  +KP+ALQLSKRIRHRGPDWSGN +KNSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSP  DY+L VNGEIYNHIQLREECP+YQ+K+LSDCEPIIPMYLK+D+DAPK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYDAK+DRI+AARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARET KA  +++P  YD +      HLAG+DDEGNL +A W+ LHSFAIGLP 
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNK----ARHLAGVDDEGNLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMNIDP +K+I  KEGRIEKYILRKAFDT DEP+ KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWID LKDTAE VISDEMFA PKA WG D+PTTKEA+WYRLKFD LFP
Sbjct: 477 RQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q T A+TVMRW+PKADWGCAEDPSGR+A+IHE+H++
Sbjct: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/576 (82%), Positives = 515/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA FRHEDV  +KP+ALQLSKRIRHRGPDWSGN IKNSTI  HERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLREEC +Y++ +LSDCEPIIPMYLK+D+DAPK+LDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARET KA  +++P  YD    ++  HLAGIDD+G L +A W+ LHSFAIGLP 
Sbjct: 241 SLIASIAARETAKATNDVEPSTYD----SKARHLAGIDDDGKLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMNIDP +K+I  KEGRIEKYILRKAFDT  EPD KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISDEMFA+PKA WG D+PTTKEAFWYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q T A+TVMRWIPKADWGCAEDPSGR+A+IHE+H+E
Sbjct: 537 QKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE 572

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/575 (82%), Positives = 516/575 (89%), Gaps = 3/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA ++H+DV AFKP+ALQLSKRIRHRGPDWSGN++KNSTIM HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  GDY L VNGEIYNHIQLRE+ P+Y++K+LSDCEPIIP YL++D+DAPK+LDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAK+DRIVAARDP+GITTLYMGR S  PKTVFFASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+TP+W+DE++IP+TPV+ K IR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETEKAN+E D     + + +    LAGID++G+L +A WSRLHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANEENDAA---DNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPN 297

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 298 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 357

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 358 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWG 417

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLDKEFL LCMNIDPKDK+I+Q  GRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 418 LEARVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILW 477

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE VISD MF+ PK  WG D+PTTKEA+WYRLKFDALFP
Sbjct: 478 RQKEQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFP 537

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQHV
Sbjct: 538 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 572

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/575 (82%), Positives = 514/575 (89%), Gaps = 4/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIF  FRHEDV  FKP ALQL+KRIRHRGPDWSGN+I+NST++AHERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           P+ S   DYIL+VNGEIYNHIQLREE  +Y +K+LSDCEPIIP+Y KY +DAPK+LDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYD KKDR++AARDPIGITTLYMGR S  PKTV+FASELKCLTD+CD+IIAFPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYYTPNWLDE +IPS P+DL +IR++LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKAN E++P +YD    +E  HLAG+DD G L SA WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYD----SEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFLDLCMN+DPK+K+INQ EGRIEKYILRKAFDT DEP  KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKDTAE  ISDE F  PKA WG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIH+QH+
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHI 571

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/576 (81%), Positives = 513/576 (89%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA ++HEDV  +K +ALQLSKRIRHRGPDWSGN  KNSTI  HERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSP  DY+L VNGEIYNHIQLREECP+YQ+K+LSDCEPIIPMYLK+D++APK+LDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYDAK+DRIVAARDPIGITTLYMGRSS  PKTV+FASELKCLTDDCD I AFPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTP+D   IRH+LEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARET  A  +++P  YD    ++  HLAG+DD+GNL +A W+ LHSFAIGLP 
Sbjct: 241 SLIASIAARETANATNDVEPSTYD----SKARHLAGVDDDGNLHTAGWTSLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMNIDPK+K+I  KEGRIEKYILRKAFDT  EPD KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWID LKD AE VISDEMFA+PKA WG D+PTTKEAFWYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q T A+TVMRW+PKADWGCAEDPSGR+A+IHE+H+E
Sbjct: 537 QKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE 572

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  993 bits (2566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/579 (79%), Positives = 516/579 (89%), Gaps = 3/579 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA ++H +V AFKPRALQL+KRIRHRGPDWSGN++KN+T+ AHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITSPCG+Y+L+VNGEIYNHIQLREE  +Y+YK+L DCEPIIPMYLKYD+DAP HLDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           A+ LYD++KDR++AARDP+GITTLYMGR+S  PKTV+FASELKCL DDCD+IIAFPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKI RY+ PNW+DE+ IP+TPVDLKQ+R TLE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEG---HHLAGIDDEGNLLSATWSRLHSFAIG 297
             IA+IAARETEK   E +   Y++Q +        L G+DD GNL + +WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 298 LPGAPDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 357
           LPGAPDL AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 358 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTM 417
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESVKRVKNLHL+D LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 418 AWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEE 477
           AWGLEARVPFLD++FL+LCMNIDP DK+I  KEG+IEKY+LRKAFDT DEPDVKPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 478 ILWRQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDA 537
           ILWRQKEQFSDGVGYSWID LKDTAE VISDEMFA PK HWG D+PTTKEA+WYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 538 LFPQPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           LFPQ TAA+TVMRWIPKADWGCAEDPSGR+AKIHEQH++
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHID 579

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/575 (81%), Positives = 516/575 (89%), Gaps = 5/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+HED++ FKP+ALQLSKRIRHRGPDWSGN I NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  GDY+L VNGEIYNHIQLRE+C +Y++++ SDCEPIIP+YL++D+DAPK+LDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           A+CLYD+KKDR++AARDPIG+ TLYMGR S  PKTV+FASELKCLTD CD+IIAFPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TP+WLDE ++P+TPVD + IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETE AN E +     E+  AE   LAGIDD+G+L ++ WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETETANVEAN-----EEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPN 295

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKST+AWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWG 415

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLDK+FL LCMNIDPKDK+IN KEGRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 416 LEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWID L+DTAE VISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 476 RQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           Q TAA+TVMRW+PKADWGCAEDPSGR+A+IHE+HV
Sbjct: 536 QKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHV 570

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  987 bits (2551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/575 (81%), Positives = 511/575 (88%), Gaps = 5/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+HED+ +FKP+ALQLSKRIRHRGPDWSGN + NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PI S  G+Y+L VNGEIYNHIQLRE+C  Y++++ SDCEPIIP+YL++D+DAPKHLDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           A+CLYDAKKDR+VAARDPIG+ TLYMGRSS  PKTV+FASELKCLTD CD+II+FPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TPNWLDE +IPS PVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKAN + D              LAGIDD+G+L ++ WSRLHSFA+GLP 
Sbjct: 241 SLIAAIAARETEKANADAD-----GDASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPN 295

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD++FL LCMNIDPKDK+IN KEGRIEKYILRKAFDT DEP+VKPYLPEEILW
Sbjct: 416 LEARVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGL+DTAE VISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 476 RQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           Q TAA+TVMRW+PKADWGCAEDPSGR+AKIHE+HV
Sbjct: 536 QKTAADTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  986 bits (2550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/576 (81%), Positives = 507/576 (88%), Gaps = 4/576 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIF  FRH+ V+ FKP AL+L KRIRHRGPDWSGNIIKNST+MAHERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           P  S   +YIL VNGE+YNHIQLREE   Y +K+LSDCEPIIP+Y KY +DAPK+LDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AW LYDAKKDRIVAARDPIGITTLYMGR S  PKTV+FASELKCLTD+CD+IIAFPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+ P+W+DE +IPS P+DL +IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETEKAN ++DP KYD    +E  HLAG+DD GNL SA WS LHSFAIGLP 
Sbjct: 241 SLIASIAARETEKANSQMDPVKYD----SEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMN+DPK+K+IN  EGRIEKYILRKAFDT DEP  KPYLPEEILW
Sbjct: 417 LEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISDE F  PKA WG D+PTTKEA+WYRLKFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVE 576
           Q TAA TVMRWIPKADWGCAEDPSGR+AKIHEQH++
Sbjct: 537 QKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHID 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score =  986 bits (2549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/575 (81%), Positives = 516/575 (89%), Gaps = 5/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+H+D+ +FKP+ALQLSKRIRHRGPDWSGN + NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLREEC +Y++++ SDCEPIIP+YL++D+DAPK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           A+C+YDAKKDRIVAARDPIG+ TLYMGRSS  PKTV+FASELKCLTD CD+IIAFPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRY+TP+WLDE +IPSTPVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKAN +++     E+   +   LAGIDD+G+L ++ WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANADVN-----EESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPN 295

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLDK+FL LCMNIDPKDK+I  KEG+IEKYILRKAFDT +EPDVKPYLPEEILW
Sbjct: 416 LEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGL+DTAE VISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 476 RQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           Q TAA TVMRW+PKADWGCAEDPSGR+AKIHE+HV
Sbjct: 536 QKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHV 570

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score =  979 bits (2531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/575 (80%), Positives = 511/575 (88%), Gaps = 5/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA F+HED+  FKP+ALQLSK+IRHRGPDWSGN + NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLRE C +Y++++ SDCEPIIP+YL++D+DAPK+LDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           A+CLYD+KKDRIVAARDPIG+ TLYMGRSS  P+TV+FASELKCLTD CD+II+FPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TP+WLDE +IPSTPVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKAN + +     E    +   LAGIDD+G+L ++ WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANADAN-----EDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPN 295

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLDK+FL LCMNIDP +K+I  KEGRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 416 LEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGL+DTAE  ISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 476 RQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           Q TAA+TVMRWIPKADWGCAEDPSGR+AKIHE+HV
Sbjct: 536 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/577 (78%), Positives = 506/577 (87%), Gaps = 5/577 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA FRH DVQ ++P ALQLSKRIRHRGPDWSGN++KNSTI+ HERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PI SPCG+Y L VNGEIYNHIQLREEC +Y ++SLSDCEPIIP+YLKY LDAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYD+K+DRIVAARDPIGITTLYMG+SS  PKT FFASELKCL DDCD I+AFPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRY+ P WLDE+ +PSTP+D K +RH+LEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETE+AN+ELDP  YD +E+    HLAGID +GNL +  WSRLHSFAIGLPG
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEK----HLAGIDAQGNLHTGGWSRLHSFAIGLPG 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL+AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 297 APDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD++FL+LCM +DP +K+I  +EGRIEKYILRKAFDT DEP+VKPYLPE+ILW
Sbjct: 417 LEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISDEM A P+  WG D PTTKEA+WYRLKFD  FP
Sbjct: 477 RQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVED 577
           + +AA TVMRWIPKADWGC  DPSGRFAKIHEQH+++
Sbjct: 537 K-SAANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN 572

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/575 (78%), Positives = 501/575 (87%), Gaps = 6/575 (1%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA +R +D+++FKP AL+LSKR+RHRGPDWSGN+IKN TI+ HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PI SP G+Y+L VNGEIYNHI LREEC +Y++ SLSDCEPIIP+YLKYD++ P+HLDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYD ++DRIVAARDPIG+TTLYMG+SS  P+T +FASELKCL D+CD I AFPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRY+ P+W+DET+IPS PVD K +R TLEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IA+IAARETE+AN+E           A+G HLAG+DD G L +  WSRLHSFAIGLP 
Sbjct: 241 SLIASIAARETERANREAG------DVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPN 294

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKI
Sbjct: 295 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKI 354

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+VKRV NLHL+DCLRANKSTMAWG
Sbjct: 355 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWG 414

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD+EFL LCMNIDP +K+I  ++GRIEKYILRKAFDT DEP V PYLPEEILW
Sbjct: 415 LEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILW 474

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWIDGLKD AE  ISDE FA P   WG D+PTTKEAFWYRLKFDALFP
Sbjct: 475 RQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFP 534

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           QPTAA TVMRW+PKADWGCAEDPSGR+AKIH+QH+
Sbjct: 535 QPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHI 569

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/575 (74%), Positives = 497/575 (86%), Gaps = 4/575 (0%)

Query: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60
           MCGIFA +R + +++FKP ALQLSKRIRHRGPDWSGN++KN TI  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120
           PI S  G+Y+L VNGEIYNHI LR+ C +Y + +LSDCEPIIP++ KY ++ P +LDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180
           AWCLYDAK DRIVAARDPIG+TTLYMG+ S  P+T +FASELKCL ++CD II+FPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRY+ P+WL ++  P+ PVD K++R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300
             IAAIAARETEKANKE+D  KYD Q      +L G+DDE +L ++ WS+LHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQV----RNLVGVDDELHLHASGWSKLHSFAIGLPN 296

Query: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360
           APDL AARKVAKFIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKI
Sbjct: 297 APDLQAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKI 356

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           KAQG+KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 357 KAQGIKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWG 416

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480
           LEARVPFLD++FL+LCMNIDP++K+I  KEG+IEKYILRKAFDT DEPDV+PYLP+EILW
Sbjct: 417 LEARVPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILW 476

Query: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540
           RQKEQFSDGVGYSWID LKD AE  ISDE FA PK  WG D+P+TKEA+WYR+KFDALFP
Sbjct: 477 RQKEQFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFP 536

Query: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575
           QPTAA TVMRW+PKA+WGC+EDPSGRFAKIHE+H+
Sbjct: 537 QPTAASTVMRWVPKAEWGCSEDPSGRFAKIHEKHI 571

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 9/103 (8%)

Query: 358 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTM 417
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 418 AWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRK 460
           A G+E R PFLD+  ++  M   P    IN K   I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQSIP----INWK---INKLILRK 471

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 73/173 (42%), Gaps = 28/173 (16%)

Query: 66  CGD-YILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYD----LDAPKHLDGMF 120
            GD YIL  NGE+YN     EE        L +    +   L+ D     +    L+G F
Sbjct: 84  VGDRYILQFNGELYN-----EEI-------LDNDTSFVASLLENDKMSVFEVISFLEGEF 131

Query: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFAS---ELKCLTDDCDNIIAFPP 177
           A+ +YD  + ++   RD IG  +L   R       ++ AS   + +  TD    I+    
Sbjct: 132 AYTIYDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV---- 186

Query: 178 GHVYDSETDKITRYYTP--NWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEV 228
            ++YD E   + +   P  N    ++I     + ++I H L + ++  ++  V
Sbjct: 187 -YIYDVEDKSLNQQMLPILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (54%), Gaps = 9/99 (9%)

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  K++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILR 459
           +E R PFLD    +  +N   K+  IN K   I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKEIPINYK---INKKILR 477

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 17/82 (20%)

Query: 69  YILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAP------KHLDGMFAW 122
           YIL  NGE+YN+          +   +SD    +   LK  LD        + L+G FA+
Sbjct: 89  YILQFNGELYNN----------EIHGISDTTYFVNC-LKTALDEKDIINILRTLEGEFAY 137

Query: 123 CLYDAKKDRIVAARDPIGITTL 144
            ++D+KK  +   RD IG  +L
Sbjct: 138 TIFDSKKKLVYFGRDTIGKRSL 159

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 46/89 (51%), Gaps = 14/89 (15%)

Query: 102 IPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASE 161
           +P YL+ D+DAPKHL+ MFA+     +K              ++ G S +  +T F  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCC--------CKIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKC----LTDDCDNIIAFPPGHVYDSE 184
             L C    LT  CDN  +F PG V+DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 7/105 (6%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFAN-KSIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGR---IEKYILRKAFDTCDEP 468
           FLD+E +   ++  P    +N+   R   +EK  LR   D   EP
Sbjct: 450 FLDEEVIQYSVSQIPISYKVNKGILRKLALEKLQLR---DIAQEP 491

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 74/172 (43%), Gaps = 28/172 (16%)

Query: 69  YILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAK 128
           Y+L  NGE+YN  ++     +Y    L  C+  +       +   + LDG FA+ +YD K
Sbjct: 92  YVLQFNGELYNS-EISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLK 143

Query: 129 KDRIVAARDPIGITTLYMGRSSMCPKTVFFASEL--KCLTDDCDNIIAFPPGHVYDSETD 186
           +  I   RD I       G+ S+C      + EL    +T      +    G +Y  +T 
Sbjct: 144 EGNIYFGRDTI-------GKRSLCYSIDENSGELFISSVTGTRGTFVDCLGGVIYTYDTK 196

Query: 187 KIT---------RYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVP 229
             T         +Y   +  DE +  S  ++L  +  TL ++V+KR+++  P
Sbjct: 197 THTLDDTKVIRDKYVVTDMTDELENESQYMEL--LYGTLYESVKKRVLSIHP 246

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 53/109 (48%), Gaps = 15/109 (13%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  FA   S  E   E  K++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRK-------AFDTCDEP 468
           FLD + +       P    IN K   I K ILRK         + CDEP
Sbjct: 455 FLDIDVIKFSTEELP----INYK---INKLILRKLAMNKLHLANICDEP 496

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 96/217 (44%), Gaps = 33/217 (15%)

Query: 27  IRHRGPDWSG-NIIKNSTIMAHERLAIVGLDSGAQPITSPCGD----YILSVNGEIYNHI 81
           I  RGP++S   + K  +I     +      S  +P T  C +    Y++  NGE+YN  
Sbjct: 49  IAARGPNYSSFKVSKQYSITWFSSVL-----SLREPFTKQCVEIKDRYVVQFNGELYND- 102

Query: 82  QLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAARDPIGI 141
           +++    +Y  + L + + II        D  + LDG FA+ +YD +       RDPIG 
Sbjct: 103 EIQYNDTQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFYFGRDPIGR 154

Query: 142 TTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHVY-------DSETD-KITR-YY 192
             L     +   + ++ +S   C T   D I     G +Y       +  TD KI++ +Y
Sbjct: 155 RCLSFSIDNETGE-LYISSVTGCKTGFQDCI----AGTIYKYDCQLKELNTDSKISKPFY 209

Query: 193 TPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVP 229
               LD+  +     +++++   L  +V KR+++  P
Sbjct: 210 VSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 9/104 (8%)

Query: 358 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTM 417
           +  + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K   
Sbjct: 385 KSYQRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIA 442

Query: 418 AWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKA 461
             G+E R PFLD+  ++L     P    IN K   + K ILRK 
Sbjct: 443 HNGVEVRYPFLDEYVINLSTLEIP----INYK---VNKLILRKV 479

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPCGD----YILSVNGEIYNHIQ 82
           I  RGP++S   +    I AH+      + S  +P T    +    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRV----IKAHQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREECPEYQYKSLSDCEPIIPMYLKYDL-DAPKHLDGMFAWCLYDAKKDRIVAARDPIGI 141
             +E  ++   SL     +  +    ++ D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 427 FLDKEFL--DLCMNIDPK-DKLINQKEGR 452
           FLD++ +   + + I  K DK+I +K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 14/126 (11%)

Query: 21  LQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPCGD-YILSVNGEIYN 79
           L+L   I  RGPD++   ++    +A    +++ L     P +   GD YIL  NGE++N
Sbjct: 42  LRLVPYIMARGPDYASYRLEAGMGLAWFS-SVLSLRQPLTPQSMAVGDRYILQFNGELFN 100

Query: 80  HIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAP-KHLDGMFAWCLYDAKKDRIVAARDP 138
                    + Q+   +D + I  +   + + A  + + G FA+ ++D +   +   RD 
Sbjct: 101 E--------DIQH---NDTQYIADLLASWPVTAVIRQMYGEFAYTIFDRQDGLLYFGRDN 149

Query: 139 IGITTL 144
           +G  +L
Sbjct: 150 VGKRSL 155

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 9/102 (8%)

Query: 359 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTM 417
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 418 AWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILR 459
           + G+E R PFLD   +        +D  IN K   I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFST----EDLPINYK---INKLILR 473

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 79/188 (42%), Gaps = 35/188 (18%)

Query: 60  QPITSPC----GDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKH 115
           QP T       G Y+L  NGE+YN  ++     +Y    L+  E  IP       D    
Sbjct: 76  QPFTKQSLVVDGRYVLQFNGELYND-EIEFNDTQYIADMLARGEASIP-------DIIAR 127

Query: 116 LDGMFAWCLYDAKKDRIVAARDPIGITTL--YMGRSSMCPKTVFFASELKCLTDDCD--- 170
           LDG FA+ +YD +  +    RD IG  +L  Y+  S    K   + S +    +D +   
Sbjct: 128 LDGEFAYTIYDTEDQKYYFGRDAIGKRSLSYYVNTS----KDQLYVSSVTGRVEDIEFRD 183

Query: 171 ---NIIAFPPGHVYDS------ETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVR 221
               II     ++YD+      +++ I+  YT + L +         ++++   L  AV 
Sbjct: 184 CIAGII-----YIYDAKNQHLDDSNHISDPYTVSPLVDENFTERGEHIEKLHFQLNLAVE 238

Query: 222 KRLMAEVP 229
           KR+ +  P
Sbjct: 239 KRINSIHP 246

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKA 461
           FLD   +       P    IN K   + K ILRK 
Sbjct: 447 FLDHNVVQFSTQEIP----INYK---VNKLILRKV 474

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 18/88 (20%)

Query: 69  YILSVNGEIYNHIQLREECPEYQYKS--LSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYD 126
           Y+L  NGE+YN  +++++  + Q+ +  LS    +I             LDG FA+ +YD
Sbjct: 88  YVLQFNGELYNK-EIKQDQNDTQFIASLLSSSTDVI--------HTLTQLDGEFAYTIYD 138

Query: 127 AKKDRIVAARDPIGITTLYMGRSSMCPK 154
            ++ +I   RD I       G+ S+C K
Sbjct: 139 LRETKIYFGRDSI-------GKRSLCFK 159

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 356 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKS 415
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 416 TMAWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRK 460
               G+E R PFLD+E +       P    IN K   + K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFSTMEIP----INYK---VNKMILRK 475

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 8/76 (10%)

Query: 69  YILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAK 128
           Y+L  NGE+YNH ++     +Y    L +  P IP  +K        L+G FA+ +YD +
Sbjct: 90  YVLQFNGELYNH-EIVHNDTQYIVGLLKESAPSIPAIIK-------KLNGEFAYSIYDIQ 141

Query: 129 KDRIVAARDPIGITTL 144
                  RD +G  +L
Sbjct: 142 NGTFYFGRDTVGKRSL 157

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKA 461
           FLD+  + L     P    IN K   + K ILRK 
Sbjct: 452 FLDEYVIKLSTAEIP----INFK---VNKLILRKV 479

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPCGD----YILSVNGEIYN-HI 81
           I  RGP++S        + A+       + S  QP T    +    Y L  NGE+YN  I
Sbjct: 47  IAARGPNYSSL----RAVKAYRISWFSSVLSLRQPFTKQSINVDDRYFLQFNGELYNKEI 102

Query: 82  QLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAARDPIGI 141
              +    Y    L + +  + +     +D  K L+G +A+ +YD    ++   RDPIG 
Sbjct: 103 SQGDNDSLYIASMLQNLKEGMGV-----IDVIKSLEGEYAYTIYDVNSSKLYFGRDPIGR 157

Query: 142 TTL 144
            +L
Sbjct: 158 RSL 160

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 363 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLE 422
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 423 ARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKA 461
            R PFLD+  +       P    IN K   I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSAVDIP----INFK---INKLILRNV 479

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (42%), Gaps = 28/168 (16%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPIT----SPCGDYILSVNGEIYNHIQ 82
           I  RGP++S   +      A++      + S  QP T    S    Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSLRVSK----AYQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYNK-E 101

Query: 83  LREECPEYQY-----KSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAARD 137
           + ++  + QY     ++L+    +I        D  + L+G +A+ +YD K  +    RD
Sbjct: 102 ISDDDNDSQYIASLLQNLTGDGDVI--------DVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHVYDSET 185
           PIG  +L     S+ P    + +      +   + I    G VY+ +T
Sbjct: 154 PIGRRSL---SYSVTPNNELYVASATGAIEGFQDCIG---GIVYEYDT 195

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRK 460
           FLD + +       P    IN K   + K ILR+
Sbjct: 449 FLDHDVIKFSTEEIP----INYK---VNKMILRR 475

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 97/222 (43%), Gaps = 41/222 (18%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPC----GDYILSVNGEIYNH-I 81
           I+ RGPD+S   + +     H       + S  +P TS        +IL  NGE+YN  I
Sbjct: 47  IKSRGPDYSSLRVSSE----HSTAWYSSVLSLREPFTSQSVKVGNRFILQFNGELYNQEI 102

Query: 82  QLREECPEYQYKSLSD-----CEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAAR 136
              +   ++    L +     C+ I            + L G FA+ LYD ++ +    R
Sbjct: 103 TAHDNDTQFIVSKLQEGYHDVCQII------------RQLSGEFAYTLYDLQQRKFYYGR 150

Query: 137 DPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHVYDSETDKI-------T 189
           D +G  +L    S++  + ++ +S    +    D I      +VYD+E+  +       +
Sbjct: 151 DNVGKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLES 207

Query: 190 RYYTPNWLDE--TKIPSTPVDLKQIRHTLEKAVRKRLMAEVP 229
           +Y+    LDE  T + ST   ++Q+   L  AVRKR+++  P
Sbjct: 208 QYFITKKLDEELTCLDST---VEQLYGMLSLAVRKRVLSIHP 246

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 367 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARV 425
           ++LSG G+DE++GGY  FA +AP   E   E  K++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 426 PFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKA 461
           PFLD+  +       P    IN K   + K ILRK 
Sbjct: 451 PFLDEYVIKFSTVEIP----INYK---VNKLILRKV 479

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 55/129 (42%), Gaps = 26/129 (20%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPCGD----YILSVNGEIYNHIQ 82
           I  RGP++S       T+ A+       + S  +P T    +    Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYN--- 99

Query: 83  LREECPEYQYKSLSDCEPIIPMYLKYDL-------DAPKHLDGMFAWCLYDAKKDRIVAA 135
             +E   +   SL      I   LK DL       D  K L+G +A+ +YD K  +    
Sbjct: 100 --KEVSHWGNDSL-----YIASLLK-DLEDDGSVIDVIKSLEGEYAYTVYDVKSAKFYFG 151

Query: 136 RDPIGITTL 144
           RDPIG  +L
Sbjct: 152 RDPIGRRSL 160

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 8/94 (8%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRK 460
           FLD+  +    +  P    IN K   I K ILRK
Sbjct: 451 FLDEHVIKYSTHDIP----INYK---INKLILRK 477

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 70/173 (40%), Gaps = 42/173 (24%)

Query: 1   MCGIFAT--------FRHEDVQAFK---PRAL----------QLSKRIRHRGPDWSGNII 39
           MCGI           F   + + FK   P AL           L K I  RGP+++    
Sbjct: 1   MCGILLNISPNDNLKFFQNEYKEFKENCPDALLNSNNDYTFSNLMKLISARGPNFASL-- 58

Query: 40  KNSTIMAHERLAIVGLDSGAQPITSP-CGD-------YILSVNGEIYNHIQLREECPEYQ 91
              T+  H     + L S    +  P C         Y+L  NGE+YN  ++     ++ 
Sbjct: 59  --RTLKDHR----ISLFSSVLSLREPFCKQSVLVEDRYVLQFNGELYND-EIIHNDTQFI 111

Query: 92  YKSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAARDPIGITTL 144
            K L + E       K  +   K+LDG FA+ +YD K  R+   RDPIG  +L
Sbjct: 112 VKLLLNTE----QNSKGIISVIKNLDGEFAFSIYDLKNKRLYFGRDPIGKRSL 160

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 58/113 (51%), Gaps = 5/113 (4%)

Query: 357 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKST 416
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  K++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 417 MAWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRI-EKYILRKAFDTCDEP 468
              G+E R PFLD+  +   +++ P +  +N+   R+  K ILR  F   +EP
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDL-PLNYKVNKHILRVMAKDILRLDF-ISEEP 489

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 10/120 (8%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPCGD-YILSVNGEIYNHIQLRE 85
           I  RGP+++ ++   S I A    +++ L +     +    D Y+L  NGE+YN   + E
Sbjct: 48  IVRRGPNYA-SLRSLSEINAMLFSSVLSLRTPFTKQSVMVQDRYLLQYNGELYNDDTV-E 105

Query: 86  ECPEYQYKSLSDCEPIIPMYLKYDL-DAPKHLDGMFAWCLYDAKKDRIVAARDPIGITTL 144
            C        SD E I  +  K+ + +  +   G FA+ + D ++ ++   RD IG  +L
Sbjct: 106 NCEH------SDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDSIGKRSL 159

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 363 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLE 422
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 423 ARVPFLDKEFLDLCMNIDPKDKLINQK 449
            R PFLD++ +     + P +  +N+K
Sbjct: 445 VRYPFLDEKVVQFSTEL-PINYKVNKK 470

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 76/170 (44%), Gaps = 27/170 (15%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLA-IVGLDSGAQPITSPCGD-YILSVNGEIYNHIQLR 84
           I +RGP+++   I+NS+       + I+ L       +    D ++L  NGE+YN     
Sbjct: 49  IINRGPNYAS--IRNSSKYGISWFSSILSLRDPLTRQSVKINDRFVLQYNGELYN----- 101

Query: 85  EECPEYQYKSLSDCEPIIPMYLKYDLDAPK---HLDGMFAWCLYDAKKDRIVAARDPIGI 141
                 Q+   +D   I  +  +Y  D PK    ++G FA+ ++D + +++   RD IG 
Sbjct: 102 ---SSIQH---NDTLFIASLIERYQDDIPKAIREMEGEFAYTIFDKQCEKLYFGRDTIGK 155

Query: 142 TTLYMGRSSMCPKTVFFASELKCLT---DDCDNIIAFPPGHVYDSETDKI 188
            +L     S   K   F S +   +   +DC+    +    +YDS+T  +
Sbjct: 156 RSLSYKFDSETSK--LFISSVSGTSEGFEDCEGGTIY----IYDSKTGNL 199

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 358 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKST 416
           + I  Q   +VL SG G+DE++GGY  F    S      E  K++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 417 MAWGLEARVPFLDKEFLDLCMNI 439
              G+E R PFLD+E ++L  ++
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSL 457

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 12/77 (15%)

Query: 69  YILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAP-KHLDGMFAWCLYDA 127
           YIL  NGE+YN              S +D + I  +  K  +D   + L G FA+ +Y+ 
Sbjct: 91  YILQYNGELYN-----------DDISHNDSQYIAGLLEKLPVDVVLRRLYGEFAYSIYNT 139

Query: 128 KKDRIVAARDPIGITTL 144
           K   I   RD +G  +L
Sbjct: 140 KTKCIYFGRDSVGKRSL 156

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (51%), Gaps = 10/99 (10%)

Query: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILR 459
           +E R PFLD   ++    +      IN K   + K ILR
Sbjct: 442 VEVRYPFLDDRVIEFSTQLP-----INYK---VNKMILR 472

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 17/122 (13%)

Query: 27  IRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPCGD----YILSVNGEIYNHIQ 82
           I  RGP+++ ++  ++T  A    +I+ L    +P+T  C D    ++L  NGEIYN   
Sbjct: 49  IVDRGPNYA-SLKSSATDAAVWFTSILSL---REPLTKQCIDINDRFVLQYNGEIYNS-S 103

Query: 83  LREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAARDPIGIT 142
           +     +Y    LS  + + P  ++        L G FA+ +YD     I   RD +G  
Sbjct: 104 IAHNDTQYIATELSIVQNV-PTVIR-------KLSGEFAYTVYDRATGEIFFGRDGVGKR 155

Query: 143 TL 144
           +L
Sbjct: 156 SL 157

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 6/93 (6%)

Query: 358 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTM 417
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 418 AWGLEARVPFLDKEFLDLCMNIDP----KDKLI 446
           + G+E R PFL +E ++      P    +DK+I
Sbjct: 442 SNGVEVRYPFLAEEVVEFSTASIPLNYKRDKMI 474

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 16/129 (12%)

Query: 22  QLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQPITSPC----GDYILSVNGEI 77
            + K +R RGP++         I     + I  + S  QP T         Y+L  NGE+
Sbjct: 38  SIVKLVRCRGPNYC----SMRQIKDVNSIWISSVLSLRQPFTKQSIVIGNKYVLQFNGEL 93

Query: 78  YNHIQLREECPEYQYKS--LSDCEPIIPMYLKYDLDAPKHLDGMFAWCLYDAKKDRIVAA 135
           YN  ++ E   + Q+ S  L  C     ++     +    LDG FA+ + D + + I   
Sbjct: 94  YND-EIIESGNDTQFLSGLLKKCISEDDIF-----NILHGLDGEFAFTIQDLENNLIYFG 147

Query: 136 RDPIGITTL 144
           RD IG  +L
Sbjct: 148 RDTIGKRSL 156

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 9/95 (9%)

Query: 367 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVP 426
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 427 FLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKA 461
           FLD + +     +      IN K   + K ILRK 
Sbjct: 448 FLDDQVVAFSTQLP-----INYK---VNKMILRKV 474

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 46/108 (42%), Gaps = 23/108 (21%)

Query: 60  QPITSPCGD----YILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAP-- 113
           +P T  C +    ++L  NGEIYN              S +D + I  M L    D P  
Sbjct: 78  EPFTKQCIEVEDRFVLQYNGEIYN-----------SSISHNDTQYIAEMLLNAK-DIPSV 125

Query: 114 -KHLDGMFAWCLYDAKKDRIVAARDPIGITTLYM----GRSSMCPKTV 156
            + L G FA+ +YD     +   RDPIG  +L      G S +C  +V
Sbjct: 126 IRTLSGEFAYTIYDKLTGEVFFGRDPIGRRSLSFKLDTGDSKICISSV 173

>TPHA0F00570 Chr6 complement(133791..135350) [1560 bp, 519 aa] {ON}
           Anc_4.104 YGL017W
          Length = 519

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 13/109 (11%)

Query: 382 LYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEARVPFLD------KEFLDL 435
           +YF   P  A      V  +K L LS  ++ N            P ++       E LDL
Sbjct: 258 VYFVWDPDYARLSLGKVSALKELVLSTKIK-NGYYYLGYYIGDCPKMNYKGKYGGELLDL 316

Query: 436 CM-NIDPKDKLIN-QKEGRIEKYILRKAFDTCDEPDVKPYLPEEI--LW 480
           C  N    +KL N  K GR+  +I+  + D CD P  +PYL E++  LW
Sbjct: 317 CAANYVRLEKLDNITKHGRL--FIMTDSEDKCDTPQSEPYLNEKLKALW 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,437,164
Number of extensions: 2651509
Number of successful extensions: 6224
Number of sequences better than 10.0: 48
Number of HSP's gapped: 6297
Number of HSP's successfully gapped: 68
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)