Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A054302.284ON78878840050.0
KAFR0J013702.284ON78084414020.0
NDAI0B035602.284ON75681312651e-163
KLTH0G10318g2.284ON79083412431e-159
NCAS0B062602.284ON72332911811e-151
TDEL0G021502.284ON66131711731e-150
Suva_9.1042.284ON80532211781e-149
KAFR0H033302.284ON36934011301e-148
YIL095W (PRK1)2.284ON81032211601e-146
SAKL0E07722g2.284ON79131611491e-145
KLLA0E08405g2.284ON77771811371e-143
Skud_9.782.284ON80932211391e-143
TPHA0C033802.284ON69732811271e-143
NDAI0G006402.284ON62131711161e-142
NCAS0G038102.284ON66133311141e-141
Kpol_1003.352.284ON71332811111e-140
ADL217W2.284ON75056911091e-139
ZYRO0A01848g2.284ON70450111011e-139
CAGL0G02607g2.284ON68832410741e-135
Skud_14.3092.284ON63931210641e-134
YNL020C (ARK1)2.284ON63831210571e-133
TBLA0B059302.284ON71732710611e-133
Smik_14.3112.284ON63731210541e-133
Suva_14.3272.284ON63230910501e-132
KNAG0H020202.284ON59231610431e-132
Ecym_33232.284ON74832110501e-131
TBLA0B069402.284ON144332410611e-126
CAGL0J03432g2.284ON6223149801e-122
TPHA0D015402.284ON7073179441e-116
KNAG0J008203.273ON10913296541e-71
SAKL0D03234g3.273ON8583186381e-70
CAGL0H10208g3.273ON10273236414e-70
Kpol_1052.223.273ON11013216415e-70
KNAG0H012203.273ON9133266348e-70
KAFR0A010403.273ON9123276349e-70
ZYRO0E06864g3.273ON11153196311e-68
Skud_2.1793.273ON10903506257e-68
Kpol_251.43.273ON8383176177e-68
Smik_2.1913.273ON11083506257e-68
Suva_4.2973.273ON11073246241e-67
NCAS0A105903.273ON10953276186e-67
KLTH0C07260g3.273ON9013226111e-66
NDAI0A057003.273ON11573456171e-66
YBR059C (AKL1)3.273ON11083496142e-66
Ecym_26503.273ON8943136083e-66
TBLA0E025903.273ON10613366114e-66
TDEL0D035203.273ON10493186062e-65
KLLA0F18612g3.273ON8143255964e-65
TPHA0M011203.273ON7883155937e-65
KAFR0C004303.273ON9494065971e-64
Kwal_27.109453.273ON9353225952e-64
TBLA0I019303.273ON13613426003e-64
TPHA0A040303.273ON10543325956e-64
AGR027C3.273ON9613105919e-64
CAGL0K11990g3.273ON9913265873e-63
Kwal_27.115422.284ON7913222236e-18
Suva_16.706.262ON3643452016e-16
Skud_16.426.262ON3643322016e-16
Suva_6.1691.271ON14842922077e-16
YJL095W (BCK1)1.271ON14782922051e-15
KLLA0F14190g1.271ON13382182041e-15
Smik_10.1471.271ON14783042005e-15
YPL236C (ENV7)6.262ON3643311945e-15
Kpol_1023.266.31ON7392921986e-15
Skud_10.1191.271ON14812921997e-15
TDEL0A067506.262ON3723491929e-15
Kpol_463.81.271ON14473041971e-14
Kwal_26.73551.271ON14462621924e-14
CAGL0L03520g1.271ON14472811908e-14
NDAI0C026806.31ON7502931871e-13
NCAS0D021006.31ON7262931852e-13
NCAS0A094701.271ON15152301862e-13
Smik_6.4416.262ON3643341794e-13
KLTH0D03454g1.271ON14332621844e-13
KNAG0B017801.271ON15802301835e-13
Smik_13.1596.31ON7052761816e-13
TPHA0F024306.31ON7983001817e-13
TPHA0I009201.271ON14342811827e-13
KAFR0A014201.271ON13982301817e-13
TBLA0C029401.271ON16432971801e-12
NDAI0G054701.271ON15552921801e-12
Ecym_21536.262ON3633471742e-12
AFR092W1.271ON14232331772e-12
Skud_13.1546.31ON7052761762e-12
YMR001C (CDC5)6.31ON7052761753e-12
Suva_13.1636.31ON7052761744e-12
ZYRO0G15290g1.271ON14872301754e-12
KLTH0H03080g6.262ON3463331705e-12
KNAG0E008506.31ON7112751736e-12
Ecym_63441.271ON13972301746e-12
Kpol_1037.206.31ON7042761728e-12
SAKL0D05522g1.271ON14742301721e-11
SAKL0A03344g6.262ON3643481671e-11
TPHA0J004206.31ON7072761701e-11
KLTH0F16676g5.406ON8782871701e-11
TDEL0G043806.31ON7222811692e-11
Ecym_52513.177ON8932241692e-11
TBLA0B004906.31ON7872901682e-11
Smik_9.842.284ON8083721682e-11
Kwal_55.215455.406ON8653011682e-11
Kpol_431.92.479ON15522061692e-11
KAFR0G026906.31ON7132761673e-11
CAGL0J11638g6.31ON7462741648e-11
KLLA0C04191g3.177ON7971271648e-11
KNAG0F029006.31ON6492551638e-11
TDEL0D014001.271ON14292011648e-11
KAFR0A050906.31ON6682441639e-11
Kwal_56.242746.262ON3463371591e-10
Smik_1.793.177ON9742621631e-10
CAGL0K08514g2.479ON14892391631e-10
TPHA0B038501.423ON5402051592e-10
TPHA0G032002.479ON15342031603e-10
YAR019C (CDC15)3.177ON9741431593e-10
KLTH0G05214g5.591ON6531941583e-10
Suva_11.1232.479ON15262181593e-10
TBLA0B039708.654ON12082051593e-10
ABL034W2.479ON14252291593e-10
ZYRO0C07480g6.31ON7742731583e-10
KNAG0F001701.24ON543801574e-10
KLLA0F11319g8.668ON8431971574e-10
KAFR0F039704.192ON3841591554e-10
Ecym_73922.479ON14342041576e-10
KNAG0D008306.262ON3872871546e-10
SAKL0E01584g6.31ON6952731566e-10
Skud_1.723.177ON9742701567e-10
ACL006W6.31ON7083051557e-10
KLTH0C10912g6.31ON6972891558e-10
TDEL0H036407.86ON12371891559e-10
KNAG0D048107.86ON14401821569e-10
ADR313W3.167ON578791531e-09
KAFR0F016301.149ON7513411541e-09
AER223C3.177ON9022231541e-09
Smik_6.1364.192ON3691991501e-09
TBLA0B085203.60ON9341141532e-09
Skud_3.1466.341ON13341661532e-09
TDEL0A060008.654ON7903021522e-09
KNAG0K023703.60ON8831421522e-09
Ecym_30356.31ON7402781522e-09
TPHA0P012703.60ON8851141522e-09
TBLA0A047207.86ON12622341522e-09
KLLA0C00979g1.24ON483791502e-09
YGR052W (FMP48)4.192ON3691991482e-09
KAFR0F043406.341ON15941651523e-09
SAKL0G01848g5.406ON8851231513e-09
TBLA0B016303.177ON12951631513e-09
Kpol_1044.37.86ON9322901513e-09
SAKL0H06754g8.668ON8842881503e-09
KNAG0D021408.140ON8701711503e-09
CAGL0I07513g3.92ON10763201503e-09
YOL113W (SKM1)3.60ON655831503e-09
TPHA0H004208.140ON10382741503e-09
NDAI0F045201.24ON489821494e-09
KNAG0D003906.341ON16561611504e-09
Skud_11.1262.479ON15182181504e-09
Suva_3.331.423ON6142041494e-09
SAKL0D12628g1.507ON818731494e-09
CAGL0M02299g8.668ON8931971494e-09
TDEL0A025502.479ON13692031504e-09
ABR014W2.496ON9711561495e-09
TPHA0G032902.496ON9731151495e-09
TPHA0L013508.490ON6161921485e-09
YKL101W (HSL1)2.479ON15182181495e-09
KAFR0D049505.406ON10082021495e-09
Kwal_56.224766.31ON6972871486e-09
Kwal_47.183075.591ON6211901476e-09
Kpol_1072.198.668ON8962101486e-09
NDAI0H024707.86ON14112851486e-09
KLLA0A07403g3.60ON8791341486e-09
Ecym_24342.496ON11221561487e-09
KLTH0E16126g3.177ON8681101487e-09
KAFR0A083603.60ON8291901477e-09
KAFR0A017602.496ON8851151477e-09
Smik_11.1392.479ON15342181487e-09
ZYRO0E07876g6.262ON3693341447e-09
ACR133C8.668ON8511981478e-09
KAFR0C014403.92ON10953041478e-09
TBLA0B023103.92ON8191971478e-09
YCR073C (SSK22)6.341ON13312271478e-09
TDEL0D053203.92ON10572891478e-09
NCAS0A021804.192ON3562231431e-08
KAFR0C045906.341ON14681601471e-08
Kpol_1031.768.490ON5762071451e-08
YNR031C (SSK2)6.341ON15791631461e-08
KLTH0D10714g8.654ON8722551461e-08
KLLA0E21693g5.406ON10161151461e-08
KLLA0F13552g2.479ON12672131461e-08
TPHA0H007603.177ON9801591461e-08
NDAI0K021002.496ON9092381461e-08
Suva_15.2975.406ON1074831461e-08
Kpol_1031.105.406ON1127831461e-08
TBLA0A015808.490ON8682101451e-08
SAKL0E02860g2.479ON13771651461e-08
Suva_1.863.177ON9743101451e-08
CAGL0H06259g7.86ON13361821461e-08
KNAG0B053502.496ON8362361451e-08
Skud_8.1635.406ON1076831451e-08
NDAI0A038702.496ON8951521451e-08
Skud_7.3504.192ON3691651421e-08
TDEL0A027202.496ON9151561451e-08
SAKL0A01254g6.341ON15582961451e-08
Smik_15.393.60ON660831442e-08
Skud_15.393.60ON6551121442e-08
Smik_14.3606.341ON15831631452e-08
CAGL0L11550g5.406ON1072831442e-08
Smik_3.941.423ON6032041432e-08
Smik_8.422.496ON9391151442e-08
TBLA0I002802.496ON13161561442e-08
Suva_15.463.60ON6531121432e-08
AEL205W3.60ON7931661442e-08
Kpol_1072.298.654ON8932041442e-08
SAKL0B09856g7.86ON12741881442e-08
Skud_14.3626.341ON15791631442e-08
TBLA0A071501.52ON13912971442e-08
Kwal_23.63256.341ON15422411442e-08
ZYRO0B01166g2.496ON9631561432e-08
TBLA0C058001.180ON981741432e-08
KNAG0B043205.406ON1027831432e-08
TBLA0I024006.341ON17303131442e-08
KLTH0F06578g3.167ON596771422e-08
Suva_14.423.60ON8641141432e-08
KLLA0F07623g7.86ON12293071432e-08
KLLA0B07579g1.149ON7221961423e-08
KLLA0C08525g6.341ON15511951433e-08
Kwal_27.97633.177ON8681101433e-08
YOL100W (PKH2)3.92ON10812901433e-08
YCR008W (SAT4)1.423ON6032041423e-08
Suva_15.653.92ON10802901433e-08
CAGL0L12650g8.490ON5672251413e-08
KLTH0D05566g2.479ON11282091423e-08
KLLA0C06138g6.31ON7082771423e-08
CAGL0G04609g3.92ON9653781423e-08
ZYRO0A06446g5.406ON9432151423e-08
TBLA0A035705.406ON9752111423e-08
KAFR0D033902.496ON7981101423e-08
KLTH0D11044g8.668ON8492101423e-08
NCAS0H019405.406ON1015831423e-08
Smik_8.1805.406ON1073831423e-08
CAGL0K02673g2.496ON9151101423e-08
Smik_14.343.60ON8381141413e-08
SAKL0C04576g1.149ON7481961414e-08
YER129W (SAK1)8.140ON1142841414e-08
ZYRO0D05500g7.86ON12621851424e-08
Kpol_1054.23.92ON10962981414e-08
Suva_14.3856.341ON15811631424e-08
SAKL0C07722g3.177ON9122641414e-08
KLLA0B13607g2.496ON9891561414e-08
ZYRO0F08272g8.490ON6072071404e-08
NCAS0C041208.140ON9152701414e-08
NDAI0I003406.341ON18361651414e-08
CAGL0D01694g3.338ON4322041394e-08
NOTE: 1 genes in the same pillar as KNAG0A05430 were not hit in these BLAST results
LIST: Kpol_1039.33

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A05430
         (788 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...  1547   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   544   0.0  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   491   e-163
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   483   e-159
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   459   e-151
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   456   e-150
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   458   e-149
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   439   e-148
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   451   e-146
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   447   e-145
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   442   e-143
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   443   e-143
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   438   e-143
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    434   e-142
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   433   e-141
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   432   e-140
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   431   e-139
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   428   e-139
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   418   e-135
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   414   e-134
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   411   e-133
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   413   e-133
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   410   e-133
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   409   e-132
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   406   e-132
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   409   e-131
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   413   e-126
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   382   e-122
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   368   e-116
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   256   1e-71
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   250   1e-70
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   251   4e-70
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   251   5e-70
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   248   8e-70
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   248   9e-70
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   247   1e-68
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   245   7e-68
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   242   7e-68
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   245   7e-68
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   244   1e-67
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   242   6e-67
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   239   1e-66
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   242   1e-66
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   241   2e-66
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   238   3e-66
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   239   4e-66
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   238   2e-65
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   234   4e-65
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   233   7e-65
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   234   1e-64
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   233   2e-64
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   235   3e-64
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   233   6e-64
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   232   9e-64
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   230   3e-63
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    91   6e-18
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    82   6e-16
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    82   6e-16
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    84   7e-16
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    84   1e-15
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    83   1e-15
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    82   5e-15
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    79   5e-15
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    81   6e-15
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    81   7e-15
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    79   9e-15
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    80   1e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    79   4e-14
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    78   8e-14
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    77   1e-13
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      76   2e-13
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    76   2e-13
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    74   4e-13
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    75   4e-13
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    75   5e-13
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    74   6e-13
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    74   7e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    75   7e-13
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    74   7e-13
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    74   1e-12
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    74   1e-12
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    72   2e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    73   2e-12
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    72   2e-12
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    72   3e-12
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    72   4e-12
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    72   4e-12
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    70   5e-12
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    71   6e-12
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    72   6e-12
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    71   8e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    71   1e-11
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    69   1e-11
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    70   1e-11
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    70   1e-11
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    70   2e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    70   2e-11
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    69   2e-11
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    69   2e-11
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    69   2e-11
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    70   2e-11
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    69   3e-11
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    68   8e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    68   8e-11
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               67   8e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    68   8e-11
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             67   9e-11
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    66   1e-10
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    67   1e-10
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    67   1e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    66   2e-10
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    66   3e-10
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    66   3e-10
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    65   3e-10
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    66   3e-10
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    66   3e-10
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    66   3e-10
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    65   3e-10
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    65   4e-10
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    65   4e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    64   4e-10
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    65   6e-10
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    64   6e-10
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    65   6e-10
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    65   7e-10
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    64   7e-10
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    64   8e-10
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    64   9e-10
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    65   9e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    64   1e-09
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    64   1e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    64   1e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    62   1e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    64   2e-09
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    64   2e-09
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    63   2e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    63   2e-09
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    63   2e-09
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    63   2e-09
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    63   2e-09
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    62   2e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   2e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    63   3e-09
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    63   3e-09
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    63   3e-09
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    63   3e-09
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    62   3e-09
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    62   3e-09
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    62   3e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    62   3e-09
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    62   3e-09
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    62   4e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    62   4e-09
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    62   4e-09
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    62   4e-09
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    62   4e-09
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    62   4e-09
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    62   4e-09
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    62   5e-09
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    62   5e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              62   5e-09
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    62   5e-09
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    62   5e-09
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    62   6e-09
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    61   6e-09
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    62   6e-09
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    62   6e-09
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    62   6e-09
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    62   7e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    62   7e-09
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    61   7e-09
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    61   7e-09
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    62   7e-09
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    60   7e-09
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    61   8e-09
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    61   8e-09
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    61   8e-09
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    61   8e-09
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    61   8e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     60   1e-08
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    61   1e-08
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    60   1e-08
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    61   1e-08
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    61   1e-08
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    61   1e-08
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    61   1e-08
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    61   1e-08
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    61   1e-08
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    61   1e-08
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    61   1e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    60   1e-08
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    61   1e-08
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    60   1e-08
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    61   1e-08
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    60   1e-08
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    60   1e-08
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     60   1e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    59   1e-08
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    60   1e-08
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    60   1e-08
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    60   2e-08
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    60   2e-08
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    60   2e-08
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    60   2e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    60   2e-08
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    60   2e-08
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    60   2e-08
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    60   2e-08
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    60   2e-08
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    60   2e-08
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    60   2e-08
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    60   2e-08
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    60   2e-08
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    60   2e-08
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    60   2e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    60   2e-08
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    60   2e-08
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    60   2e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    59   2e-08
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    60   2e-08
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    60   2e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    59   3e-08
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    60   3e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    60   3e-08
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    60   3e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    59   3e-08
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    60   3e-08
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    59   3e-08
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    59   3e-08
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    59   3e-08
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    59   3e-08
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    59   3e-08
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    59   3e-08
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    59   3e-08
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    59   3e-08
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    59   3e-08
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    59   3e-08
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    59   3e-08
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    59   3e-08
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    59   4e-08
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    59   4e-08
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    59   4e-08
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    59   4e-08
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    59   4e-08
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    59   4e-08
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    59   4e-08
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    59   4e-08
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    59   4e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      59   4e-08
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    58   4e-08
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    59   4e-08
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    59   5e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    59   5e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    59   5e-08
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    59   5e-08
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    59   5e-08
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    59   5e-08
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    58   5e-08
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    59   5e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    59   5e-08
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    58   5e-08
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    59   5e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    58   5e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    58   5e-08
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    59   5e-08
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    59   5e-08
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    59   5e-08
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    59   5e-08
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    58   5e-08
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    59   6e-08
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    58   6e-08
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    59   6e-08
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    59   6e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    58   6e-08
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    58   6e-08
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    59   6e-08
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    59   6e-08
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    58   6e-08
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    59   6e-08
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    58   6e-08
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    59   6e-08
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    59   6e-08
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    58   6e-08
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    59   6e-08
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    59   7e-08
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    58   7e-08
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    58   7e-08
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    58   7e-08
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        58   7e-08
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    57   7e-08
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    58   7e-08
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    58   8e-08
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    58   8e-08
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    58   8e-08
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    58   8e-08
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    58   8e-08
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    58   9e-08
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    58   9e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    58   9e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    57   9e-08
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    58   9e-08
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    58   9e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    58   9e-08
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    58   9e-08
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    57   1e-07
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    58   1e-07
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    58   1e-07
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    57   1e-07
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    58   1e-07
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    57   1e-07
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    58   1e-07
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    57   1e-07
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    57   1e-07
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    57   1e-07
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    57   1e-07
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    57   1e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    57   1e-07
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    57   1e-07
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    57   1e-07
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    57   1e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    57   1e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    57   1e-07
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       57   1e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    57   1e-07
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    57   1e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    57   1e-07
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    57   1e-07
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    57   1e-07
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    56   1e-07
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    57   1e-07
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    57   1e-07
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    57   1e-07
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    57   2e-07
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    57   2e-07
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    57   2e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    57   2e-07
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    57   2e-07
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     57   2e-07
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    57   2e-07
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    57   2e-07
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    57   2e-07
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    57   2e-07
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    57   2e-07
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    57   2e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    57   2e-07
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    57   2e-07
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    57   2e-07
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    57   2e-07
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    57   2e-07
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    56   2e-07
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    57   2e-07
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    57   2e-07
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    57   2e-07
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    57   2e-07
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    57   2e-07
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    57   2e-07
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    57   2e-07
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    56   2e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               56   2e-07
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    57   2e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    56   2e-07
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    56   2e-07
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    56   2e-07
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    56   2e-07
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    57   2e-07
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    57   2e-07
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    56   3e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    56   3e-07
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    56   3e-07
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    56   3e-07
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    56   3e-07
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    56   3e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    56   3e-07
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    56   3e-07
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    56   3e-07
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    56   3e-07
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    55   3e-07
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    56   4e-07
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    56   4e-07
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    56   4e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    56   4e-07
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    56   4e-07
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    56   4e-07
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    55   4e-07
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    56   4e-07
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    55   4e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    55   4e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    55   4e-07
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    56   4e-07
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    56   4e-07
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    55   4e-07
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    55   5e-07
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    55   5e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    55   5e-07
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    55   5e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    55   5e-07
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    55   5e-07
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    55   5e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   5e-07
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    55   5e-07
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    55   5e-07
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    55   5e-07
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    55   5e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    55   6e-07
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    55   6e-07
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    55   6e-07
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     55   6e-07
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    55   6e-07
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    55   6e-07
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    55   6e-07
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    55   6e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    55   6e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   6e-07
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    55   6e-07
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    55   6e-07
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    54   6e-07
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    54   7e-07
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    55   7e-07
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    54   7e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    55   7e-07
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    55   7e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    55   7e-07
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    54   7e-07
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               55   7e-07
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    55   7e-07
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    55   7e-07
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    55   7e-07
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    55   7e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    55   7e-07
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    55   8e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    55   8e-07
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   8e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    55   8e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    54   8e-07
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    55   8e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    54   8e-07
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    55   8e-07
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    54   9e-07
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    55   9e-07
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    54   9e-07
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     55   9e-07
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    54   9e-07
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    54   9e-07
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    55   9e-07
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    54   9e-07
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    54   9e-07
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    55   9e-07
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    54   9e-07
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    54   9e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    54   1e-06
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    54   1e-06
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    55   1e-06
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    54   1e-06
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    54   1e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    54   1e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    54   1e-06
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     54   1e-06
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    54   1e-06
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    54   1e-06
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    54   1e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    54   1e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    54   1e-06
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    54   1e-06
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    54   1e-06
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    54   1e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    54   1e-06
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    54   1e-06
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    54   1e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   1e-06
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    54   1e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     54   1e-06
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    54   1e-06
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    54   1e-06
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    54   1e-06
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    54   1e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    54   1e-06
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    54   1e-06
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    54   1e-06
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    54   1e-06
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    54   1e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    54   1e-06
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    54   1e-06
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    54   1e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    54   1e-06
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    54   1e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    54   1e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    54   1e-06
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    54   1e-06
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    54   2e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    54   2e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    54   2e-06
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    54   2e-06
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              54   2e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    54   2e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    54   2e-06
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    54   2e-06
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    54   2e-06
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               54   2e-06
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    54   2e-06
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    54   2e-06
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    54   2e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    54   2e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    54   2e-06
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    53   2e-06
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    53   2e-06
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    53   2e-06
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    54   2e-06
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    52   2e-06
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    54   2e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    53   2e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    53   2e-06
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    54   2e-06
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    54   2e-06
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     53   2e-06
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    52   2e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    54   2e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    53   2e-06
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    54   2e-06
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    54   2e-06
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     53   2e-06
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    54   2e-06
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    53   2e-06
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    53   2e-06
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    53   2e-06
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    53   2e-06
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    53   2e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    53   2e-06
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    53   2e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    53   2e-06
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    53   2e-06
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    52   2e-06
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    53   2e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    53   2e-06
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    53   2e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    53   2e-06
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    53   2e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    54   2e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    53   2e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    53   2e-06
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    53   3e-06
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    53   3e-06
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    53   3e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    53   3e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    53   3e-06
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    53   3e-06
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    53   3e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    53   3e-06
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    53   3e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    53   3e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    53   3e-06
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    53   3e-06
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    53   3e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    53   3e-06
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    53   3e-06
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    53   3e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    52   3e-06
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    53   3e-06
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    53   3e-06
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    53   3e-06
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    53   3e-06
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    53   3e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    53   3e-06
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              53   3e-06
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    52   3e-06
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    53   3e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    52   4e-06
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    52   4e-06
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    52   4e-06
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    52   4e-06
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    52   4e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    53   4e-06
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    53   4e-06
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    52   4e-06
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    51   4e-06
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    52   4e-06
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    52   4e-06
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    52   4e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    52   4e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    52   4e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    52   4e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   4e-06
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     52   4e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    52   4e-06
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    52   4e-06
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    52   4e-06
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    52   5e-06
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    52   5e-06
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    52   5e-06
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    52   5e-06
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    52   5e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    51   5e-06
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    52   5e-06
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    52   5e-06
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    52   5e-06
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    52   5e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    52   5e-06
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    52   5e-06
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    52   6e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    52   6e-06
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    52   6e-06
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    52   6e-06
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    52   6e-06
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    51   6e-06
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    52   6e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    52   6e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    52   6e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    51   6e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    52   6e-06
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    52   6e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    51   6e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    52   6e-06
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    52   6e-06
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    52   6e-06
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     52   6e-06
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    52   6e-06
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    52   6e-06
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    51   6e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    50   6e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    51   7e-06
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    51   7e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    52   7e-06
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    52   7e-06
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    52   7e-06
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    52   7e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    50   7e-06
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    52   7e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    52   7e-06
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    51   7e-06
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               52   7e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    51   7e-06
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    52   7e-06
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    52   7e-06
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    52   7e-06
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    52   7e-06
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    52   7e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    51   8e-06
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    51   8e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     51   8e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    52   8e-06
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    51   8e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    51   8e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    51   8e-06
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    52   8e-06
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    51   8e-06
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    51   8e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    51   8e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    52   8e-06
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    52   8e-06
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    51   8e-06
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    51   9e-06
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    51   9e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    51   9e-06
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    51   9e-06
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    51   9e-06
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    51   9e-06
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    51   9e-06
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    51   9e-06
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    51   1e-05
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    51   1e-05
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    50   1e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    51   1e-05
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    51   1e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    51   1e-05
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    51   1e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     51   1e-05
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    51   1e-05
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    51   1e-05
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    51   1e-05
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              50   1e-05
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    51   1e-05
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    51   1e-05
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    51   1e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               51   1e-05
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    51   1e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   1e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    51   1e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    50   1e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    51   1e-05
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    51   1e-05
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    51   1e-05
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    51   1e-05
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              51   1e-05
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    51   1e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    50   1e-05
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    51   1e-05
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    50   1e-05
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    50   1e-05
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              51   1e-05
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    51   1e-05
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    50   1e-05
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    51   1e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    50   1e-05
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    51   1e-05
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    51   1e-05
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    51   1e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    51   1e-05
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    51   1e-05
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    51   1e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    51   1e-05
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    50   1e-05
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    51   1e-05
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    51   1e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    50   1e-05
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    50   1e-05
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    50   1e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    50   1e-05
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    50   1e-05
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    50   2e-05
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    50   2e-05
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    49   2e-05
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    50   2e-05
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    50   2e-05
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              50   2e-05
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    50   2e-05
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    50   2e-05
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    50   2e-05
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    50   2e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    50   2e-05
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    50   2e-05
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    50   2e-05
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    49   2e-05
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    50   2e-05
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    50   2e-05
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    50   2e-05
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    50   2e-05
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    49   2e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    50   2e-05
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    50   2e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    50   2e-05
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              50   2e-05
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    50   2e-05
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    50   2e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    50   2e-05
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    50   2e-05
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    50   2e-05
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    50   2e-05
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    50   2e-05
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    50   2e-05
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    50   2e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   2e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    50   2e-05
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    50   2e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    50   2e-05
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    50   2e-05
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    50   2e-05
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    50   2e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   2e-05
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    50   2e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    50   2e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    49   2e-05
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    50   2e-05
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    50   2e-05
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    50   2e-05
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    50   2e-05
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    50   2e-05
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    50   2e-05
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    49   3e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    50   3e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    50   3e-05
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    50   3e-05
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    49   3e-05
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    50   3e-05
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    49   3e-05
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    50   3e-05
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    50   3e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    49   3e-05
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    50   3e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    50   3e-05
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    50   3e-05
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    49   3e-05
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      50   3e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    50   3e-05
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    50   3e-05
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    49   3e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    47   3e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    50   3e-05
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    49   3e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    49   3e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    49   3e-05
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    49   3e-05
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    49   3e-05
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    49   3e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    49   4e-05
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    49   4e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    48   4e-05
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     49   4e-05
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    49   4e-05
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    49   4e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    49   4e-05
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    49   4e-05
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    49   4e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    49   4e-05
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    49   4e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    49   4e-05
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    49   4e-05
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    49   4e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    49   4e-05
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     49   4e-05
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    49   4e-05
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    49   4e-05
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    49   4e-05
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    49   4e-05
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    49   4e-05
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    49   4e-05
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    49   4e-05
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    49   4e-05
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    49   4e-05
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    49   4e-05
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    49   4e-05
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    49   5e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    49   5e-05
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    49   5e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    48   5e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    49   5e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    49   5e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    49   5e-05
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    49   5e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    49   5e-05
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    49   5e-05
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    49   5e-05
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    49   5e-05
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    49   5e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    49   5e-05
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    49   5e-05
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    49   5e-05
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    49   5e-05
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    49   6e-05
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    49   6e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   6e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    48   6e-05
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    49   6e-05
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    49   6e-05
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    49   6e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    49   6e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    48   6e-05
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    47   6e-05
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    48   6e-05
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    49   6e-05
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    48   6e-05
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    48   6e-05
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    49   6e-05
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    49   6e-05
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    49   7e-05
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    48   7e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    49   7e-05
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     48   7e-05
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               48   7e-05
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    48   7e-05
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    48   7e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    48   7e-05
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    47   7e-05
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    48   7e-05
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    48   7e-05
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    48   7e-05
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    48   7e-05
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    48   7e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    48   8e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    48   8e-05
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    48   8e-05
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    48   8e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    48   8e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    48   8e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    48   8e-05
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    48   8e-05
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    48   8e-05
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    48   8e-05
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    48   9e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    47   9e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    48   9e-05
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    48   9e-05
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    48   9e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    48   1e-04
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    47   1e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    48   1e-04
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    47   1e-04
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    48   1e-04
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    48   1e-04
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    48   1e-04
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    48   1e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    48   1e-04
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    48   1e-04
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    48   1e-04
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    47   1e-04
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    48   1e-04
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    48   1e-04
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    47   1e-04
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    47   1e-04
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    48   1e-04
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    48   1e-04
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    47   1e-04
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    48   1e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   1e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    47   1e-04
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    47   1e-04
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    47   1e-04
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    47   1e-04
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    47   1e-04
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    47   1e-04
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    47   1e-04
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    48   1e-04
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    47   1e-04
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    47   1e-04
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    47   1e-04
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     47   1e-04
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    47   1e-04
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    47   1e-04
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    47   1e-04
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       47   2e-04
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    47   2e-04
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    47   2e-04
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    47   2e-04
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    47   2e-04
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    47   2e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    47   2e-04
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    47   2e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    47   2e-04
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    47   2e-04
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    47   2e-04
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    47   2e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   2e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    47   2e-04
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    47   2e-04
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    47   2e-04
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    47   2e-04
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    47   2e-04
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    47   2e-04
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    47   2e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    46   2e-04
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    47   2e-04
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    47   2e-04
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    46   2e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    47   2e-04
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    47   2e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    46   2e-04
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    47   2e-04
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    46   2e-04
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    47   2e-04
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    47   2e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    47   2e-04
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    47   2e-04
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    47   2e-04
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    47   2e-04
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    47   2e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    47   2e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      47   2e-04
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    47   2e-04
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    47   2e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     47   2e-04
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    47   2e-04
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    47   2e-04
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    47   2e-04
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    47   2e-04
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    47   2e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    46   2e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    47   2e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    46   2e-04
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    47   2e-04
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    47   2e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    47   3e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    46   3e-04
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    46   3e-04
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    46   3e-04
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    45   3e-04
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    45   3e-04
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    46   3e-04
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    46   3e-04
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    47   3e-04
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    46   3e-04
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    47   3e-04
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    46   3e-04
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    46   3e-04
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    46   3e-04
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    47   3e-04
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    46   3e-04
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    46   3e-04
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    46   3e-04
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    46   3e-04
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    46   3e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    46   3e-04
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    45   3e-04
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    46   3e-04
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    46   3e-04
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    46   3e-04
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    46   3e-04
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    45   3e-04
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    45   3e-04
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    46   3e-04
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    46   3e-04
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     46   3e-04
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    45   4e-04
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    46   4e-04
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    46   4e-04
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    46   4e-04
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    46   4e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    45   4e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      46   4e-04
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     46   4e-04
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       45   4e-04
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    46   4e-04
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    46   4e-04
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    45   4e-04
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    46   4e-04
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    45   4e-04
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    45   4e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    46   4e-04
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    45   4e-04
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     46   4e-04
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    45   4e-04
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    45   4e-04
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    45   4e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    45   4e-04
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    45   4e-04
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    45   4e-04
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    46   5e-04
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    46   5e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    45   5e-04
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    46   5e-04
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    46   5e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    45   5e-04
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     45   5e-04
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    46   5e-04
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               45   5e-04
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    45   5e-04
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    45   5e-04
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    45   5e-04
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    45   5e-04
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     45   5e-04
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    45   5e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    45   5e-04
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    45   5e-04
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    45   5e-04
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    45   5e-04
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    45   5e-04
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    45   5e-04
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    46   5e-04
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    45   5e-04
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    45   5e-04
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    45   5e-04
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    45   5e-04
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    45   5e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    45   6e-04
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    45   6e-04
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    45   6e-04
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    45   6e-04
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    45   6e-04
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    45   6e-04
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    45   6e-04
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    45   6e-04
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    45   6e-04
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    45   6e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    45   6e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    45   6e-04
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    45   6e-04
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    45   6e-04
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    45   6e-04
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              45   6e-04
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    45   6e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    45   7e-04
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    45   7e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    44   7e-04
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    45   7e-04
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    45   7e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    45   7e-04
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    45   7e-04
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    45   7e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    45   7e-04
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    45   7e-04
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    45   7e-04
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    45   7e-04
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    45   7e-04
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    45   8e-04
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    45   8e-04
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    45   8e-04
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    45   8e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    45   8e-04
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    44   8e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    45   8e-04
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    44   8e-04
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    45   8e-04
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    44   8e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    44   8e-04
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    45   8e-04
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    45   9e-04
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    45   9e-04
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    45   9e-04
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    45   9e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    45   9e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    45   9e-04
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    45   0.001
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    45   0.001
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    44   0.001
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    44   0.001
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    44   0.001
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    44   0.001
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    45   0.001
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    45   0.001
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    44   0.001
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    45   0.001
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    44   0.001
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    45   0.001
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    44   0.001
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    44   0.001
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    45   0.001
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    44   0.001
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    45   0.001
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       44   0.001
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    44   0.001
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    44   0.001
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    44   0.001
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    44   0.001
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    44   0.001
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    44   0.001
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    44   0.001
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     44   0.001
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    44   0.001
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    44   0.001
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    44   0.001
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    44   0.001
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    44   0.001
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    44   0.001
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    44   0.001
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    44   0.001
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    44   0.001
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    44   0.001
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    44   0.001
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    44   0.001
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    44   0.001
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    44   0.001
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    44   0.002
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    43   0.002
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    44   0.002
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    44   0.002
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    44   0.002
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    44   0.002
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    44   0.002
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    44   0.002
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.002
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    44   0.002
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    44   0.002
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    44   0.002
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    44   0.002
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    44   0.002
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    44   0.002
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    44   0.002
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    44   0.002
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    43   0.002
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.002
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             44   0.002
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    44   0.002
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    44   0.002
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    44   0.002
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    44   0.002
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    44   0.002
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    43   0.002
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    44   0.002
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    44   0.002
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    44   0.002
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    44   0.002
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    43   0.002
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    44   0.002
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    44   0.002
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    43   0.002
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    44   0.002
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    44   0.002
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    43   0.002
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    43   0.002
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    44   0.002
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    43   0.002
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    44   0.002
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    43   0.002
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    44   0.002
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    43   0.002
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    44   0.002
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    43   0.002
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    43   0.002
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    44   0.002
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    43   0.002
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     43   0.002
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    43   0.002
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    44   0.002
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    43   0.003
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    43   0.003
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    43   0.003
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    43   0.003
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    43   0.003
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    43   0.003
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    43   0.003
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    43   0.003
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    43   0.003
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    43   0.003
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    43   0.003
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    43   0.003
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               43   0.003
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    43   0.003
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    43   0.003
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    42   0.003
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    43   0.003
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    43   0.003
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    43   0.003
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    42   0.003
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    42   0.003
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    43   0.003
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    43   0.003
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    43   0.003
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    43   0.003
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    43   0.003
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    43   0.003
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    43   0.003
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    43   0.003
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    43   0.003
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    43   0.003
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    42   0.003
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    42   0.003
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    43   0.003
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    42   0.004
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    43   0.004
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    42   0.004
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    43   0.004
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    43   0.004
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    42   0.004
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    43   0.004
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    42   0.004
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    42   0.004
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    43   0.004
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    43   0.004
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    42   0.004
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    42   0.004
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    42   0.004
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    42   0.004
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    42   0.005
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    42   0.005
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    42   0.005
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    42   0.005
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    42   0.005
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    42   0.005
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    42   0.005
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    42   0.005
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    42   0.005
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    42   0.005
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    42   0.005
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    42   0.005
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    42   0.005
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    42   0.005
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    42   0.005
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    42   0.005
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    42   0.005
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    42   0.005
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    42   0.005
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    42   0.005
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    42   0.005
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    42   0.005
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    42   0.005
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    42   0.005
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    42   0.005
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    42   0.005
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    42   0.006
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    42   0.006
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    42   0.006
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    42   0.006
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    42   0.006
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    42   0.006
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    42   0.006
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    42   0.006
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    42   0.007
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    42   0.007
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    42   0.007
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    42   0.007
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    42   0.007
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    42   0.007
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    42   0.007
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    42   0.007
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.007
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    42   0.007
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    42   0.007
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    42   0.007
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    42   0.007
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    41   0.007
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    42   0.008
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    42   0.008
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    41   0.008
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    42   0.008
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.008
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    42   0.008
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    42   0.009
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    41   0.009
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    41   0.009
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    41   0.009
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.009
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    41   0.009
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    41   0.009
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    41   0.009
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    41   0.009
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    41   0.010
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    41   0.010
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    41   0.010
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    41   0.010
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    41   0.010
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    41   0.010
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    41   0.010
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    41   0.011
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    41   0.011
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    41   0.011
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    41   0.011
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    41   0.011
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    41   0.011
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    41   0.012
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    41   0.012
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    41   0.012
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    40   0.012
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    41   0.012
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    41   0.012
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    41   0.012
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    40   0.013
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    41   0.013
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              41   0.013
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    41   0.013
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    41   0.013
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    41   0.013
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    40   0.013
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    41   0.013
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    41   0.014
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    41   0.014
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    41   0.014
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    41   0.014
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    40   0.015
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    41   0.015
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    41   0.015
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    41   0.016
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    41   0.016
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    41   0.016
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    40   0.016
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    40   0.016
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    40   0.016
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    40   0.017
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    40   0.017
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    41   0.017
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    40   0.017
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     40   0.017
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               40   0.017
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    40   0.017
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    40   0.018
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    40   0.018
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    40   0.018
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    40   0.018
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    40   0.018
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    40   0.019
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    40   0.019
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    40   0.019
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    40   0.019
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    40   0.019
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    40   0.019
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    40   0.019
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    40   0.020
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    40   0.020
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    40   0.020
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    40   0.021
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    40   0.021
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    40   0.022
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    40   0.023
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    40   0.023
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    40   0.023
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    40   0.023
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    40   0.024
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    40   0.025
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    40   0.025
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    40   0.025
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    39   0.025
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    40   0.026
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    40   0.026
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               40   0.026
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    40   0.027
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    40   0.028
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    40   0.028
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    40   0.029
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    40   0.029
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    39   0.029
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    40   0.029
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    40   0.030
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    40   0.030
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    40   0.031
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    40   0.031
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    40   0.032
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    39   0.032
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    40   0.032
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    39   0.033
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    39   0.033
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    39   0.033
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               40   0.034
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    39   0.034
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    40   0.035
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    39   0.035
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    40   0.037
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    39   0.037
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    40   0.037
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    39   0.039
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    39   0.039
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    39   0.041
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.042
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    39   0.042
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    39   0.042
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    39   0.043
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    39   0.043
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               39   0.043
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    39   0.044
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    39   0.044
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    39   0.044
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    39   0.044
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    39   0.044
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.045
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    39   0.045
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    39   0.045
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    39   0.045
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    39   0.045
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    39   0.047
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    39   0.047
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    39   0.048
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    39   0.048
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    39   0.048
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    39   0.051
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    39   0.051
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    39   0.052
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    39   0.054
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    39   0.055
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    39   0.057
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    39   0.058
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    38   0.059
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    39   0.059
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    39   0.059
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    39   0.060
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    39   0.060
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    39   0.060
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    39   0.062
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    39   0.062
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    38   0.063
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    39   0.063
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    39   0.065
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    39   0.065
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    38   0.067
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    39   0.068
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    39   0.068
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    38   0.069
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    39   0.069
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    38   0.069
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    38   0.071
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    39   0.072
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    39   0.072
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    38   0.072
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    38   0.073
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    38   0.073
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    38   0.074
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.074
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    38   0.074
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    39   0.075
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    38   0.075
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    38   0.076
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    38   0.079
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    39   0.080
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    38   0.081
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    38   0.081
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    38   0.084
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    38   0.087
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              38   0.089
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    38   0.092
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    38   0.093
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    38   0.097
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    38   0.097
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    38   0.10 
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    37   0.11 
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    38   0.11 
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    38   0.12 
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    38   0.12 
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    37   0.13 
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    37   0.13 
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    37   0.13 
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    38   0.13 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.13 
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    37   0.14 
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    37   0.14 
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    37   0.14 
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    37   0.15 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.15 
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     37   0.15 
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    37   0.15 
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    37   0.15 
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    37   0.16 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    37   0.16 
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    37   0.16 
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    37   0.16 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    37   0.16 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.16 
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    37   0.16 
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    37   0.17 
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    37   0.17 
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    37   0.17 
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    37   0.17 
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    37   0.17 
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    37   0.18 
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    37   0.18 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    37   0.18 
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    37   0.18 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.19 
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    37   0.19 
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    37   0.19 
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    37   0.19 
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    37   0.19 
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    37   0.20 
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    37   0.20 
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    37   0.20 
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    37   0.22 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    37   0.22 
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    37   0.22 
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    37   0.22 
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    37   0.23 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    37   0.24 
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    37   0.24 
Skud_14.175 Chr14 (330240..330842) [603 bp, 200 aa] {ON} YNL158W...    36   0.24 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    37   0.24 
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               37   0.24 
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    37   0.24 
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    37   0.25 
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    36   0.25 
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    37   0.25 
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    37   0.26 
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    37   0.27 
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    36   0.28 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    37   0.28 
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    37   0.29 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    36   0.29 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    37   0.30 
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    37   0.30 
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    36   0.31 
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    37   0.31 
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    36   0.31 
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    36   0.32 
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    36   0.32 
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    36   0.32 
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    36   0.32 
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    37   0.32 
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    36   0.32 
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    36   0.33 
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    36   0.34 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.35 
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    36   0.35 
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    36   0.36 
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    36   0.37 
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    36   0.37 
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    36   0.37 
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    36   0.37 
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    36   0.38 
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    36   0.38 
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    36   0.40 
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    36   0.41 
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    36   0.43 
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    36   0.43 
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    36   0.45 
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    36   0.46 
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    36   0.47 
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    36   0.47 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    35   0.48 
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    36   0.48 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    36   0.48 
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    36   0.50 
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    36   0.50 
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    36   0.50 
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    36   0.53 
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    35   0.54 
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     36   0.55 
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    35   0.55 
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    35   0.56 
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    35   0.57 
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    35   0.59 
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    35   0.59 
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    35   0.59 
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    35   0.59 
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    35   0.60 
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    35   0.60 
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    35   0.60 
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    35   0.61 
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    35   0.62 
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    35   0.63 
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    35   0.63 
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    35   0.63 
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    35   0.64 
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    35   0.64 
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    35   0.64 
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    35   0.65 
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    35   0.65 
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    35   0.68 
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    35   0.71 
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    35   0.75 
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    35   0.75 
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    35   0.77 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    35   0.79 
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    35   0.79 
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    35   0.80 
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    35   0.80 
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    35   0.81 
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    35   0.82 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    35   0.83 
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    35   0.84 
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    35   0.85 
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    35   0.85 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    35   0.86 
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    35   0.87 
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    35   0.88 
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    35   0.96 
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    34   0.97 
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    35   1.0  
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    34   1.0  
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    35   1.0  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    35   1.0  
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    35   1.1  
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    35   1.1  
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    34   1.1  
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    35   1.1  
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    35   1.2  
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    35   1.2  
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    34   1.2  
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    34   1.2  
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    34   1.2  
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    34   1.3  
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    34   1.3  
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    34   1.3  
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    34   1.4  
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    34   1.5  
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    34   1.5  
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    34   1.5  
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    34   1.5  
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    34   1.5  
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    34   1.6  
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    34   1.6  
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    34   1.6  
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    34   1.6  
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    34   1.6  
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    34   1.7  
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    34   1.7  
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    34   1.8  
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    34   1.8  
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    34   1.9  
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    34   1.9  
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    34   1.9  
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    34   2.1  
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    34   2.1  
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    33   2.2  
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    33   2.2  
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    34   2.3  
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    33   2.5  
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    33   2.5  
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    33   2.6  
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    33   2.9  
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               33   2.9  
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    33   3.0  
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    33   3.0  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    33   3.1  
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    33   3.1  
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    33   3.2  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    33   3.4  
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    33   3.5  
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    33   3.6  
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    33   3.6  
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    33   4.0  
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    33   4.3  
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    33   4.5  
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    32   4.6  
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               32   4.7  
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    32   4.8  
NDAI0F02980 Chr6 complement(725796..727634) [1839 bp, 612 aa] {O...    32   4.8  
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    32   4.9  
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    32   5.0  
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    32   5.1  
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    32   5.4  
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    32   5.4  
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    32   5.4  
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    32   5.7  
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    32   5.8  
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    32   6.8  
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    32   7.1  
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    32   7.2  
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    32   8.3  
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    32   9.1  
TBLA0H03010 Chr8 (739587..740201) [615 bp, 204 aa] {ON} Anc_1.25...    31   9.2  

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score = 1547 bits (4005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/788 (96%), Positives = 760/788 (96%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 241 LLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQ 300
           LLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQ
Sbjct: 241 LLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQ 300

Query: 301 NIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQSAKETTAIRVGKEISPLKPQLS 360
           NIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQSAKETTAIRVGKEISPLKPQLS
Sbjct: 301 NIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQSAKETTAIRVGKEISPLKPQLS 360

Query: 361 PIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSLEDGNNGLENHYLSSS 420
           PIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSLEDGNNGLENHYLSSS
Sbjct: 361 PIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSLEDGNNGLENHYLSSS 420

Query: 421 VPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVDSETQTLEEPSLQHTRILPHIS 480
           VPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVDSETQTLEEPSLQHTRILPHIS
Sbjct: 421 VPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVDSETQTLEEPSLQHTRILPHIS 480

Query: 481 TDRTDNTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANN 540
           TDRTDNTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANN
Sbjct: 481 TDRTDNTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANN 540

Query: 541 VKALSVENARNHLERLXXXXXXXXXXXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSE 600
           VKALSVENARNHLERL            AKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSE
Sbjct: 541 VKALSVENARNHLERLGSSYSIGSNNNIAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSE 600

Query: 601 LSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAG 660
           LSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAG
Sbjct: 601 LSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAG 660

Query: 661 YGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNGXXXX 720
           YGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNG    
Sbjct: 661 YGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNGKYPA 720

Query: 721 XXXXXXXXXXXXDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFK 780
                       DHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFK
Sbjct: 721 KSKAPPVVPKKPDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFK 780

Query: 781 QRYPSTVS 788
           QRYPSTVS
Sbjct: 781 QRYPSTVS 788

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/844 (40%), Positives = 469/844 (55%), Gaps = 122/844 (14%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MN P I  +P G ++ VGSH AK++KYLTSGG+AQ+Y VEISP D Y NSNIACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAMKLLKNNRHVVSYIDS+A+KS   NG+YEVF+LME+CERG L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MN++L+ RL E E+L IM+   QGIAAMH+L P L+HRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCGI+RPP+N QE  +V HD+MKNTTAQYRSPEM+DL KG PI  K      W + + + 
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKS---DIWALGVFLY 237

Query: 241 -LLHYTF---REDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
            L +YT    +   E AIL  R+QYP+YP+YSDRLKN++RV+LS +P  RPN+CQ+LEE+
Sbjct: 238 KLCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEV 297

Query: 297 SKIQNIPCPIDNFYLERSRHQGAVSV--------MPVNFSRANTTQFTDQSAKE---TTA 345
           S++Q IPCPI NFYL R+      ++        MP   S+  +TQ    S  +   T A
Sbjct: 298 SRLQGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQP-STQMNLASLNDTLPTAA 356

Query: 346 IRVGKEISPLKPQLSPIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLY--N 403
           ++  +   P   Q       + P L+ T+T P   N H  P  I  V +K     L   +
Sbjct: 357 LKFNQTTIPPTNQ-------HSPHLLHTQTLPLPTNDH--PVAISHVQDKISPHELLKKS 407

Query: 404 SLEDGNNGLENHYLSSSVPAISYLANQHANDNI----------RNTTKLNIPAQNSTGSK 453
           S   G+ G  N  +  +     +    HA+ N            +++  N+P  N + S 
Sbjct: 408 SKSLGSTGTSNKNVIDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSP 467

Query: 454 NKT----------------YVDSETQTLEEPSLQHTRI---------LPHISTDRTDNTG 488
            K+                YVD ETQT    S    R              S  + + TG
Sbjct: 468 QKSWKSINDNYDVSKRPTNYVDEETQTYTGQSTFLRRTSSNRSNRSISSQYSGVQENTTG 527

Query: 489 NSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALSVEN 548
           +S+V +L V+L+NV+T +     SI + Q TG+SI+SA+ S+++  +G  NN ++ S +N
Sbjct: 528 SSLVRKLSVKLKNVLTGE-----SIKSRQNTGDSIRSAMNSIRSGFTGNNNNTRSASYDN 582

Query: 549 ARNHLERLXXXXXXXXXXXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELY 608
            +    RL             + +S         + +SN+LK        +  +   E Y
Sbjct: 583 GK----RLSSVNLHMHSAILEQDDSDEFEMPRYNSVSSNTLKDVEEHERRTVNTSSREYY 638

Query: 609 DTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVK--KTAAGYGKYT- 665
                       +S SP++ +V+R+MK SI+KRV +LLKNAE++     +TA+GYGKYT 
Sbjct: 639 ------------RSQSPVRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTD 686

Query: 666 --KRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNGXXXXXXX 723
             K    +SPT        Q+    T  + S  G    P   P    RD+          
Sbjct: 687 YNKNKDEISPTKSRVAQFNQS----TAALASLSGKRKKP---PVPYKRDS---------- 729

Query: 724 XXXXXXXXXDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRY 783
                      L+P PP KPA LSS  +    S+ V +   D+L D +VD++EK  ++R+
Sbjct: 730 -----------LKPTPPAKPAFLSSRPV---ASSRVSSNATDMLVDLSVDDIEKDIRRRF 775

Query: 784 PSTV 787
           PSTV
Sbjct: 776 PSTV 779

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  491 bits (1265), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 325/813 (39%), Positives = 445/813 (54%), Gaps = 86/813 (10%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP IP YP G ++ VG+H+A I KYLTSGGFAQIY+VEI+P D Y+ SN+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P KSGLN LR EVDAMKLLKNNRHVVSYIDSNA KS F NGSYEV LLMEYCE G L+DF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MN++L+ RL E E+LNI++Q  QG+A MH L P L+HRDIKIENVL SG+G FK+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           VCG IRPPRN QEL YVQHD++KNTTAQYR PEM+DL +G PI+ K  I  LG +     
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             L +YT  F +  E AIL+ ++QYPA+PIYSDRLKN++RV+LS +P KRPNIC+LLEEI
Sbjct: 239 --LCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296

Query: 297 SKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQSAKETTAIRVGKEISPL- 355
           S IQ +PCPI NFYL R++              AN  Q   Q+      I   + I  L 
Sbjct: 297 SSIQGVPCPIQNFYLIRAQQL------------ANQIQLQRQTT--VPKIATAQPIQQLN 342

Query: 356 -KPQLSPIKSSYGPVLVMTKTTPNSFNSHHTPPPIGI-----VSNKTIAKPLYNSL---E 406
            + Q  PI ++     ++T  T    + +   P + +       + ++ K +Y  L   +
Sbjct: 343 ARTQTMPIINTKANTSLVTPITVPVLSENTRLPALELDIKVPQFSPSLDKDMYMKLHPFQ 402

Query: 407 DGNNGLENHYLSSSVPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVDSETQTLE 466
                L     +S  P   Y++   + DN     +    +Q         Y+        
Sbjct: 403 KSGTLLTPSKTASVSPIRRYISRSPSRDNTNYDIQRRRTSQYDHDQNQSNYMGRSLS--R 460

Query: 467 EPSLQHTRILPHISTDRTDNTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSA 526
             S++ T  L      + +NTG+S   +   +++ V+T +S  +S I + Q+TG S++SA
Sbjct: 461 TSSIKSTSALSFEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQDTGGSVRSA 520

Query: 527 IESLKNSVSGMANNVKALSVENARNHLERLXXXXXXXXXXXXAKPNSAPIIPAVVTTHTS 586
             +++ + +G   +++A S++N  N+                 + N   II   +    S
Sbjct: 521 FGAIRGAFTG---SMRAPSLDNNTNNSMHNNSNNNTSRNSSYGRHN---IITNPIKEEDS 574

Query: 587 NSLKTAVSSPTHS----------ELSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKA 636
            ++  A  +  H+           L  ENE Y           ++S SP K  V +  + 
Sbjct: 575 RNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHA------SEYYRSHSPTKPFVTKTTRD 628

Query: 637 SIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSAR 696
           +I++RV NLL  +E  P+++                  N   H     S S  P  L++R
Sbjct: 629 NIQQRVQNLLSESEQ-PMER-----------------NNIDTHHTNAVSHSMIPRNLNSR 670

Query: 697 --GSSGHPVVVPALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPPKKPAHLSSLKINKK 754
              S  +  VV   IN   D G                 HLRPKPP KP +LS +   ++
Sbjct: 671 EKDSLRYSSVV---INPLEDIG---SSPKKAPPLPFKPHHLRPKPPPKPTYLSKMFSKER 724

Query: 755 HSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787
            S+T      + L    VD LE+ F++R+PST+
Sbjct: 725 ISSTA----TEQLVTLDVDTLERDFRKRFPSTL 753

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  483 bits (1243), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 331/834 (39%), Positives = 446/834 (53%), Gaps = 91/834 (10%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQ +   Y PG  + VGSH+A+I+KYLTSGGFA IY+ EI P D  + + IACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LNVLR EVDAMKLL+ N+HVVSYIDS+AAKS   +GSYEVFLLMEYC  G L+DF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RLQE EVL I + + QGIAAMH L PPLIHRDIKIENVLIS D  FKVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCG+IRPP+NPQE  YVQHD++KNTTAQYR+PEMIDL +G+PI  K      W + + + 
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKS---DIWALGVFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E AIL+ R+Q+P+YP YSD LK+++  +LS +P +RPNICQ+LEE+S
Sbjct: 238 KLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVS 297

Query: 298 KIQNIPCPIDNFYLERSRHQGAVSVMP-VNFSRANTTQFTDQSAKETTAIRVGKEISPLK 356
           +IQ  PCP+ NFY+ R+  Q      P + F  + +    D +      I V  ++S  +
Sbjct: 298 RIQGTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSA---NNIINVPFKMSHNQ 354

Query: 357 PQLSPIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIAKPLYNSLEDGNNGLENHY 416
           P  S    +  PV        N +     P PI  VS+     P      +GN  L++  
Sbjct: 355 PLRSTQTFAGAPV----NAASNGYLPALKPLPIQPVSSSFTNGPF--KFIEGNKALQSKQ 408

Query: 417 LSSSVPAISYLANQHANDNI-------------------RNTTKLNIPAQNSTGSKNKTY 457
                P IS+  N+                         R      I A  +    +  Y
Sbjct: 409 TPHFQPPISHDFNRLGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISANPTNVEPSPIY 468

Query: 458 VDSETQTLEEPSLQHTRILPHI---------STDRTDNTGNSIVSRLGVQLRNVITNDSS 508
           + S TQT +  +  H   L             +  + +TG S   R G +L+ V T +  
Sbjct: 469 LSSGTQTDDGFASSHALKLERTKSIASLSSSESVESQHTGGSATRRFGQKLK-VFTGERR 527

Query: 509 ASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALSVENARNHLERLXXXXXXXXXXXX 568
           + S I + Q TG+S++SA  +L+   SG +   +   + N RN L+              
Sbjct: 528 SISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSE---LPNKRNSLD---------ISSTS 575

Query: 569 AKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDTLHLPD--PKTSFQSPSPL 626
           +  N      +   +    ++    S    S  +      D L   D   K  ++S SP+
Sbjct: 576 SHSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQDDTGAKNYYKSHSPV 635

Query: 627 KYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQ--- 683
           K +  +  ++SI+KRV +LLKN++DSPVKKTA GYG       M+SP +    L  Q   
Sbjct: 636 KVSATQGSRSSIQKRVQDLLKNSQDSPVKKTAHGYG-------MLSPGDEAAELASQLTN 688

Query: 684 --------NSVSQTPLILS--ARGSSGHPVVVPALINRDNDNGXXXXXXXXXXXXXXXXD 733
                    S + TP +LS   R SS   VV+ A        G                 
Sbjct: 689 ETMLQNVHQSTASTPKVLSPAKRNSS---VVIKA--------GQQVSKDAEEVPSSRKPA 737

Query: 734 HLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787
             +PK PKKP+HL + KI K+  T+      D +SD  +DELEK FK+R+PS V
Sbjct: 738 PPKPKRPKKPSHLKADKIIKEAETSAYEHSVD-ISDIEIDELEKDFKRRFPSAV 790

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  459 bits (1181), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 258/329 (78%), Gaps = 8/329 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP IP YPPG ++ VGSH  KI+KYLTSGGFAQIY+ EISP + Y NS  ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K+GLN LR EVDAMKLLKNNRHVVSYIDS+AA+S    G+YEVFLLMEYC+ G L+DF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E+E+LNI++Q  QG++AMH L P LIHRDIKIENVLIS  G FK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           VC  IRPPRNPQEL YVQHDV+KNTTAQYR+PEM+DL +G PI  K  I  LG +     
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             L +YT  F +  E AIL+ RYQYPA+PIY+D+LKN++R  L   P KRPNICQLLEEI
Sbjct: 239 --LCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEI 296

Query: 297 SKIQNIPCPIDNFYLERSRHQGAVSVMPV 325
           S+IQ IPCPI+NFYL R+ +  A  + P+
Sbjct: 297 SRIQGIPCPINNFYLSRTINVQASLMNPI 325

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  456 bits (1173), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/317 (66%), Positives = 256/317 (80%), Gaps = 6/317 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP IPNY PG V+ VGSH AK++ YLTSGGFAQ+YS EI P D + +SN+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAMKLL+NN+HVVSYIDS+AAKS F NGSYEVFLLMEYC  G L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RLQE E+LNIM+QV QGIAAMH L PPLIHRDIKIENVLIS  G +KVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCG+IRPP+NPQE  YVQHDV+KNTTAQYRSPEMIDL +G PI+ K      W + + + 
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKS---DIWALGVFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E+AIL+ R+Q+PA PIYSDRLK ++R +L  +P +RPN+CQ+LE++S
Sbjct: 238 KLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVS 297

Query: 298 KIQNIPCPIDNFYLERS 314
           ++Q I CP+ NFYL R+
Sbjct: 298 RMQGIQCPVRNFYLLRA 314

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 59/163 (36%), Gaps = 40/163 (24%)

Query: 625 PLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQN 684
           PL     R+ K SI++RV +LL ++ED P+ K+          PK    +  H+      
Sbjct: 539 PLTSVRSREAKESIQRRVRDLLNSSEDLPLSKSEPK----KDEPKRGQLSKTHH------ 588

Query: 685 SVSQTPLILSARGSSGHPVVVPALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPPKKPA 744
              + P +         P   P                           HLRPKPP KPA
Sbjct: 589 --DEKPSVKEKSKQKVRPRAPP------------------------KPAHLRPKPPPKPA 622

Query: 745 HLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787
            LS     KK   T  +     + D  V+ LE+  ++    T+
Sbjct: 623 FLS----GKKMVDTEPSEAGKAVIDAKVESLERDLRKEVTGTL 661

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  458 bits (1178), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/322 (66%), Positives = 259/322 (80%), Gaps = 7/322 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MN P I  Y PG ++ VGSH AKI+KYLTSGGFAQ+YS EISP D Y+++NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K GLN LR EVDAMKLLKNN+HVVSYIDS+AAKS  G  +YEVF+LMEYCERG L+DF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-VAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RLQE E+L+IM Q  QGIAAMH L PPLIHRDIKIENVLIS +GL+KVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G+IRPP+NPQE  YVQHD++ NTTAQYRSPEMIDL +G PI+ K      W + + + 
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKS---DIWALGVFLY 236

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            + +YT  F +  E AIL+ RYQYP++P YSDRLKN++R++L   P +RPNICQ+LEE+S
Sbjct: 237 KICYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVS 296

Query: 298 KIQNIPCPIDNFYLERSRHQGA 319
           ++QN PCPI NFYL R+ +Q A
Sbjct: 297 RLQNRPCPIRNFYLLRAMNQNA 318

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 155/372 (41%), Gaps = 54/372 (14%)

Query: 449 STGSKNKTYVDSETQTLEEPSLQHTRILPHISTDRT----------DNTGNSIVSRLGVQ 498
           ST ++   YVDSETQTL+  +    +  P IS   T          + TG  IV  L  +
Sbjct: 455 STINRPNNYVDSETQTLDSIATLKLKPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSK 514

Query: 499 LRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMA-NNVKALSVE-NARNHLERL 556
           L+ VIT +S   S I + Q TG+SI+SA   L++  +G + NN ++ S + N  N + R 
Sbjct: 515 LKRVITGESRNGSPIKSRQNTGDSIRSAFGMLRHGFTGSSINNSRSTSFDNNNANSVNRR 574

Query: 557 XXXXXXXXXXXXAKPNSA------------------PIIPAVVTTHTSNSLKTAVSS--P 596
                          ++                   P I +    H  N+ +T       
Sbjct: 575 LTSSSSNPSSSNLNSDTKRKEELDKKRKLEHRRSMPPSILSDFDQHERNNSRTGSRDYYR 634

Query: 597 THSELSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKK 656
           +HS +        T   P  K+S          +D++ K SI++RV NLL N+EDS   K
Sbjct: 635 SHSPVKKTQTTPTTTTRPSLKSSNSD-----INIDQEKKESIQRRVHNLLNNSEDSLSYK 689

Query: 657 TAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNG 716
           +A+GYGKYT        TN      RQ+SV  TP I   R ++ H        N  ND+ 
Sbjct: 690 SASGYGKYTD--TEAESTN------RQSSVRITP-ITEERFNNYHSS------NTMNDHT 734

Query: 717 XXXXXXXXXXXXXXXXD-HLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDEL 775
                             HLR K        S+L+  K     + +   + + D  VDEL
Sbjct: 735 SSKDKPKSRPPRPPPKPLHLRTKIHNTRCS-SNLQSRKPPMERISSEATETIVDVNVDEL 793

Query: 776 EKSFKQRYPSTV 787
           E  F++R+PS V
Sbjct: 794 EADFRKRFPSKV 805

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 215/340 (63%), Positives = 267/340 (78%), Gaps = 10/340 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  Y PG ++ VGSHQ +I+KY+TSGGFAQIY+VEISP D + +SNIACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAMKLL+NN+HVVSYIDS+A+KS F NGSYEVFLLMEYCERG L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E EVL+I +QV QGIAAMH L PPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V GIIRPP NPQELQYVQHDV+KNTTAQYRSPEMID  +G PI+ K      W + + + 
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEK---SDIWAIGVFLY 237

Query: 241 -LLHYT--FRED-REVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
            L +YT  F ++  E AIL+ RY+YP +PIYS+RLK+++  +L  +P +RPNI Q++EEI
Sbjct: 238 KLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEI 297

Query: 297 SKIQNIPCPIDNFYL--ERSRHQGAVSVMPVNFSRANTTQ 334
           SK+QN+PCPI NFYL  ++ +H+  V + P+  +  N +Q
Sbjct: 298 SKMQNVPCPIVNFYLVTQQQKHK-MVQLQPIPVNTLNVSQ 336

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  451 bits (1160), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 256/322 (79%), Gaps = 7/322 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MN P I  Y PG ++ VGSH AKI+KYLTSGGFAQ+Y+ EISP D Y+N+NIACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K GLN LR EVDAMKLL+NN+HVVSYIDS+AA+S  G  +YEVF+LME+CERG L+DF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNG-IAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RLQE E+L IM+Q  QGI AMH L PPLIHRDIKIENVLIS DGL+KVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G+IRPPRN QE  YVQHD++ NTTAQYRSPEMIDL +G PI+ K      W + + + 
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEK---SDIWALGVFLY 236

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            + +YT  F +  E  IL+ RYQYP++P YSDRLKN++R++L   P +RPNICQ+LEE+S
Sbjct: 237 KICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVS 296

Query: 298 KIQNIPCPIDNFYLERSRHQGA 319
           ++QN PCPI NFYL R+ +Q A
Sbjct: 297 RLQNKPCPIRNFYLLRAMNQNA 318

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 155/362 (42%), Gaps = 47/362 (12%)

Query: 457 YVDSETQTLEEPSLQHTRILPHISTDRTDNT----------GNSIVSRLGVQLRNVITND 506
           YVDSETQT++  ++ + ++ P I++    +T          G+ IV  L  +L+ VIT +
Sbjct: 465 YVDSETQTIDNMAVPNLKLSPTITSKSLSSTKEIAAPDNINGSKIVRSLSSKLKKVITGE 524

Query: 507 SSASSSIDTVQETGNSIKSAIESLKNSVSGMA-NNVKALSVENARNHLERLXXXXXXXXX 565
           S  +S I + Q TG+SI+SA   L++  +G + NN ++ S +N   +             
Sbjct: 525 SRGNSPIKSRQNTGDSIRSAFGKLRHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSS 584

Query: 566 XXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDTLHLPDPKTSFQSPSP 625
              + P           +  +  L+   S P  S LSD ++          +  ++S SP
Sbjct: 585 STSSFPKFNSDTKRKEESDKNQRLEKRRSMPP-SILSDFDQHERNNSRTGSRDYYRSHSP 643

Query: 626 LKYA--------------------VDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYT 665
           +K                      ++++ K SI++RV NLLK+++D    K+A+GYGKYT
Sbjct: 644 VKKTQASAKTTSKPTLIPDNGNVNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYT 703

Query: 666 KRPKMVSPTNPHYHLVRQNSVSQTPLILSARGSSGHPVVVPALINRDNDNGXXXXXXXXX 725
                 S         R +SV  TP+       +    V+     +   NG         
Sbjct: 704 DIGTETSN--------RHSSVRITPITEEKFKKTLKDGVLDI---KTKSNGKDKSRPPRP 752

Query: 726 XXXXXXXDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRYPS 785
                   HLR +  +K  + S L+  K     + +   + + D  VD+LE  F++R+PS
Sbjct: 753 PPKPL---HLRTE-IQKIRNFSRLQSKKLPIERISSEATETIVDVNVDDLEADFRKRFPS 808

Query: 786 TV 787
            V
Sbjct: 809 KV 810

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  447 bits (1149), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 210/316 (66%), Positives = 255/316 (80%), Gaps = 7/316 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           M+QP +  YP G V+ VGSH+A+I+KYLTSGGFA IYS EISP D   +S+IACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAMKLLK ++ VVSYIDS+AAKS   NGSYEVFLLMEYC RG L+DF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL+E EVL IM+QV QG+AAMH L PPLIHRDIKIENVLIS DG FKVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCG+IRPP+NPQEL YVQHD++KNTTAQYRSPEMIDL +G P++ K      W + + + 
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKS---DIWALGVFLY 236

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  EVAIL+ ++Q+PAYP YSD+LKN++  LL  +P++RPNICQLL E+S
Sbjct: 237 KLCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVS 296

Query: 298 KIQNIPCPIDNFYLER 313
           +IQ +PCP+ NFYLER
Sbjct: 297 RIQGVPCPVKNFYLER 312

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 101/350 (28%), Positives = 162/350 (46%), Gaps = 37/350 (10%)

Query: 456 TYVDSETQTLE--EP---------SLQHTRILPHISTDRTDNTGNSIVSRLGVQLRNVIT 504
           +YVDSETQT E  EP         S           +    +TG S   R+G +L+ +I+
Sbjct: 461 SYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIIS 520

Query: 505 NDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALSVENARNHLERLXXXXXXXX 564
           N+   +S I + Q TG S +SA  +L+    G ++N    S  + RN ++          
Sbjct: 521 NEPRNTSPIRSRQNTGGSTRSAFSTLRR---GTSSNFS--SDRSKRNSVD--FSVRRLGS 573

Query: 565 XXXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENELYDTLHLPDPKTSFQSPS 624
                + +S+  I     T+   +     S  T S  SD N+ Y+       +   Q+ S
Sbjct: 574 GGNKVRVSSSKSIEEKGNTNKFENKGHNRSVSTSSITSDLNK-YEGKAGSVSRGYNQAHS 632

Query: 625 PLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPK-MVSPTNPHYHLVRQ 683
           P+K + +R+ + SI+KRV +LLKN++DSPV+KTA  +G+++  P+   +       ++  
Sbjct: 633 PIKMSANRESRNSIQKRVHDLLKNSQDSPVRKTAPDFGEFSSFPQDHAADHTISDKVIDV 692

Query: 684 NSVSQTPLILSARGSSGH---PVVVPALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPP 740
           ++V+ +P++  A   + H    VV P                            LRPKPP
Sbjct: 693 HNVTSSPVVQKATLDTTHQSNTVVSPTR--------KHFTRTREKPVPPPKPVRLRPKPP 744

Query: 741 KKPAHL--SSLKINKKHSTTVLNTPADLLSDTA-VDELEKSFKQRYPSTV 787
            KP HL   +L I KK      +  A+ LSD   +D+LE+ FK+RYPS +
Sbjct: 745 PKPFHLKVKNLVIPKKGR---YSNRANTLSDEVDIDDLEEDFKKRYPSAI 791

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  442 bits (1137), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 291/718 (40%), Positives = 408/718 (56%), Gaps = 94/718 (13%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  Y  G ++ VGSHQ K+LKYL SGGFA +YSVEISP D     N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K+ LN LR EVD+MK L+ N+ +VSYIDS+A KS    G YEV+LLMEYC  G L+DF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RLQE E+LNIM+QV QG+AAMH L PPLIHRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G+IR PRN +E  YVQ+D+MKNTTAQYR PEMIDL +G PI+ K     S   AL + 
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEK-----SDIWALGVF 235

Query: 241 L---LHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295
           L    +YT  F ++ E AIL  ++++PAYP YSDR+KN++ V+L   P+KRPNICQ++EE
Sbjct: 236 LYKTCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEE 295

Query: 296 ISKIQNIPCPIDNFYLER---SRHQGAVSVMPVNFSRANTTQFTDQSAKETTAIRVGKEI 352
           +S+IQ IPCPI NFYL R    + Q  VS  P      +  Q T  +   T+        
Sbjct: 296 VSRIQGIPCPIKNFYLLRMMDKQEQPRVSPPP------HVPQMTVPATVPTSV-----ST 344

Query: 353 SPLKPQL-----SPIKSS---YGPVLVMTKTTP----NSFNSHHTPPPIGI---VSNKTI 397
             L PQ+     +P K++   + P L ++K+ P        S   P    +   VSN T 
Sbjct: 345 QHLPPQVVSNVQTPSKTASIQHLPYLHVSKSQPMVTQQDLLSQKQPAGKTVPQTVSNYTS 404

Query: 398 AKPL----YNSLEDGNNGLENHYLSSSVPAISYLANQHANDNIRNTTKLNI-PAQNSTG- 451
           + P      ++L   +  +E+   +  +P + Y        +     + ++ P +N  G 
Sbjct: 405 SDPFSKIDRSALLSTSATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRGA 464

Query: 452 -----SKNKTYVD------SETQTLEEPS-LQHTRILPHIST---------DRTDNTGNS 490
                + N+T +D      SETQT + PS L  +R L   S              +TG S
Sbjct: 465 ISSILASNRTSLDRPKYVDSETQTSDHPSELGLSRSLSRKSVASSLSSAESLEATSTGGS 524

Query: 491 IVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGM---ANNVKALSVE 547
           +  ++G +++ VIT +    S+I + Q TG S+KSA  +L+  +S M    ++    S  
Sbjct: 525 LTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSSL 584

Query: 548 NARNHLERLXXXXXXXXXXXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENEL 607
            AR +                 +  S   IP   +++T  S + + SS +    +++ EL
Sbjct: 585 EARKY-----------------RSTSGKSIPENTSSNT-KSHRRSTSSFSFVPENNDYEL 626

Query: 608 YDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYT 665
            + +    PK+S +       +   K  +SI+KRV +L+ NA+D P + +A GYGKYT
Sbjct: 627 IEDIQKEKPKSSLRR------SSSLKTSSSIQKRVKDLI-NADDIPNRSSATGYGKYT 677

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  443 bits (1139), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 253/322 (78%), Gaps = 7/322 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MN P I  Y PG V+ VGSH AKI+KYLTSGGFAQ+Y+ EISP D Y+N+N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K GLN LR EVDAMKLLKNN+HVVSYIDS+AAKS  G  +YEVF+LME+CERG L+DF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL+E E+L IM+Q  QGIAAMH L PPLIHRDIKIENVLIS DGL+KVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G+IRPPRN QE  YVQHD++ NTTAQYRSPEMIDL +  PI+ K      W + + + 
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS---DIWALGVFLY 236

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            + +YT  F +  E AIL+ RYQYP++P YSDRLK ++ ++L   P +RPNICQ+LEE+S
Sbjct: 237 KICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVS 296

Query: 298 KIQNIPCPIDNFYLERSRHQGA 319
           ++QN PCPI NFYL R+  Q A
Sbjct: 297 RLQNEPCPIRNFYLLRAMGQNA 318

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 67/153 (43%), Gaps = 15/153 (9%)

Query: 635 KASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILS 694
           K SI++RV NLL N+ED    K+A+GYGKYT      S         R +SV  TP+   
Sbjct: 672 KESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASN--------RHSSVRITPITEG 723

Query: 695 ARGSSGHPVVVPALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPPKKPAHLSSLKINKK 754
                 +   +    +R++ +                  HLR +  +   + S L+  + 
Sbjct: 724 KFNKYYNSGTLKGETSRNDKHKSRPPRPPPKPL------HLRTE-IQNTRNFSRLQSRQP 776

Query: 755 HSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787
               + +   + + D  VD+LE  F++R+PS V
Sbjct: 777 QMERISSEATETIVDVNVDDLEADFRKRFPSKV 809

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  438 bits (1127), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 212/328 (64%), Positives = 255/328 (77%), Gaps = 12/328 (3%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP IP Y PG ++ VGSHQAKILKYLTSGGFAQ+Y VEISP D ++ SNIACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSE----FGNGSYEVFLLMEYCERGS 116
           P+K+ LNV R EV+AMKLL+NN++VVSYIDS+AAKS       NGSYEVFLLMEYC    
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVC 176
           L+DFMNT+L+ RL+E E+LNIM+ V QG+AAMH L PPL+HRDIKIENVLIS    FK+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWC 234
           DFGSVCG+IRPP N  EL +VQHD++KNTTAQYRSPEM+ L K  PI  K  I  LG + 
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 235 VALQIMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQL 292
                 + +YT  F ++ E AIL+ RYQYPAYP YSD LKN++RV+L   P KRPNICQ+
Sbjct: 241 YK----VCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296

Query: 293 LEEISKIQNIPCPIDNFYLERSRHQGAV 320
           +EE+S++Q +PCP+ NFYLER+  Q AV
Sbjct: 297 VEEVSRLQGVPCPLKNFYLERAIRQTAV 324

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 599 SELSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKM--KASIEKRVLNLLKNAEDSPVKK 656
           +EL  E    D+ +  D ++SF S +     +  K   K SI  R LN + +   + VKK
Sbjct: 571 TELKMELSKNDSKNAVDSRSSFNSNAEPSSELTNKTVKKNSITDRYLNSVGDNGVTSVKK 630

Query: 657 TAAGYGKYTK 666
           TA GYGKYTK
Sbjct: 631 TAEGYGKYTK 640

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  434 bits (1116), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 205/317 (64%), Positives = 251/317 (79%), Gaps = 8/317 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP +  Y PG ++ VGSHQA+I+KYLTSGGFAQ+Y+ EISP D + NS+I CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAMKLL+NN HVVSYIDS+AAK +   GSYEVFLLMEYC+RG L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L+IM+QV QG+AAMH L PPL+HRDIKIENVL++  G +K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           VCGIIRPP NPQE  YVQHD+MKNTTAQYRSPEMI+L KG PI  K  I  LG +     
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             L +YT  F +  E AIL+  +Q+P +P YSDR+K+++R+ L+  P +RPNI QLLEE+
Sbjct: 239 --LCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEV 296

Query: 297 SKIQNIPCPIDNFYLER 313
           SKIQN+PCPI +FYL+R
Sbjct: 297 SKIQNVPCPIPDFYLQR 313

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  433 bits (1114), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 206/333 (61%), Positives = 255/333 (76%), Gaps = 11/333 (3%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP IP Y PG ++ VGSH+ +++KYLTSGGFAQIY+V+ISP D++TN+N+ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVD MKLL+NN HVVSYIDS+AAK     GSYEVFLLMEYC+ G L+DF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ERL+E E+LNIM+QV QGIAAMH L PPL+HRDIKIENVL++  G +KVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           VCGIIRPP N QE+ YVQHD+MKNTTAQYR+PEMIDL +G PI+ K  I  LG +     
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             L +YT  F ++ E AIL+  +Q+P YP YSDRLK ++  +L   P +RPN  Q+LEE+
Sbjct: 239 --LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEV 296

Query: 297 SKIQNIPCPIDNFYLER---SRHQGAVSVMPVN 326
           S +QN+ CPI NFYL     ++ Q A+   P N
Sbjct: 297 SSMQNVQCPIPNFYLMNNNVTQGQMAMQTQPQN 329

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/18 (83%), Positives = 15/18 (83%)

Query: 734 HLRPKPPKKPAHLSSLKI 751
           HLRPK PKKPA LSS KI
Sbjct: 643 HLRPKVPKKPAFLSSQKI 660

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  432 bits (1111), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/328 (62%), Positives = 252/328 (76%), Gaps = 10/328 (3%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP IP YP G  ++VG H A ILKYLTSGG+AQ+Y  +ISP D  T S+I CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K+ LN  R EVDAMKLL+N  HVVSYIDSNAAKS   NG+YEV LLME+C  G L+DF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RLQE E+LNIM+QV QG+AAMH L PPL+HRDIKIENVLIS  G +K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           VCG+IRPP + QE  +VQHD++KNTTAQYR+PEMIDL +  PI+ K  I  LG +     
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             L +YT  F +  E AIL+ RY+Y AYP YSD LKN++R++L+  P +RPNICQ+LEE+
Sbjct: 239 --LCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEV 296

Query: 297 SKIQNIPCPIDNFYLERSRHQGAVSVMP 324
           S++Q IPCPI NFYLER+ H+   ++MP
Sbjct: 297 SRLQGIPCPIKNFYLERAIHRS--TLMP 322

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (76%)

Query: 637 SIEKRVLNLLKNAEDSPVKKTAAGYGKYTK 666
           SI+ R+ NL+ NA++ P+ K A+ YGKYTK
Sbjct: 587 SIQDRMKNLIDNADNIPINKIASDYGKYTK 616

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  431 bits (1109), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 254/569 (44%), Positives = 339/569 (59%), Gaps = 40/569 (7%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEI-SPKDEYTNSNIACLKRVI 59
           MNQ       PG ++ VGSH+ KI++YLTSGGFAQIYS E+ SP       ++ACLKRV 
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP--IQGSLACLKRVH 58

Query: 60  VPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLD 119
           VP+K  LN LR EVDAMK+LK +RHVVSYIDS+AAKS   +G+YEV+LLMEYC RG L+D
Sbjct: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118

Query: 120 FMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           FMN++L+ RL E EVL IM+ V QGI AMH L+PPLIHRDIKIENVLISGDG FKVCDFG
Sbjct: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178

Query: 180 SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQI 239
           SV G+IRPP+N  E  YVQHD++KNTTAQYR+PEMIDL +  P++ K           ++
Sbjct: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238

Query: 240 MLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKI 299
                 F +  E AIL  ++Q+P+YP Y+DRLKN++ V+LS HPV+RPNICQ+LEE+S+I
Sbjct: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298

Query: 300 QNIPCPIDNFYLERSRHQGAVSVMPVNFSRAN------TTQFTDQSAKETTAIRVGKEIS 353
           Q +PCP+ NFYLER +H GA +  PV+ S +       T QF+  +   T       ++S
Sbjct: 299 QGVPCPLPNFYLERMKH-GACT--PVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMS 355

Query: 354 PLKPQLSPIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIA-------KPLYNSLE 406
           PL   + PI S+   V +M  TTPN  +     P   I  N   +         L + + 
Sbjct: 356 PLPHGIQPITSNM--VYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMH 413

Query: 407 DGNNGLENHYLSSSVPAISYLANQHANDNI---RNTTKLNIPAQNSTGSKNKTYVDSETQ 463
                LEN +  S V        + +++ I   RN  +  +     T +K  TYVDSETQ
Sbjct: 414 FNRPQLENSHTFSGV------GPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQ 467

Query: 464 TLE---------EPSLQHTRILPHISTDRTDNTGNSIVSRLGVQLRNVITNDSSASSSID 514
           T +          P       L         +TGNS++ RL  +     T+D   S+ + 
Sbjct: 468 TGDIITSNKSGSRPFAMSLSPLSSPELFSEQSTGNSLLGRLSRKTIRSPTSD-KGSNPLK 526

Query: 515 TVQETGNSIKSAIESLKNSVSGMANNVKA 543
           +    G+ + S + S   ++S  A + K+
Sbjct: 527 SKSSVGDDLASLLSSPSRNLSFPAQSSKS 555

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  428 bits (1101), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 235/501 (46%), Positives = 311/501 (62%), Gaps = 38/501 (7%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MN P IP Y PG V+ VG+H AKILKY+ SGGFAQ+YS E+ P D  T +N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P K+GLN LR EV+AMKLLK ++HVV YIDS+AA+S   NG+YEVFLLME+C  G L+DF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL+E E+LNIM+QV QGIAAMH L PPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G IRPPRNPQE  +VQHD++KNTTAQYRSPEMIDL +   I+ K      W + + + 
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKS---DIWALGIFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  + AIL+ RYQ+ A+PIYSDRLKN++  +LS  P++RPNICQ+LEE+S
Sbjct: 238 KLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVS 297

Query: 298 KIQNIPCPIDNFYLERSRHQ--GAVSVMPVNFSRANTTQFTDQSAKETTAIRVGKEISPL 355
           ++Q +  P+ NFYL R+      + S +    S  NT  F    A          +++PL
Sbjct: 298 RMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPA----------QVAPL 347

Query: 356 KPQLS------PIKSSYGPVLVMTKTT----------PNSFNSHHTPPPIGIVSNKTIAK 399
            P  S      P+  +  P+ +M KT           P + N    P  +G      +A 
Sbjct: 348 TPAQSLGANGMPVGVTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQ---VAG 404

Query: 400 PLYNSLEDGNNGLENHYLSSSVPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVD 459
           P+    +D ++G+   +  +S       +     D    T+ +N     +   +   YVD
Sbjct: 405 PVPMGSQDMSSGILPPFNRASTLPTDGFSTGPGKDGGVITSAVNT-GPETIKDRPFNYVD 463

Query: 460 SETQTLEEPSLQHTRILPHIS 480
           SETQT +  S+  ++   H S
Sbjct: 464 SETQTSDAGSITTSKPYLHPS 484

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 60/142 (42%), Gaps = 19/142 (13%)

Query: 635 KASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILS 694
           K SI+K+V +LLK AEDSP  K+       T     +  T   +    +N + +T   + 
Sbjct: 579 KESIQKKVQSLLKAAEDSPKNKS-------TSEIVNIRTTTSSFS---ENGLRKTTSNVE 628

Query: 695 ARGSSGHPVVVPALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPPKKPAHLSSLKINKK 754
              S+   +  P+ +N                      +HLRPK P KPA LS     +K
Sbjct: 629 NGKSTTRSIKTPSSVN------GKSESKSKPPPPPPKPEHLRPKKPPKPAFLSG---KRK 679

Query: 755 HSTTVLNTPADLLSDTAVDELE 776
               +LN   D + D+ VD +E
Sbjct: 680 EPEVLLNEVKDAVMDSNVDTIE 701

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  418 bits (1074), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 248/324 (76%), Gaps = 6/324 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP +     G  + VG+H  KILKYLTSGGFAQIY+VEI     +  SN+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN+LR EVDAMKLL NN+HVVSYIDS+A +S   +G+YEVFLLMEYCE G L+DF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L+IM+Q  QGIA MH L+PPL+HRDIKIENVL+S  G++KVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G+IRPPRN QEL YVQHD+MKNTTAQYR PEM+DL +G PI+ K      W + + + 
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKA---DIWALGVFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E AIL+ R+Q+P++P YSDRLKN+++ +L  HP  RPN+CQ+LEE+S
Sbjct: 238 KLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVS 297

Query: 298 KIQNIPCPIDNFYLERSRHQGAVS 321
           ++QN+PCPI NFYL R+  +  +S
Sbjct: 298 RMQNVPCPIRNFYLLRAMEKVKLS 321

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 75/154 (48%), Gaps = 16/154 (10%)

Query: 635 KASIEKRVLNLLKNAEDSPVKKTAAGYGKYTKRPKMVSPTNPHYHLVRQNSVSQTPLILS 694
           + SI+ RV +LL N   + VKK+A GYGKYT     +S T  +   V  +S    P++  
Sbjct: 550 RKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTDE---LSSTGTNIPKVTPDS----PVLAD 602

Query: 695 ARGSSGHPVV-VPALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPPKKPAHLSSLKINK 753
               +  P + +P+  N+ + +G                  LR    KK + LS+L++  
Sbjct: 603 LIDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPK------KLRSN--KKISTLSALRLEP 654

Query: 754 KHSTTVLNTPADLLSDTAVDELEKSFKQRYPSTV 787
           K +  + +   D+L    VD+LE+ FK+R+PS V
Sbjct: 655 KQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  414 bits (1064), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 245/312 (78%), Gaps = 6/312 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YS  ISP D +++SNIACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAM+LL+NNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L IM+QV QG+AAMH L PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCG+IRPPRNPQEL YVQ D+ KNTTAQYRSPEM+D+ +G PI+ K      W + + + 
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKS---DIWALGIFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E AIL+G +++P YP YS++L++++R +L  +P +RPN+ QLL+ IS
Sbjct: 238 KLCYYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRIS 297

Query: 298 KIQNIPCPIDNF 309
            +QN+PCPI + 
Sbjct: 298 IMQNVPCPISDI 309

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  411 bits (1057), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 244/312 (78%), Gaps = 6/312 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YS  I+P D ++NS++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAM+LLKNNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L IM+QV QG+AAMH L PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCGIIRPPRN QEL YVQ D++KNTTAQYRSPEMID  +G PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKS---DIWALGIFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  ++AIL+G++++P YP YS++LK ++R +L   P  RPN+ QLL+ IS
Sbjct: 238 KLCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRIS 297

Query: 298 KIQNIPCPIDNF 309
            +QN+PCPI++ 
Sbjct: 298 IMQNVPCPINDI 309

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  413 bits (1061), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 200/327 (61%), Positives = 242/327 (74%), Gaps = 11/327 (3%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I NY PG  + VG HQ  I+KYLTSGGFAQIY V+++P +     N+ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P KSGLN LR EV+AM+LLK   HVV YIDSNAA+S   +G+YEV  LME+C  G L+DF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL+E EVLNIMNQV QGI AMH L PPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           V GIIRPP+N +E  +VQ D+MKNTTAQYR PEM+DL +G PI  K  I  LG +     
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             + +YT  F    E AIL+ RYQYP YP+YS RLKN++R++L   P +RPN+CQ+LEE+
Sbjct: 239 --ICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296

Query: 297 SKIQNIPCPIDNFYLERSRHQGAVSVM 323
           S +Q IPCP+ NFYL+R   Q A  +M
Sbjct: 297 SSMQGIPCPLPNFYLQR---QQATQLM 320

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%)

Query: 733 DHLRPKPPKKPAHLSSLKINKKHSTTVLNTPADLLSDTAVDELEKSFKQRYPS 785
           D+LRPK P KPA+L  +K  K  +           S   + ++E  F QRYPS
Sbjct: 664 DYLRPKKPPKPANLQGMKFMKSENVEQEIKERKENSKKQLQKMEVDFSQRYPS 716

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  410 bits (1054), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 246/312 (78%), Gaps = 6/312 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YSV ISP D +TN+N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAM+LLKNNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L I++QV QG+AAMH L PPLIHRDIKIENVLIS +  +K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCGIIR PRN QEL YVQ D++KNTTAQYRSPEMID+ +G PI+ K      W + + + 
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKS---DIWALGIFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E AIL+G++++P YP YS++LK+++R +L  +P  RP++ QLL+ IS
Sbjct: 238 KLCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRIS 297

Query: 298 KIQNIPCPIDNF 309
            +QN+PCPI++ 
Sbjct: 298 IMQNVPCPINDI 309

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  409 bits (1050), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/309 (62%), Positives = 242/309 (78%), Gaps = 6/309 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  Y  G  + VGSHQ +I+KYLTSGGFAQ+YS  ISP D +TNSN+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K+ LN LR EVDAMKLL+NNR+VVSYIDS+AAK+   NGSYEVF+LMEYCERG L+DF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L IM QV QG+AAMH L PPLIHRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           VCG+IRPPRNPQEL YV+ DV+KNTTAQYRSPEM+D+ +G PI+ K      W + + + 
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKS---DIWALGIFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E AILNG++++  YP YS++L+N++  LL  +P +RPN+ QLL++I+
Sbjct: 238 KLCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQIT 297

Query: 298 KIQNIPCPI 306
            +QN P PI
Sbjct: 298 NMQNAPYPI 306

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  406 bits (1043), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 194/316 (61%), Positives = 243/316 (76%), Gaps = 8/316 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQP I  YP G  + VGSHQ +I+KYLT+GGFAQIY   ISP D ++ +NIACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LNVLR EVDAMKLL+NNR VVSYIDS+AAKS F NG+YEVFLLMEYCE G L++F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           +N++L+ RL+E EV+NIM  V QG+AAMH L PPL+HRDIKIENVL+S +  FK+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           V G IRPP NPQEL  VQ+D+M+NTTAQYRSPEMID+ +GFPI+ K  I  LG +     
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYK-- 238

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             + +YT  F +  E  IL  RY++PA+P YSDRL++++  LL+  P  RPNI  +++E+
Sbjct: 239 --ICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296

Query: 297 SKIQNIPCPIDNFYLE 312
           S ++NI CPI NFYL+
Sbjct: 297 SDMKNISCPIINFYLK 312

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  409 bits (1050), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 243/321 (75%), Gaps = 9/321 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MNQ    ++ PG V+ VGSH+ K++KYLTSGGFAQIY  E+   D     ++ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHV 59

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+K  LN LR EVDAMKLL+ N+H+VSYIDS+A+KS   NGSYEV LLMEYC RG L+ F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L++RL+E EVL IMNQV QGI AMH L PPLIHRDIKIENVLI+ +G  KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238
           VCG+IRPP+N  EL YVQHD++KNTTAQYR+PEMIDL +GF ++ K  I  LG +     
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYK-- 237

Query: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
             L +YT  F +  EVAIL   +Q+P+YP YS+RLKN++ V+L+ +P+ RPN CQ+LEE+
Sbjct: 238 --LCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEV 295

Query: 297 SKIQNIPCPIDNFYLERSRHQ 317
            +IQ  PCP+ NFYLERS  Q
Sbjct: 296 CRIQGQPCPVKNFYLERSLKQ 316

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 16/21 (76%)

Query: 734 HLRPKPPKKPAHLSSLKINKK 754
           HLRP PP KPAHL S  +NKK
Sbjct: 716 HLRPTPPPKPAHLKSPPVNKK 736

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  413 bits (1061), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 242/324 (74%), Gaps = 8/324 (2%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN--SNIACLKRV 58
           MNQP IP Y  G V+ +G+HQ  I KYL  GGFAQ+YSV +       N    +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLL 118
           IVP+KSGLN LR EVDAMKLLK N+++VSYIDS+A +SE   G YEVFLLMEYC RG ++
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDF 178
           DF+NT+L  RLQE E+L IM+ VCQG+AAMH L PPLIHRDIKIENVLIS +G +K+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQ 238
           GS C ++RPP+ PQE  ++ HD+M NTTAQYRSPEMID   G+PI+ K      W + + 
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKS---DIWALGVF 237

Query: 239 IM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295
           +  L +YT  F ++ E AILN ++Q+P+YP YSD ++N++ ++L+  P+KRPNICQ+LE+
Sbjct: 238 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297

Query: 296 ISKIQNIPCPIDNFYLERSRHQGA 319
           +SK+Q +PCPI+NF L R + Q +
Sbjct: 298 VSKLQGVPCPIENFMLTRIKLQNS 321

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 624  SPLKYAVDRKMKASIEKRVLNLLKNAE-DSPVKKTAAGYGKYTKRP 668
            S L+   +   K  I+KRV+ LLKN+E D+ V +TA GYGKYT +P
Sbjct: 1196 SSLRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKP 1241

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  382 bits (980), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 177/314 (56%), Positives = 234/314 (74%), Gaps = 6/314 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           MN P IP Y PG  + VGSH   ILKYLTSGG+AQIYS +I P D++  +N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           P+KS LN LR EVDAMK LK+++++VSYIDS+AAKS++ +G+YEVFL+MEYC RG L+DF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MNT+L+ RL E E+L I   + QG+AAMH L PPLIHRDIKIENVLIS D  +K+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G IRPP+ P+EL YV+HD+M +TTAQYR+PEM+DL KGF +  K      W + + + 
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKS---DIWALGVFLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F +  E  ILNG  ++P YP YSD +K ++  +L+ +P+ RPNI Q+++ +S
Sbjct: 238 KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVS 297

Query: 298 KIQNIPCPIDNFYL 311
           K+ N+ CPI N ++
Sbjct: 298 KLLNVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  368 bits (944), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 230/317 (72%), Gaps = 6/317 (1%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60
           M+Q     Y  G  ++V SH+  I  YLTSGGFAQ+Y+  I+ + +     + CLKRVIV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
           PNK  LN+LR EVDAMK+LKNN+++VSYIDS+A + +    SY V LLMEYC    LLDF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MN +L+ERL+E+E+L IM  V QG+  MH+L PPL+HRDIKIENVL+SGDG FK+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
           V G++R P + +E  Y+Q+D++KNTTAQYRSPEM++L  GFPI  K      W + + + 
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKS---DIWALGILLY 237

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            L +YT  F E    AI+ G++ YPAYP Y+D LKN++RVLLS +P++RPNICQLLEE+ 
Sbjct: 238 KLCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELF 297

Query: 298 KIQNIPCPIDNFYLERS 314
           +IQ+   P+ NFY++R+
Sbjct: 298 RIQHKSSPLPNFYVQRA 314

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  256 bits (654), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 198/329 (60%), Gaps = 32/329 (9%)

Query: 5   VIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN--------------- 49
            I  +  G  + VGSH  +I+KYLT GGFAQIY V+++   EY N               
Sbjct: 25  AIEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLT---EYLNEFDAIDIQNQRQQQE 81

Query: 50  ---SNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVF 106
               ++ CLKRV+V +++GL+ ++ EV+ MK L+   +VV Y DSNA ++   NG +EVF
Sbjct: 82  LKIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVF 141

Query: 107 LLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVL 166
           LLMEYC   SLLD+MN +L  +L E E+LNIM  +  G++ +H L  PLIHRDIKIENVL
Sbjct: 142 LLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVL 201

Query: 167 ISGDGLFKVCDFGSVCGIIRPP--RNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIE 224
           +  +  FK+CDFGS    I PP     Q++  + HD+  +TT QYRSPEMIDL +  P+ 
Sbjct: 202 VDHNNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVN 259

Query: 225 RKIRHLGSWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSP 281
            K      W + + +  LL YT  F    + AIL+ +Y+ P    YS+RL N++ V+L+ 
Sbjct: 260 EKA---DIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAE 315

Query: 282 HPVKRPNICQLLEEISKIQNIPCPIDNFY 310
           +P  RPNI Q+L EI  I N+  PI + Y
Sbjct: 316 NPNLRPNIYQVLSEICSILNVEVPIPDIY 344

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  250 bits (638), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 193/318 (60%), Gaps = 15/318 (4%)

Query: 4   PVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEI--------SPKDEYTNSNIACL 55
           P +    PG +I VGSH+ +I+KYL  GGFA IY V+         +P       ++ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERG 115
           KRV+V +++GLN LR EV+ MK LKN+ ++V Y DSNA++   G+  YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 SLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKV 175
           SLLD+MN +L  +L E+EVL IM  V + +A MH L  PLIHRDIKIENVL+  +  FK+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCV 235
           CDFGS           Q++  + +++  +TT QYR+PEMIDL +  PI+ K      W +
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKS---DIWAL 263

Query: 236 ALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQL 292
            + +  LL YT  F    + AIL+ +Y  PA   YS +L N++ ++L+ +P  RPNI Q+
Sbjct: 264 GIFLYKLLFYTTPFELTGQFAILHSKYDIPANN-YSSKLINLIIIMLAENPNLRPNIYQV 322

Query: 293 LEEISKIQNIPCPIDNFY 310
           + ++  I  +  P ++ Y
Sbjct: 323 IYQVCAIMKVDVPFEDKY 340

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  251 bits (641), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 196/323 (60%), Gaps = 17/323 (5%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE----------ISPKDEYTNS 50
           +N P    YP G +I VG+H+ +I+ YL  GGFAQIY V+          +  K   T  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLME 110
           +IACLKRVIV ++ GLN +R EV+ MK LK++ ++V Y DSNA++   G   +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            C   SLLD+MN +L+ +L E E+L IM  V  GI+ MH L  PLIHRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
             FK+CD GS      P  + Q++  +  ++  +TT QYR+PEMIDL +  PI  K    
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKS--- 248

Query: 231 GSWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
             W + + +  LL YT  F    ++AIL+ +Y +P    YS ++ N++ ++L+ +P  RP
Sbjct: 249 DIWALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPNK-YSSKIINLIIIMLAENPNLRP 307

Query: 288 NICQLLEEISKIQNIPCPIDNFY 310
           NI Q++  I  I N+P PI++ Y
Sbjct: 308 NIFQVVYHICSIMNLPVPIEDRY 330

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  251 bits (641), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 141/321 (43%), Positives = 193/321 (60%), Gaps = 14/321 (4%)

Query: 2   NQP-VIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSV---EISPKDEYTNSNI----- 52
           N+P  +  +  G  + VG+ + +I+KYLT GGFAQIY V   E S + +  NSNI     
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 53  --ACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLME 110
             ACLKRV+V +++GLN +R EV+ MKLLK   ++V Y DSNA++ + G   +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 111 YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            C   SLLDFMN +L  +L E+E+L IM+ V   +A MH L PPLIHRDIKIENVL+   
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 171 GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
             FK+ DFGS           Q++  +  D+  +TT QYRSPEMIDL K  PI+ K   +
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEK-SDI 255

Query: 231 GSWCVALQIMLLHYT-FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNI 289
            +  + L  +L + T F    + AIL+ +Y +P    YS RL N++ ++LS +P  RPNI
Sbjct: 256 WALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQTN-YSSRLINLIIIMLSENPNLRPNI 314

Query: 290 CQLLEEISKIQNIPCPIDNFY 310
            Q+L EI  I      I + Y
Sbjct: 315 YQVLHEICSISGTRLEITDKY 335

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  248 bits (634), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 195/326 (59%), Gaps = 24/326 (7%)

Query: 6   IPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSV-----------EISP--KDEYTNSNI 52
           +  Y PG VI VGSH+ +IL+Y+  GGFAQIYSV           E SP  KD+    ++
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGS------YEVF 106
           ACLKRVIV +++GLN LR EV+ MK L    ++V Y DSNA++   G  S      +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 LLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVL 166
           LLME C   SLLD+MN +L  +L EQE+L +M  V   IA MH L  PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 ISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK 226
           +     FK+CDFGS           +++ Y+  ++  +TT QYRSPEMIDL +  PI+ K
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 --IRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPV 284
             I  LG +   L  +     F    + AIL+ ++++P    YS +L N++ V+LS +P 
Sbjct: 255 SDIWALGIFLYKL--LFFTTPFERTGQFAILHSKFEFPQNN-YSFKLINLIIVMLSENPN 311

Query: 285 KRPNICQLLEEISKIQNIPCPIDNFY 310
            RPNI Q+L +I +++ +P PI + Y
Sbjct: 312 LRPNIYQVLHQICQLKQVPIPIADKY 337

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  248 bits (634), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 192/327 (58%), Gaps = 30/327 (9%)

Query: 9   YPPGFVIKVGSHQAKILKYLTSGGFAQIYSV----------------EISPKDEYTN--- 49
           + PG V+ VG H+ +I+KYL  GGFAQIYSV                E S  DE+     
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 50  --SNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFL 107
              N+ACLKRV+VP+++GLN LR EV+ M+ LK   ++V Y DSNA++   GN  +EV L
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLI 167
           LME C   SLLD+MN +L  +L E+E+L IM  V  GI+ MH L  PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK- 226
                FK+CDFGS         + QE+  +  ++  +TT QYRSPEMIDL +  PI+ K 
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 227 -IRHLGSWCVALQIMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHP 283
            I  LG +       LL YT  F    + AIL+ +Y+ P    YS RL N++ ++L+ +P
Sbjct: 259 DIWALGVFLYK----LLFYTTPFEMTGQFAILHSKYEIPPNN-YSSRLINLIIIMLAENP 313

Query: 284 VKRPNICQLLEEISKIQNIPCPIDNFY 310
             RPNI Q++ ++     I  PI + Y
Sbjct: 314 NLRPNIYQVMHQVCITIGIEPPIKDKY 340

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  247 bits (631), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 188/319 (58%), Gaps = 10/319 (3%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNS--------N 51
           + +PV+  Y PG V+ VG+ Q +I+ ++  GGFAQIYSV+ I    E+ N         +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
           IACLKRV+VP+++GL+ +R EV+ MK L+  + ++ Y DSNA++   G   YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  RL E+E+L +M      I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
            FK+CDFGS           Q++  +  ++  NTT QYRSPEMIDL +  PI  K     
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 SWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQ 291
                 +++     F    + +IL+ +Y++PA   YS +L N++ ++L+ +P  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPANK-YSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 LLEEISKIQNIPCPIDNFY 310
           ++  I  +     PI++ Y
Sbjct: 313 VMHHICSVIGCEVPIEDKY 331

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  245 bits (625), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 203/350 (58%), Gaps = 28/350 (8%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNS--------N 51
           M  P +  Y PG ++ VG+H+ +I+ YL  GGFAQIY V+ +   +E+ N+        +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
           +ACLKRV+V +++GLN +R EV+ MK LK   +VV Y DSNA++   G   +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  +L E E++ IM  V   I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
            FK+ DFGS           Q++  +  ++  +TT QYRSPEMIDL +  PI  K     
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS---D 250

Query: 232 SWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
            W + + +  LL +T  F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPN
Sbjct: 251 IWALGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPN 309

Query: 289 ICQLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQ 338
           I Q+L  +  I N+  PI++ Y E           P NF+R   TQF ++
Sbjct: 310 IYQVLCHLCDILNVEVPIEDKYAE----------GPYNFARY--TQFQNK 347

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  242 bits (617), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 133/317 (41%), Positives = 188/317 (59%), Gaps = 14/317 (4%)

Query: 5   VIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIY---------SVEISPKDEYTNSNIACL 55
           V+ +Y PG ++ VG H+ +++KYL  GGFA+IY         +V+ + K+   N +  CL
Sbjct: 25  VLDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCL 84

Query: 56  KRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERG 115
           KRV+V + +GLN +R EV+ M+ LK    VV Y DSNA++   G   YEV LLME C   
Sbjct: 85  KRVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNN 144

Query: 116 SLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKV 175
           SLLD+MN +L  +L E E+L IM  V   +A MH L  PLIHRDIKIENVL+     FK+
Sbjct: 145 SLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKL 204

Query: 176 CDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSW 233
           CDFGS    +    + Q++  +  ++  +TT QYRSPEMIDL +  P+  K  I  LG +
Sbjct: 205 CDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVF 264

Query: 234 CVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLL 293
              L  M     F    + AIL+ +Y++P    YS +L N++ V+L+ +P  RPNI Q+L
Sbjct: 265 LYKL--MFYTTPFERTGQFAILHSKYEFPLNN-YSSKLINLIIVMLAENPNLRPNIYQVL 321

Query: 294 EEISKIQNIPCPIDNFY 310
            +I  I  I  P+D+ Y
Sbjct: 322 NQICYISGIKNPMDDAY 338

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  245 bits (625), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 140/350 (40%), Positives = 206/350 (58%), Gaps = 28/350 (8%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNS--------N 51
           M  P +  + PG ++ VG+H+ +++ YL  GGFAQIY V+ +   +E+ N+        +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
           +ACLKRV+V +++GLN +R EV+ MK LK   +VV Y DSNA++   G   +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  +L E E++ IM  V   I+ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
            FK+ DFGS           Q++  +  ++  +TT QYRSPEMIDL +  PI  K     
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS---D 250

Query: 232 SWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
            W + + +  LL +T  F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPN
Sbjct: 251 IWALGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPN 309

Query: 289 ICQLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQ 338
           I Q+L  + +I NI  PI++ Y E     GA      NFS+   TQF ++
Sbjct: 310 IYQVLYHLCEILNIEVPIEDKYTE-----GA-----YNFSKY--TQFQNK 347

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  244 bits (624), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/324 (41%), Positives = 194/324 (59%), Gaps = 16/324 (4%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNS--------N 51
           M  P +  Y PG ++ VG+H+ +I+ YL  GGFAQIY+V+ +   +E+ N+        +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
           +ACLKRV+V +++GLN +R EV+ MK LK   +VV Y DSNA++   G   +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  +L E E++ IM  V   I+ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
            FK+ DFGS           Q++  +  ++  +TT QYRSPEMIDL +  PI  K     
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKS---D 250

Query: 232 SWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
            W + + +  LL +T  F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPN
Sbjct: 251 IWALGIFLYKLLFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPN 309

Query: 289 ICQLLEEISKIQNIPCPIDNFYLE 312
           I Q+L  I  I N   PI++ Y E
Sbjct: 310 IYQVLYHICDILNAEVPIEDKYSE 333

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  242 bits (618), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 134/327 (40%), Positives = 197/327 (60%), Gaps = 20/327 (6%)

Query: 2   NQPVIPN---YPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNS------- 50
           N  V PN   Y PG  + VG+H+ +I+KY+  GGFAQIY+V+ I   +E+ N+       
Sbjct: 12  NTTVKPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQ 71

Query: 51  --NIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLL 108
             ++ACLKRV+V +++GLN +R EV+ MK L+   ++V Y DSNA++   G   +EV LL
Sbjct: 72  MGDVACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLL 131

Query: 109 MEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLIS 168
           ME C   SLLD+MN +L  +L E+E+L IM  V   ++ MH L  PL+HRDIKIENVL+ 
Sbjct: 132 MELCPNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVD 191

Query: 169 GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIR 228
               FK+CDFGS           Q++  +  ++  +TT QYRSPEMIDL +  PI+ K  
Sbjct: 192 AQNNFKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKS- 250

Query: 229 HLGSWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVK 285
               W + + +  LL +T  F    + AIL+ +Y++P    YS +L N++ ++L+ +P  
Sbjct: 251 --DIWALGIFLYKLLFFTTPFELTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPNL 307

Query: 286 RPNICQLLEEISKIQNIPCPIDNFYLE 312
           RPNI Q+L  I  I  +  PI++ Y E
Sbjct: 308 RPNIYQVLHNICSISGMKVPIEDQYAE 334

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  239 bits (611), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 191/322 (59%), Gaps = 22/322 (6%)

Query: 4   PVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN------------SN 51
           PV+     G  + VG+H+ +I+KYL  GGFA IY V+     EY N              
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFV---EYANELEQAPSITLKVGE 80

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
            ACLKRV+V +++GLN +R EV  MK L    ++V Y DS+A++S  G   +EV LLME 
Sbjct: 81  TACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMEL 140

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  +L EQE+L IM  V + +A MH L  PLIHRD+KIENVL+ GD 
Sbjct: 141 CPNNSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDN 200

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
            FK+CDFGS    +      QE+  + +++  +TT QYRSPEMIDL +  PI+ K     
Sbjct: 201 NFKLCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKS---D 257

Query: 232 SWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
            W + + +  LL YT  F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPN
Sbjct: 258 IWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPINN-YSSKLINLIIIMLAENPNLRPN 316

Query: 289 ICQLLEEISKIQNIPCPIDNFY 310
           I Q+++ +  I  +  PI++ Y
Sbjct: 317 IYQIMDNLCSIMKVENPIEDKY 338

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  242 bits (617), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 195/345 (56%), Gaps = 35/345 (10%)

Query: 9   YPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNSN---------------- 51
           +P G  + VGSH+ +I+KY+  GGFAQIY+V+ +   +E+ +SN                
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 52  -------IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYE 104
                  IACLKRV+V +++GLN +R EV+ MK LK   +VV Y DSNA++   G   +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           V LLME C   SLLD+MN +L  +L E E+L IM  +   ++ MH L  PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIE 224
           VL+     FK+CDFGS    +      Q++  +  ++  +TT QYRSPEMIDL +  PI+
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 RKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPV 284
            K           +++     F    + AIL+ +Y++P    YS +L N++ ++L+ +P 
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKNN-YSSKLINLIIIMLAENPN 322

Query: 285 KRPNICQLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSR 329
            RPNI Q+L+ I  + N+  PI++ Y      QG     P NF +
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY-----EQG-----PYNFEK 357

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  241 bits (614), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/349 (39%), Positives = 202/349 (57%), Gaps = 26/349 (7%)

Query: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTNS--------N 51
           M  P +  Y PG ++ VG+H+ +++ YL  GGFAQIY V+ +   +E+ N+        +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
           +ACLKRV+V +++GLN +R EV+ MK LK   ++V Y DSNA++   G   +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  +L E E++ IM  V   I+ MH L   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRH 229
            FK+ DFGS           Q++  +  ++  +TT QYRSPEMIDL +  PI  K  I  
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 230 LGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNI 289
           LG +   L  +     F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPNI
Sbjct: 254 LGVFLYKL--LFFTTPFEMTGQFAILHSKYEFPVNK-YSSKLINLIIIMLAENPNLRPNI 310

Query: 290 CQLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQ 338
            Q+L  + +I N+  PI++ Y E     GA      NFS+   TQF ++
Sbjct: 311 YQVLYHLCEILNVEVPIEDKYAE-----GA-----YNFSKY--TQFQNK 347

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  238 bits (608), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 136/313 (43%), Positives = 184/313 (58%), Gaps = 21/313 (6%)

Query: 12  GFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN-----------SNIACLKRVIV 60
           G ++ VG H+ +I++YL  GGFA IY V      EYTN            +IACLKRV V
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFI---EYTNELDRHHSVLQRGDIACLKRVQV 87

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120
            +++GLN LR EV+ MK LK   +VV Y DSNA++   G   +EV LLME C  GSLLD+
Sbjct: 88  NDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDY 147

Query: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
           MN +L  +L E+EVL IM  + +GI+ MH L  PLIHRDIKIENVL+     FK+CDFGS
Sbjct: 148 MNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGS 207

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
               +      QE+  + +++  +TT QYRSPEMIDL +   I  K      W + + + 
Sbjct: 208 TSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKS---DIWALGIFLY 264

Query: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297
            LL YT  F    + AIL+ +Y  P    +S +L N++ V+L+ +P  RPNI Q+L  I 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQNN-FSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 298 KIQNIPCPIDNFY 310
            I     PI++ Y
Sbjct: 324 SIMECDVPIEDHY 336

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  239 bits (611), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 194/336 (57%), Gaps = 26/336 (7%)

Query: 8   NYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTN-------------SNIA 53
           NYP G  + VGSH+ +++KY+  GGFAQIY+V+ I   +E+ +              +IA
Sbjct: 98  NYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIA 157

Query: 54  CLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCE 113
           CLKRV+V + +GLN +R EV+ M+ L+    VV Y DSNA+        YEV LLME+C 
Sbjct: 158 CLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCP 217

Query: 114 RGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLF 173
             SLLD+MN +L  RL E+E++ IM     GIA +H L  PLIHRDIKIENVL+  +  F
Sbjct: 218 NNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNF 277

Query: 174 KVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLG 231
           K+CDFGS         N +++     ++  NTT QYRSPEMIDL +  PI+ K  I  LG
Sbjct: 278 KLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALG 337

Query: 232 SWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQ 291
            +   L  +     F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPNI Q
Sbjct: 338 VFLYKL--LFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQ 394

Query: 292 LLEEISKIQNIPCPIDNFY-------LERSRHQGAV 320
           +L+ +  I     P+++ Y        E ++ QG V
Sbjct: 395 VLQYLCSINGWKVPLNDKYGLGPYNFTEYAKFQGNV 430

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  238 bits (606), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 188/318 (59%), Gaps = 14/318 (4%)

Query: 4   PVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTN--------SNIAC 54
           P +  + PG V+ VG+H+ +++ YL  GGFAQIY V+ +   +E+ N         ++AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCER 114
           LKRV+V +++GL+ +R EV+ MK L   +++V Y DSNA +   GN  +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFK 174
            SLLD+MN +L  +L E+E+L IM  V   ++ MH L  PLIHRDIKIENVL+     FK
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGS 232
           +CDFGS           QE+  +  ++  +TT QYR PEMIDL +  PI  K  I  LG 
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 233 WCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQL 292
           +   L   +    F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPNI Q+
Sbjct: 257 FLYKLLFFIT--PFEMTGQFAILHSKYEFPPNH-YSSQLINLIIIMLAENPFVRPNIYQV 313

Query: 293 LEEISKIQNIPCPIDNFY 310
           L  I  +  +  PI++ Y
Sbjct: 314 LNHICTMIGVEVPIEDKY 331

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  234 bits (596), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 135/325 (41%), Positives = 189/325 (58%), Gaps = 26/325 (8%)

Query: 5   VIPN---YPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNS----------- 50
           +IPN     P   + VG+H+ +IL++L  GGFA IY V+     E TN            
Sbjct: 22  MIPNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFL---ELTNEMDAGIDSKLLK 78

Query: 51  --NIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLL 108
             +IACLKRVIVP+++GLN LR EV+ MK L+ + ++V Y DSNA++   G+  +E+ LL
Sbjct: 79  AGDIACLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLL 138

Query: 109 MEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLIS 168
           ME C + SLLD+MN KL  +L E E+L IM  V   IA MH L  PLIHRDIKIENVL+ 
Sbjct: 139 MELCPKKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVD 198

Query: 169 GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIR 228
            D  FK+CDFGS           Q++  + +++  +TT QYRSPEMIDL +  PI  K  
Sbjct: 199 KDDNFKLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS- 257

Query: 229 HLGSWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVK 285
               W + + +  LL YT  F    + AIL+ +Y+ P    YS +L N++ ++L+ +P  
Sbjct: 258 --DIWALGIFLYKLLFYTTPFELTGQFAILHSKYEIPQNG-YSSKLINLIIIMLAENPSL 314

Query: 286 RPNICQLLEEISKIQNIPCPIDNFY 310
           RPNI Q++  +  I     P  + Y
Sbjct: 315 RPNIYQVMHHVCSILKCDVPFTDKY 339

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  233 bits (593), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/315 (40%), Positives = 185/315 (58%), Gaps = 12/315 (3%)

Query: 6   IPNYPPGFVIKVGSHQAKILKYLTSGGFAQIY---------SVEISPKDEYTNSNIACLK 56
           I  Y PG +++VG H+ +I+KYL  GGFA+IY          ++I+        ++ CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGS 116
           RV+V + +GLN +R EV  MK L    ++V   DSNA++   G   YEV LLME C   S
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVC 176
           LLD+MN +L  +L E E+L IM  V   +A MH L  PLIHRDIKIENVL+     FK+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVA 236
           DFGS    +      +++  +  ++  +TT QYRSPEMID+ +   I  K   + +  + 
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEK-SDIWALGIF 334

Query: 237 LQIMLLHYT-FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295
           L  +L + T F    + AIL+ +Y++P +  YS +L N++ ++L+ +P  RPNI Q+L  
Sbjct: 335 LYKLLFYITPFERTGQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAY 393

Query: 296 ISKIQNIPCPIDNFY 310
           I KI NI  PID+ Y
Sbjct: 394 ICKIINIKTPIDDIY 408

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  234 bits (597), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 149/406 (36%), Positives = 215/406 (52%), Gaps = 35/406 (8%)

Query: 2   NQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVE-ISPKDEYTN----------- 49
           N   I  +  G  + VG+H+ +I+ YLT GGFAQIY V+ I   +E+ N           
Sbjct: 24  NVGTIEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISN 83

Query: 50  -----SNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYE 104
                 ++ACLKRV+V ++ GLN +R EV+ MK L+   ++V Y DSNA +S  GN  YE
Sbjct: 84  YSLKLGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYE 143

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           V LLME C   SLL++MN +L  +L E+EVL IM  V  G+A MH L  PLIHRDIKIEN
Sbjct: 144 VLLLMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIEN 203

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIE 224
           VL+  +  FK+CDFGS           Q++  +  +V  +TT QYRSPEMIDL +  PI 
Sbjct: 204 VLVDSNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPIN 263

Query: 225 RKIRHLGSWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSP 281
            K      W + + +  LL YT  F    + A+L+ ++  PA   YS ++ N+V ++LS 
Sbjct: 264 EKS---DIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSE 319

Query: 282 HPVKRPNICQLLEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQFTDQSAK 341
           +   RPNI Q++  I ++  +  PI + Y      +G     P NFS+ +  Q   Q A 
Sbjct: 320 NLNLRPNIYQVMHYICQLIQVDTPILDIY-----GRG-----PYNFSKYSDYQKKAQ-AI 368

Query: 342 ETTAIRVGKEISPLKPQLSPIKSSYGPVLVMTKTTPNSFNSHHTPP 387
           +      G+  S +  Q   +        + T    +  +   +PP
Sbjct: 369 QNQLFASGQNNSNVMKQTDSVDDFLNDFFLATFEAASKLDIERSPP 414

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  233 bits (595), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 190/322 (59%), Gaps = 22/322 (6%)

Query: 4   PVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN------------SN 51
           PV+     G  + VG+H+ +I+KYL  GGFA IY V      EY N             +
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFI---EYANELEQVPTIKLEVGD 122

Query: 52  IACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEY 111
           +ACLKRV+V +++GLN +R EV  MK L    ++V Y DS+A+++  G+  +EV LLME 
Sbjct: 123 LACLKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMEL 182

Query: 112 CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
           C   SLLD+MN +L  +L EQE+L IM  V + +A MH L  PLIHRD+KIENVL+  + 
Sbjct: 183 CPNNSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANH 242

Query: 172 LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
            FK+CDFGS           QE+  + +++  +TT QYRSPEMIDL +  PI  K     
Sbjct: 243 NFKLCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKS---D 299

Query: 232 SWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
            W + + +  LL YT  F    + AIL+ +Y++P    YS +L N++ ++L+ +P  RPN
Sbjct: 300 IWALGIFLYKLLFYTTPFELTGQFAILHSKYEFPVNN-YSSKLINLIIIMLAENPNLRPN 358

Query: 289 ICQLLEEISKIQNIPCPIDNFY 310
           I Q+++ +  I  +  P+++ Y
Sbjct: 359 IYQVMDNLCSILKVKNPLEDKY 380

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  235 bits (600), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 192/342 (56%), Gaps = 24/342 (7%)

Query: 5   VIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSV-------EISPKDEYTNS----NIA 53
            I  Y PG +I VG+HQ KI  YL  GGFAQIY V       E   K +  NS    +IA
Sbjct: 31  FIEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIA 90

Query: 54  CLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCE 113
           CLKRV+V +++GLN +R EV+ MKLL+   ++V Y DSNA +   G   YE+ LLME C 
Sbjct: 91  CLKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCP 150

Query: 114 RGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLF 173
             SLLD+MN +L+ +L E E++ IM      ++ MH L  PLIH+DIK+EN+L+  +  F
Sbjct: 151 NNSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNF 210

Query: 174 KVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSW 233
           K+CDFGS         +  ++  +  ++  +TT QYRSPEMIDL +  PI  +   + + 
Sbjct: 211 KLCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPI-NETSDIWAL 269

Query: 234 CVALQIMLLHYT-FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQL 292
            V L  +L   T F    + +IL+ ++  P    Y  +L N++ ++LS +   RPNI Q+
Sbjct: 270 GVFLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQV 328

Query: 293 LEEISKIQNIPCPIDNFYLERSRHQGAVSVMPVNFSRANTTQ 334
           + EI  I N P PI++ Y           + P NF +  T Q
Sbjct: 329 MYEICSITNTPLPIEDKY----------GMGPYNFDKYATFQ 360

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  233 bits (595), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 135/332 (40%), Positives = 185/332 (55%), Gaps = 43/332 (12%)

Query: 6   IPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN---------------- 49
           I  Y  G ++ VG  + +ILKYLT GGFAQIY+V      EY N                
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFI---EYLNEFDNDDAENDNNSRNL 93

Query: 50  --SNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNG------ 101
              ++ACLKRV+VP+++GL+ +R EVD MK L N  ++V Y DSNA+K +  +       
Sbjct: 94  KIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNN 153

Query: 102 ---------SYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLL 152
                     +E+ LLMEYC   SLLDFMN +L  +L E E+L  M  +   +  MH L 
Sbjct: 154 NDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLA 213

Query: 153 PPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSP 212
            PLIHRDIKIENVL+  +  FK+ DFGS   I  P    Q++  +  D+  NTT QYRSP
Sbjct: 214 QPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSP 273

Query: 213 EMIDLVKGFPIERKIRHLGSWCVALQIM-LLHYT--FREDREVAILNGRYQYPAYPIYSD 269
           EMIDL K  PI+ K      W + + +  LL YT  F    + AIL+ +Y++PA   YS 
Sbjct: 274 EMIDLYKCLPIDEKS---DIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPANN-YSS 329

Query: 270 RLKNVVRVLLSPHPVKRPNICQLLEEISKIQN 301
           +  N++ ++L+ +P  RPNI Q+L  +  I N
Sbjct: 330 KFINLIIIMLAENPNLRPNIFQVLYYLKSISN 361

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  232 bits (591), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 129/310 (41%), Positives = 182/310 (58%), Gaps = 15/310 (4%)

Query: 12  GFVIKVGSHQAKILKYLTSGGFAQIYSV-------EISPKDEYTN-SNIACLKRVIVPNK 63
           G  + VG HQ ++++YL  GGFA IY V       E+  +D      +  CLKRV V ++
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  SGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNT 123
           +GLN LR EV+ MK L+N  ++V Y DSNA++   G   YEV LLME C  GSLLD+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 KLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCG 183
           +L  +L E EVL IM  +  G++ MH    PLIHRDIKIENVL+  D  FK+CDFGS   
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 IIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM-LL 242
            +    + QE+  + +++  +TT QYRSPEMIDL +  PI  K      W + + +  LL
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKS---DIWALGIFLYKLL 268

Query: 243 HYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQ 300
            YT  F    + AIL+ +Y+ P    +S +L N+V ++L+ +P  RPN+ Q++  I  + 
Sbjct: 269 FYTTPFELTGQFAILHSKYEIPRNS-FSSKLINLVIIMLAENPYLRPNVYQVMYHICSMM 327

Query: 301 NIPCPIDNFY 310
                ID+ Y
Sbjct: 328 ECEVKIDDLY 337

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  230 bits (587), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 133/326 (40%), Positives = 189/326 (57%), Gaps = 29/326 (8%)

Query: 3   QPVIPN-YPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN------------ 49
           QP I   +P G V+ VGSH+ +++ YL  GGFAQIY V+     EYTN            
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFV---EYTNEFERKNDESMNQ 145

Query: 50  ----SNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGS--- 102
                + ACLKRV+V ++ GLN +R+EV+ MK L+   ++V Y DSNA++    +G+   
Sbjct: 146 PLKPGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQ 205

Query: 103 -YEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIK 161
            +EV LLME C   SLLD+MN +L  +L EQE+  IM  +   +A MH L  PLIHRDIK
Sbjct: 206 GFEVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIK 265

Query: 162 IENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGF 221
           IENVL+  +  FK+CDFGS         + Q++  +  D+  +TT QYRSPEMIDL K  
Sbjct: 266 IENVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYI 325

Query: 222 PIERK--IRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLL 279
           PI  K  I  LG +   L  +     F    + A+L+ ++++P    YS +L N++ V+L
Sbjct: 326 PINEKSDIWALGVFLYKL--LFFTTPFERTGQFAMLHSKFEFPPNS-YSSKLINLIIVML 382

Query: 280 SPHPVKRPNICQLLEEISKIQNIPCP 305
           + +P  RPNI Q+L  +S++ N   P
Sbjct: 383 AENPSLRPNIYQVLYYLSEVTNREVP 408

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 87/322 (27%), Positives = 144/322 (44%), Gaps = 59/322 (18%)

Query: 486 NTGNSIVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMANNVKALS 545
           +TG S     G +L+ V T +  + S I + Q TG S+KSA  +L+   S  ++  + LS
Sbjct: 509 STGGSFSRTFGRRLKKVFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLS 568

Query: 546 VENA----RNHLERLXXXXXXXXXXXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSEL 601
            +N      N                  + NS       + +H+  +  T++       +
Sbjct: 569 KKNTVDVTTNGSSSNGYKFRVTSSDSIEEENSG-----FIYSHSRKASSTSI-------V 616

Query: 602 SDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAEDSPVKKTAAGY 661
           SD + L D     + K  ++S SP+K +     ++SI+KRV NLLK+++DSPVKK+A GY
Sbjct: 617 SDLDSLQDDSGT-NAKKYYRSHSPVKLSGSSDARSSIQKRVQNLLKSSQDSPVKKSAHGY 675

Query: 662 GKYTKRPKMVSP-----------TNPHYHLV-----RQNSVSQTPLILSARGSSGHPVVV 705
           G+ +++    SP             P    V     R +SV  + ++ +A+ ++   +  
Sbjct: 676 GEVSEKEDKESPEQFTGKPAVAEARPIKRTVVPPPKRYSSVEFSSIVPTAKNTTAKDIEQ 735

Query: 706 PALINRDNDNGXXXXXXXXXXXXXXXXDHLRPKPPKKPAHLSSLKINKKHSTTVLNTPAD 765
           P  +                        H +PK P KP HL + +I K  S+T  N    
Sbjct: 736 PIRV------------------------HHKPKRPTKPPHLKADRIIKHGSSTTENPRHS 771

Query: 766 LLSDTAVDELEKSFKQRYPSTV 787
             SD  ++ELEK F++R+PS V
Sbjct: 772 --SDLEIEELEKDFQRRFPSAV 791

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 146/345 (42%), Gaps = 61/345 (17%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIAC-----LKRVIVPNKSGLNVL 69
           I+V   + KI + L  GG + +Y V++        + +A      LK++I PN   ++  
Sbjct: 23  IRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESISNG 82

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER- 128
             E++  K  ++  +V+  IDS   + +  +GS  +++++ +   GSL D +N +L E  
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVMQEK--DGSKSIYIILPFYTLGSLQDSINRRLLEGT 139

Query: 129 -LQEQEVLNIMNQVCQGIAAMHK---------------------------LLP--PL--- 155
            + E E + IM  V +G+  +H                            LL   PL   
Sbjct: 140 FISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEMD 199

Query: 156 ------------IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMK 203
                        HRDI   N+L S DGL  + D GS         N  +L+ +Q  V  
Sbjct: 200 MLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVND 259

Query: 204 NTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AILN 256
           N T  Y +PE++ L     ++ K+      C    +M     F  + ++       AI  
Sbjct: 260 NCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAINT 319

Query: 257 GRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQN 301
           G+Y +P    +S+ L +V++  +   PV+RP   QLL  +  +++
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLES 364

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 141/332 (42%), Gaps = 61/332 (18%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEI-----SPKDEYTNSNIACLKRVIVPNKSGLNVL 69
           I+V   + KI + L  GG + +Y V++     S ++    + +  LK++I P+   ++  
Sbjct: 23  IRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNG 82

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER- 128
             E++  K  ++  +V+  IDS   + +  +GS  +++++ Y   GSL D +N +L E  
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVMQEK--DGSKTIYIILPYYSLGSLQDSINRRLLEGT 139

Query: 129 -LQEQEVLNIMNQVCQGIAAMHK---------------------------LLP--PL--- 155
            + E E + IM  V +G+  +H                            LL   PL   
Sbjct: 140 FISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEMD 199

Query: 156 ------------IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMK 203
                        HRDI   N+L S DGL  + D GS         N  +L  +Q  V  
Sbjct: 200 MLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVND 259

Query: 204 NTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AILN 256
           N T  Y +PE+++L     +  K+      C    +M     F  + ++       AI  
Sbjct: 260 NCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 GRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
           G+Y +P    +S+RL +V++  +   P++RP 
Sbjct: 320 GKYSFPRNSRFSERLLDVIKRCIQVDPIQRPT 351

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 136/292 (46%), Gaps = 44/292 (15%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK  Y++ N A L        S +  LR
Sbjct: 1184 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PK--YSSQNEAIL--------STVEALR 1232

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+       E  N  Y +FL  EY   GS+   +  ++  R  
Sbjct: 1233 SEVSTLKDL-DHLNIVQYLGF-----ENKNSIYSLFL--EYVAGGSVGSLI--RMYGRFD 1282

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  + ++  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1283 ESLIKHLTTQVLRGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1336

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  C+ L++      +    
Sbjct: 1337 ----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMFAGKRPWSNLE 1390

Query: 251  EVAILN--GRYQYPAYPIYSDRLKNVVRV-------LLSPHPVKRPNICQLL 293
             VA +   G+ +  A PI  D L  + RV            P KRP   +LL
Sbjct: 1391 VVAAMFKIGKSK-SAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 137/292 (46%), Gaps = 44/292 (15%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK  Y++ N A L        S +  LR
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PK--YSSQNEAIL--------STVEALR 1226

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+       E  N  Y +FL  EY   GS+   +  ++  R  
Sbjct: 1227 SEVSTLKDL-DHLNIVQYLGF-----ENKNNIYSLFL--EYVAGGSVGSLI--RMYGRFD 1276

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  + ++  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1277 EPLIKHLTTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1330

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  C+ L++      +    
Sbjct: 1331 ----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMFAGKRPWSNLE 1384

Query: 251  EVAILN--GRYQYPAYPIYSDRL-------KNVVRVLLSPHPVKRPNICQLL 293
             VA +   G+ +  A PI  D L       +N +      +P KRP   +LL
Sbjct: 1385 VVAAMFKIGKSK-SAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 103/218 (47%), Gaps = 35/218 (16%)

Query: 31   GGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSG--------LNVLRTEVDAMKLLKNN 82
            G F  +Y          T   +  +K+V VP  S         +  L++EV  +K L N+
Sbjct: 1047 GSFGAVYLAL-----NVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVC 142
             ++V Y+       E  NG Y +FL  EY   GS+   +  ++  R  +Q + ++  QV 
Sbjct: 1101 VNIVQYLGF-----EEKNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVL 1151

Query: 143  QGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVM 202
            +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R   N     Y   D+ 
Sbjct: 1152 EGLAYLHS--KGILHRDMKADNLLLDNDGVCKISDF----GISRKSNN----IYSNSDMT 1201

Query: 203  KNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
               T  + +PEM+D   G+  +  I  LG  CV L++ 
Sbjct: 1202 MRGTVFWMAPEMVDTAHGYSAKVDIWSLG--CVVLEMF 1237

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 138/304 (45%), Gaps = 44/304 (14%)

Query: 9    YPPGFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN 67
            +  G +I  GS  A  L   +T+G    +  VE+ PK  Y++ N A L        S + 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PK--YSSQNEAIL--------STVE 1223

Query: 68   VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE 127
             LR+EV  +K L ++ ++V Y+        F N      L +EY   GS+   +  ++  
Sbjct: 1224 ALRSEVSTLKDL-DHLNIVQYLG-------FENKDNIYSLFLEYVAGGSVGSLI--RMYG 1273

Query: 128  RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRP 187
            R  E  + ++  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R 
Sbjct: 1274 RFDEPLIKHLTTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRK 1327

Query: 188  PRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFR 247
             ++     Y   D+    T  + +PEM+D  +G+  +  I  LG  C+ L++      + 
Sbjct: 1328 SKD----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMFAGKRPWS 1381

Query: 248  EDREVAILN--GRYQYPAYPIYSDRL-------KNVVRVLLSPHPVKRPNICQLLEEISK 298
                VA +   G+ +  A PI  D L       +  +      +P KRP   +LL     
Sbjct: 1382 NLEVVAAMFKIGKSK-SAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELLSHRFS 1440

Query: 299  IQNI 302
            + N+
Sbjct: 1441 VVNV 1444

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 80/331 (24%), Positives = 139/331 (41%), Gaps = 61/331 (18%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIA-----CLKRVIVPNKSGLNVL 69
           I+V   + +I + L  GG + +Y V++S      ++ IA      LK++I P+   ++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER- 128
             E++  K  ++  +V+  IDS   + +  +GS  +++++ Y   GSL D +N +L E  
Sbjct: 83  MREIENYKRFQSP-YVIKSIDSQVMQEK--DGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 129 -LQEQEVLNIMNQVCQGIAAMHK---------------------------LLP--PL--- 155
            + E E + IM  V +G+  +H                            LL   PL   
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 156 ------------IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMK 203
                        HRDI   N+L S DGL  + D GS         N  +L  +Q  V  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 204 NTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AILN 256
           N T  Y  PE+++L     +  K+      C    +M     F  + ++       AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 257 GRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
           G+Y +P    +S+ L +V++  +   P++RP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 135/292 (46%), Gaps = 40/292 (13%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      +    +A   ++ + ++   N L +E+   ++ KN RH  
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEI---QIHKNMRHQN 156

Query: 85  VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQG 144
           +V +ID              V++L+E C  GSL+D +  K R+ L E EV     Q+C  
Sbjct: 157 IVHFIDC-------FEDDINVYILLEICPNGSLMDLL--KRRKILTEPEVRFFTTQICGA 207

Query: 145 IAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKN 204
           +  MH     +IHRD+K+ N+    D   K+ DFG +  II    N  E +Y        
Sbjct: 208 LDHMHS--RNIIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYTIC----- 256

Query: 205 TTAQYRSPEMIDLVK--GFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR---- 258
            T  Y +PE+I   K  G   E  I  LG   V +  M+      + +EV+ +  R    
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFEVDIWSLG---VMIFAMITGKPPFQAKEVSTIYDRIKHC 313

Query: 259 -YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNI-PC-PID 307
            Y +P     S  +K +++ +LS +P++RP I ++L       N  PC PID
Sbjct: 314 NYSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPID 365

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 136/292 (46%), Gaps = 44/292 (15%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK  Y++ N A L  V          LR
Sbjct: 1181 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PK--YSSQNEAILGTV--------EALR 1229

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+       E  N  Y +FL  EY   GS+   +  ++  R  
Sbjct: 1230 SEVSTLKDL-DHLNIVQYLGF-----ENKNNIYSLFL--EYVAGGSVGSLI--RMYGRFD 1279

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  + ++  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1280 ESLIRHLTTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKD 1333

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  C+ L++      +    
Sbjct: 1334 ----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMFAGKRPWSNLE 1387

Query: 251  EVAILN--GRYQYPAYPIYSDRL-------KNVVRVLLSPHPVKRPNICQLL 293
             VA +   G+ +  A PI  D L       ++ +      +P +RP   +LL
Sbjct: 1388 VVAAMFKIGKSK-SAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 78.6 bits (192), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 81/349 (23%), Positives = 141/349 (40%), Gaps = 65/349 (18%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNS-------NIACLKRVIVP--NKSG 65
           + +   +  I + L  G  + +Y V+       T S        +  LKR+  P  N   
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 66  LNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKL 125
           ++    EVD  K  ++  ++++ +DS   + +  +GS  + +L+ Y   GSL D +N  L
Sbjct: 86  ISAAMKEVDNYKRFQSP-YIITLVDSQVVQEK--DGSKTLCILLPYFPLGSLQDMVNRNL 142

Query: 126 RER--LQEQEVLNIMNQVCQGIAAMHK--------------------------LL--PPL 155
            +   + E E + IM  + +G+  +H                           LL   PL
Sbjct: 143 LKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPL 202

Query: 156 ----------------IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQH 199
                           +HRDI++ N+L S +GL  V D GS C          +L  +Q 
Sbjct: 203 ELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQD 262

Query: 200 DVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV------- 252
            V  N +  Y +PE++++     I+ K       C    ++     F  + +V       
Sbjct: 263 WVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTY 322

Query: 253 AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQN 301
           AI  G+Y +P    YS+ L  V++  L   P  RP+I +LL+ +  +Q 
Sbjct: 323 AIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQT 371

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 135/304 (44%), Gaps = 43/304 (14%)

Query: 9    YPPGFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN 67
            +  G +I  GS  A  L   +T+G    +  VE+ PK    N  +           + ++
Sbjct: 1140 WMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEV-PKYGLQNETVV----------NTVD 1188

Query: 68   VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE 127
             LR EV  +K L ++ ++V Y+   A      NG Y +FL  EY   GS+   +  ++  
Sbjct: 1189 ALRLEVSTLKDL-DHLNIVQYLGFEAK-----NGIYSLFL--EYVAGGSVGSLI--RMYG 1238

Query: 128  RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRP 187
            R  +  + ++  QV QG++ +H     ++HRD+K +N+L+  DG+ K+ DF    GI R 
Sbjct: 1239 RFDDILIRHLTIQVLQGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRK 1292

Query: 188  PRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFR 247
              +     Y   ++    T  + +PEM+D  +G+  +  I  LG  C+ L++      + 
Sbjct: 1293 SNDI----YSNSEMTMKGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMFAGKRPWS 1346

Query: 248  EDREVAILNGRYQYPA--------YPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE-ISK 298
                VA +    Q  +         P+ S+  K  +       P KRP   +LL    SK
Sbjct: 1347 NFEVVAAMFKIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLLSHPFSK 1406

Query: 299  IQNI 302
            + N+
Sbjct: 1407 VNNL 1410

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 117/262 (44%), Gaps = 38/262 (14%)

Query: 48   TNSNIACLKRVIVPNK--------SGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFG 99
            T   +  +K+V VP          S L  LR+EV  +K L ++ ++V Y+        F 
Sbjct: 1167 TTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDL-DHTNIVQYLG-------FE 1218

Query: 100  NGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRD 159
            N +Y   L +EY   GS+   +  +L  +  E  +  +  QV +G++ +H     ++HRD
Sbjct: 1219 NKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHS--KKILHRD 1274

Query: 160  IKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVK 219
            +K +N+L+  DG+ K+ DF    GI +   N     Y   D+    T  + +PEM+D  +
Sbjct: 1275 MKADNLLLDVDGICKISDF----GISKKSNN----IYSNSDMTMRGTVFWMAPEMVDTKQ 1326

Query: 220  GFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYP--------IYSDRL 271
            G+  +  I  LG  CV L++      +     VA +    ++ + P        I S   
Sbjct: 1327 GYSAKVDIWSLG--CVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEG 1384

Query: 272  KNVVRVLLSPHPVKRPNICQLL 293
            K  +      +P KRP   +LL
Sbjct: 1385 KEFLDACFEINPEKRPTADELL 1406

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 125/281 (44%), Gaps = 45/281 (16%)

Query: 31   GGFAQIY-SVEISPKDEYTNSNIACLKRVIVPN--------KSGLNVLRTEVDAMKLLKN 81
            G F  +Y S+ I      T   +  +K+V VP         K  +  L++EV  +K L +
Sbjct: 1160 GSFGAVYLSLNI------TTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDL-D 1212

Query: 82   NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQV 141
            + ++V Y+ S     E     Y +FL  EY   GS+   +  +L  R  E+ + ++  QV
Sbjct: 1213 HLNIVQYLGS-----EIRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQV 1263

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDV 201
              G+  +H     ++HRD+K +N+L+  DG+ K+ DF    GI +  +N     Y   D+
Sbjct: 1264 LSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSDM 1313

Query: 202  MKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQY 261
                T  + +PEM+D  +G+  +  I  LG  CV L++      +     VA +    + 
Sbjct: 1314 TMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CVVLEMFAGKRPWSNLEVVAAMFQIGKS 1371

Query: 262  PAYP--------IYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
             + P        + S + K+ +       P KRP    LLE
Sbjct: 1372 KSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 134/293 (45%), Gaps = 34/293 (11%)

Query: 10  PPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVL 69
           PP  +IK      +   +L  GGFA+ + ++      +    +A   ++ + ++     L
Sbjct: 84  PPS-LIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKL 139

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERL 129
            +E+   K +K++ ++V +ID     +        V++L+E C  GSL+D +  K R+ L
Sbjct: 140 LSEIQIHKSMKHS-NIVQFIDCFEDDAN-------VYILLEICPNGSLMDLL--KKRKSL 189

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPR 189
            E EV     Q+C  I  +H     +IHRD+K+ N+    D   KV DFG    +     
Sbjct: 190 TEPEVRFFTTQICGAIKYLHS--RRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA---- 243

Query: 190 NPQELQYVQHDVMKNTTAQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE 248
           N +E +Y         T  Y +PE ++    G   E  I  +G   V +  +L+     +
Sbjct: 244 NDRERKYTVCG-----TPNYIAPEVLMGKHSGHSFEVDIWSIG---VMIYALLVGKPPFQ 295

Query: 249 DREVAILNGR-----YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
            ++V ++  R     Y YP     S   + ++  +LS +P++RP I  +++++
Sbjct: 296 AKDVNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 134/293 (45%), Gaps = 34/293 (11%)

Query: 10  PPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVL 69
           PP  +IK      +   +L  GGFA+ + ++      +    +A   ++ +  +     L
Sbjct: 81  PPS-LIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKL 136

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERL 129
            +E+   K +K+  ++V ++D       F + +  V++L+E C  GSL+D M  K R+ L
Sbjct: 137 LSEIQIHKSMKHP-NIVHFVDC------FEDDT-NVYILLEICSNGSLMDLM--KKRKTL 186

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPR 189
            E EV     Q+C  +  MH     +IHRD+K+ N+    D   KV DFG    +     
Sbjct: 187 TEPEVRFFTTQICGAVKYMHS--RRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA---- 240

Query: 190 NPQELQYVQHDVMKNTTAQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE 248
           N +E +Y         T  Y +PE ++    G   E  I  +G   V +  +L+     +
Sbjct: 241 NNRERKYTV-----CGTPNYIAPEVLMGKHAGHSFEVDIWSIG---VMIYALLVGKPPFQ 292

Query: 249 DREVAILNGR-----YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
            ++V ++  R     Y YP     S   K ++  +L   PV+RP+I ++++++
Sbjct: 293 AKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 112/230 (48%), Gaps = 34/230 (14%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK  Y++ + A +        S +  LR
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PK--YSSQDEAII--------STVEALR 1265

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+        F N      L +EY   GS+   +  ++  R  
Sbjct: 1266 SEVSTLKDL-DHLNIVQYLG-------FENKDNIYSLFLEYVAGGSVGSLI--RMYGRFD 1315

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  + ++  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1316 EPLIRHLNTQVLRGLAYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSKD 1369

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  C+ L++ 
Sbjct: 1370 ----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMF 1413

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 82/334 (24%), Positives = 139/334 (41%), Gaps = 65/334 (19%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIA-----CLKRVIVPNKSGLNVL 69
           I+V   + KI + L  GG + +Y V++        + I       LK++I P+   ++  
Sbjct: 23  IRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNG 82

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER- 128
             E++  K  ++  +V+  IDS   + +  NGS  +++++ Y   GSL D +N +L E  
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVTQEK--NGSKIIYIILPYYSLGSLQDSINRRLLEGT 139

Query: 129 -LQEQEVLNIMNQVCQGIAAMHK---------------------------LLP--PL--- 155
            + E E + IM  V +G+  +H                            LL   PL   
Sbjct: 140 FISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 156 ------------IHRDIKIENVLISGDGLFKVCDFGSV--CGIIRPPRNPQELQYVQHDV 201
                        HRDI   N+L S +GL  + D GS     I    RN  +L  +Q  V
Sbjct: 200 VLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRN--QLSELQEWV 257

Query: 202 MKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AI 254
             N T  Y +PE+++L     +  K+      C    +M     F  + ++       AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
             G+Y +P    +S+ L NV++  +   P++RP 
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRPT 351

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 116/262 (44%), Gaps = 38/262 (14%)

Query: 48   TNSNIACLKRVIVPNK--------SGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFG 99
            T   +  +K+V VP          S L  L++EV  +K L ++ ++V Y+        F 
Sbjct: 1167 TTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDL-DHVNIVQYLG-------FE 1218

Query: 100  NGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRD 159
            N ++   L +EY   GS+   +  +L  R  E  +  +  QV +G+A +H     ++HRD
Sbjct: 1219 NKNHVYSLFLEYVAGGSVGSLI--RLFGRFDEDLIRFLAVQVLRGLAYLHS--KGILHRD 1274

Query: 160  IKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVK 219
            +K +N+L+  DG+ K+ DF    GI +   N     Y   D+    T  + +PEM+D  +
Sbjct: 1275 MKADNLLLDVDGICKISDF----GISKKSNN----IYSNSDMTMRGTVFWMAPEMVDTKQ 1326

Query: 220  GFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYP--------IYSDRL 271
            G+  +  I  LG  CV L++      +     VA +    ++ + P        + S   
Sbjct: 1327 GYSAKVDIWSLG--CVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEA 1384

Query: 272  KNVVRVLLSPHPVKRPNICQLL 293
            K+ +       P KRP    LL
Sbjct: 1385 KSFLDACFEIDPEKRPTADDLL 1406

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 107/230 (46%), Gaps = 34/230 (14%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   LT+G    +  VE+ PK    + NI             +  LR
Sbjct: 1278 GEMIGKGSFGAVYLCLNLTTGEMMAVKQVEV-PKYSAQDQNIL----------DTVEALR 1326

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+        F N      L +EY   GS+   +  +L  R  
Sbjct: 1327 SEVSTLKDL-DHLNIVQYLG-------FENDHDIYSLFLEYVGGGSVGSLI--RLYGRFD 1376

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  +  +  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1377 EALIRFLTVQVLEGLAYLHS--KGILHRDMKADNLLLDLDGVCKISDF----GISRKSKD 1430

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  CV L++ 
Sbjct: 1431 ----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CVVLEMF 1474

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    D +    +A   +  + ++     L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHP-NIV 142

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + S  V++L+E C  GSL++ +  K R+ L E EV     Q+C  I 
Sbjct: 143 QFIDC------FEDDS-NVYILLEICPNGSLMELL--KRRKVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N  E +Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  LG   V L  +L+     + R+V  +  R     + 
Sbjct: 243 PNYIAPEVLMGKHSGHSFEVDIWSLG---VMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P     SD  K ++R +LS  P++RP++ ++++ +
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 90/300 (30%), Positives = 138/300 (46%), Gaps = 52/300 (17%)

Query: 10  PPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVL 69
           PP  VIK  S +    + L  GGFA+ + +    KD+   S  AC    IV  KS    +
Sbjct: 82  PPS-VIKDNSKKYFRRECLGEGGFARCFHI----KDDVGIS-FAC---KIVSKKS----I 128

Query: 70  RTEVDAMKLL------KNNR--HVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFM 121
           +TE    KLL      +N R  H+V ++D    + E       V++L+E C  GSL+D +
Sbjct: 129 KTERTKFKLLSEIQIHQNLRYSHIVKFMD--CFEDELN-----VYILLELCPNGSLMDLL 181

Query: 122 NTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSV 181
             K R+ L E EV  +  QVC  I  MH     +IHRD+K+ NV    +   K+ DFG  
Sbjct: 182 --KKRKILTEAEVKFMTTQVCGAINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLA 237

Query: 182 CGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVK--GFPIERKIRHLGSWCVALQI 239
             +     N  E +Y         T  Y +PE+I L K  G   E  I  LG   + +  
Sbjct: 238 ATL----SNVSEKKYTMCG-----TPNYIAPEVI-LSKQIGHSFEADIWSLG---IMIYA 284

Query: 240 MLLHYTFREDREVAILNGR-----YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
           M+L     + ++V  +  +     Y++P     ++ +K +++ LL   P +RP I  +L+
Sbjct: 285 MVLGKPPFQAKDVTTIYEKIKLCQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 127/281 (45%), Gaps = 45/281 (16%)

Query: 31   GGFAQIY-SVEISPKDEYTNSNIACLKRVIVPN-----KSGLN---VLRTEVDAMKLLKN 81
            G F  ++ S+ I      T   +  +K++ VP+     ++ LN    +++EV  +K L +
Sbjct: 1144 GSFGAVFLSLNI------TTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDL-D 1196

Query: 82   NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQV 141
            + ++V Y+       E  +  Y +FL  EY   GS+   +  ++  R  ++ + ++ NQV
Sbjct: 1197 HLNIVQYLGF-----EMKHNIYSLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQV 1247

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDV 201
             +G++ +H     ++HRD+K +N+L+  DG+ K+ DFG             E  Y   ++
Sbjct: 1248 LEGLSYLHS--QGILHRDMKADNLLLDQDGICKISDFG--------ISKKSEDIYSNSEM 1297

Query: 202  MKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQY 261
                T  + +PEM+D  +G+  +  I  LG  CV L++      +     V  +    Q 
Sbjct: 1298 TMRGTVFWMAPEMVDTKQGYNAKVDIWSLG--CVVLEMFAGKRPWSNFEVVTAMYKIGQS 1355

Query: 262  PAYP--------IYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
             + P        + S   KN +       P +RP   QLLE
Sbjct: 1356 KSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 108/230 (46%), Gaps = 34/230 (14%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK    + NI           S +  LR
Sbjct: 1099 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PKYSSQDENII----------STVEALR 1147

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+        F N      L +EY   GS+   +  ++  R  
Sbjct: 1148 SEVSTLKDL-DHLNIVQYLG-------FENKDNIYSLFLEYVAGGSVGSLI--RMYGRFD 1197

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  + ++  QV +G++ +H     ++HRD+K +N+L+  DG+ K+ DFG         R 
Sbjct: 1198 EAMIRHLTIQVLRGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDFGI-------SRK 1248

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
              ++ Y   D+    T  + +PEM+D  +G+  +  I  LG  CV L++ 
Sbjct: 1249 SNDI-YSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CVVLEMF 1295

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 134/297 (45%), Gaps = 42/297 (14%)

Query: 9    YPPGFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN 67
            +  G +I  GS  +  L   +T+G    +  VE+    E+ + N A +        S + 
Sbjct: 1338 WVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVP---EFGSQNEAIV--------STVE 1386

Query: 68   VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE 127
             LR+EV  +K L ++ ++V Y+       E  N  Y +FL  EY   GS+   +  ++  
Sbjct: 1387 ALRSEVTLLKDL-DHINIVQYLGF-----EKKNNIYSLFL--EYVAGGSIGSLI--RMYG 1436

Query: 128  RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRP 187
            R  E  + +   Q+  G++ +H     ++HRD+K +N+L+ G+G+ K+ DF    GI R 
Sbjct: 1437 RFDESLIRHSTTQILAGLSYLHS--KGILHRDMKADNILLDGEGICKISDF----GISRK 1490

Query: 188  PRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFR 247
             ++     Y   ++    T  + +PEM+D  +G+  +  I  LG  C+ L++      + 
Sbjct: 1491 SKD----IYSNSEMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIILEMFAGKRPWS 1544

Query: 248  EDREVAILNGRYQ-YPAYPIYSDRL-------KNVVRVLLSPHPVKRPNICQLLEEI 296
                VA +    Q   A PI  D L       ++ +       P KRP   Q+L+ +
Sbjct: 1545 NLEVVAAMFKIGQSKSAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 134/292 (45%), Gaps = 44/292 (15%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK  Y++ + A +        S ++ ++
Sbjct: 1257 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEV-PK--YSSQDEAIM--------STVDAIK 1305

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+        F N      L +EY   GS+   +  ++  R  
Sbjct: 1306 SEVSTLKDL-DHLNIVQYLG-------FENKDNIYSLFLEYVAGGSVGSLI--RIYGRFD 1355

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  + ++  QV +G+A +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1356 EPLIRHLNIQVLRGLAYLHAR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSKD 1409

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  C+ L++      +    
Sbjct: 1410 ----IYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CIVLEMFAGKRPWSNFE 1463

Query: 251  EVAILN--GRYQYPAYPIYSDRL-------KNVVRVLLSPHPVKRPNICQLL 293
             VA +   G+ +  A PI  D L       +  +       P KRP   +LL
Sbjct: 1464 VVAAMFKIGKSK-SAPPIPEDTLPLISAEGREFLDACFEIDPDKRPTADELL 1514

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/347 (22%), Positives = 142/347 (40%), Gaps = 67/347 (19%)

Query: 12  GFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR- 70
           G  I +      +   L  G    +Y V+  PK  ++    A LK+V  P      V R 
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVK-CPKRSHSGGVYA-LKKVTCPIGRADFVTRA 78

Query: 71  -TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKL--RE 127
            TE+   +   N+ ++ + +D   A+ +  NG+  +++L+ Y   GSL D +N  +   +
Sbjct: 79  MTEISNYQRF-NSPYITNILDFQVAQHD--NGTKIIYMLLPYFPAGSLQDLINNMIIRGD 135

Query: 128 RLQEQEVLNIMNQVCQGIAAMHK------------------------------------- 150
            L E  V+ +M  +C+G+  MH+                                     
Sbjct: 136 SLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDL 195

Query: 151 LLPPL--------IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPP---RNPQELQYVQH 199
           L PPL        +H  +  EN+++S +GL  + +  S    +R P    +  +L  +Q 
Sbjct: 196 LSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQE 252

Query: 200 DVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVA------ 253
            + +N+   Y  PE++DL     I  +       C+   +M    +F  ++++       
Sbjct: 253 WLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKH 312

Query: 254 -ILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKI 299
            I  G + +P  P YS  LK +V+  L   P KRP+I + L +  ++
Sbjct: 313 SISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YJL095W (BCK1)
          Length = 1423

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 107/233 (45%), Gaps = 40/233 (17%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEI---SPKDEYTNSNIACLKRVIVPNKSGLN 67
            G +I  GS  A  L   +T+G    +  VE+     +DE T +N   L            
Sbjct: 1127 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALI----------- 1175

Query: 68   VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE 127
               +EV  +K L ++ ++V Y+        F N +    L +EY   GS+   +  +L  
Sbjct: 1176 ---SEVSTLKDL-DHLNIVQYLG-------FENKNCIYSLFLEYVAGGSVGSLI--RLYG 1222

Query: 128  RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRP 187
               EQ +  +  QV +G+A +H  L  ++HRD+K +N+L+  DG+ K+ DF    GI R 
Sbjct: 1223 HFDEQLIRFLTTQVLEGLAYLH--LRGILHRDMKADNLLLDNDGVCKISDF----GISRK 1276

Query: 188  PRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
              N     Y   ++    T  + +PEM+D  +G+  +  I  LG  CV L++ 
Sbjct: 1277 SNN----IYSNSEMTMRGTVFWMAPEMVDTTQGYSAKVDIWSLG--CVVLEMF 1323

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    + +    +A   +  + ++     L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + S  V++L+E C  GSL++ +  K R+ L E EV     Q+C  I 
Sbjct: 143 QFIDC------FEDDS-NVYILLEICPNGSLMELL--KRRKVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N  E +Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  LG   V L  +L+     + R+V  +  R     + 
Sbjct: 243 PNYIAPEVLMGKHSGHSFEVDIWSLG---VMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P     SD  K ++R +LS  P++RP++ ++++ +
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    + +    +A   +  + ++     L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + S  V++L+E C  GSL++ +  K R+ L E EV     Q+C  I 
Sbjct: 143 QFIDC------FEDDS-NVYILLEICPNGSLMELL--KRRKVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N  E +Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  LG   V L  +L+     + R+V  +  R     + 
Sbjct: 243 PNYIAPEVLMGKHSGHSFEVDIWSLG---VMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P     SD  K ++R +LS  P++RP++ ++++ +
Sbjct: 300 FPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 128/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++    + +    +A   +  + ++     L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAHP-NIV 142

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            ++D       F + S  V++L+E C  GSL++ +  K R+ L E EV     Q+C  I 
Sbjct: 143 QFVDC------FEDDS-NVYILLEICPNGSLMELL--KRRKVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N  E +Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NESERKYTI-----CGT 242

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  LG   V L  +L+     + R+V  +  R     + 
Sbjct: 243 PNYIAPEVLMGKHSGHSFEVDIWSLG---VMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P     SD  K ++R +LS  P++RP++ ++++ +
Sbjct: 300 FPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 113/230 (49%), Gaps = 34/230 (14%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ P+  Y + N A +        S +  LR
Sbjct: 1185 GEMIGKGSFGAVFLCLNVTTGEMMAVKQVEV-PR--YGSQNEAII--------STVEALR 1233

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
             EV  +K L ++ ++V Y+       E  +  Y +FL  EY   GS+   +  ++  +  
Sbjct: 1234 AEVSTLKDL-DHLNIVQYLGF-----EVKDSIYSLFL--EYVAGGSVGSLI--RMYGKFD 1283

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E+ + ++  QV +G++ +H     ++HRD+K +N+L+  DG+ K+ DF    GI R  ++
Sbjct: 1284 EKLIKHLTIQVLRGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSKD 1337

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
                 Y   ++    T  + +PEM+D  +G+  +  I  LG  CV L++ 
Sbjct: 1338 ----IYSNSEMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CVVLEMF 1381

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 135/333 (40%), Gaps = 55/333 (16%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKS--GLNVLRTE 72
           + V  H+  I + L  GGF+ +Y VE         + +  LK++  P  S   ++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVE------SRENGLMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ-- 130
           VD  +  K+  ++   IDS   +    +GS  V++L+ Y  +GSL D +N  L +  Q  
Sbjct: 73  VDNYQKFKSP-YIAQIIDSQVVQER--DGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EQEVLNIMNQVCQGIAAMHKLLPP-----------------------------------L 155
           E EV+ +   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMI 215
            H DIK  N++IS +G+  + D GS         + Q L   Q    ++ T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AILNGRYQYPAYPIYS 268
           D+     I  K       C    +      F  + ++       ++  G+Y  P+   YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 DRLKNVVRVLLSPHPVKRPNICQLLEEISKIQN 301
             L +VV+  L+  P  RP++ +L+  +  +Q+
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQS 342

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 128/275 (46%), Gaps = 31/275 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      +    +A   ++ + ++     L +E+   ++ K+ RH  
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHFN 149

Query: 85  VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQG 144
           VV +ID       F + +  V++L+E C  GSL++ +  K R  + E EV   M Q+C  
Sbjct: 150 VVQFIDC------FEDDT-NVYILLEICPNGSLMELL--KKRRTVTEPEVRYFMTQICGA 200

Query: 145 IAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKN 204
           I  MH     +IHRD+K+ N+    +   K+ DFG    +     N +E +Y        
Sbjct: 201 IKYMHS--RRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV-----C 249

Query: 205 TTAQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQY 261
            T  Y +PE ++    G   E  I  +G    AL I    +  ++   +   I N  + +
Sbjct: 250 GTPNYIAPEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAF 309

Query: 262 PAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           P     S+  K ++  +LS  P++RP+I ++++ +
Sbjct: 310 PKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 109/230 (47%), Gaps = 34/230 (14%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK            ++ V N   +  L 
Sbjct: 1101 GEIIGKGSFGAVYLGLNVTTGEMMAVKQVEV-PK-------FGSQDQITVTN---VEALI 1149

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+       E  NG Y +FL  EY   GS+   +  +L     
Sbjct: 1150 SEVSTLKNL-DHLNIVQYLGF-----ENKNGIYSLFL--EYVAGGSVGSLI--RLYGHFD 1199

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            EQ +  +  QV +G+A +H+    ++HRD+K +N+L+  +G+ K+ D     GI R   N
Sbjct: 1200 EQLIRFLTKQVLEGLAYLHRR--GILHRDMKADNLLLDNNGVCKISDL----GISRKSNN 1253

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
                 Y   ++    T  + +PEM+D  +G+  +  I  LG  CV L++ 
Sbjct: 1254 ----IYSNAEMTMRGTVFWMAPEMVDTTQGYSAKVDIWSLG--CVVLEMF 1297

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 130/276 (47%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      +    +A L    + ++     L +E+   K +K+ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + +  V++L+E C  GSL+D +  K R+ L E EV     Q+C  I 
Sbjct: 143 QFIDC------FEDDT-NVYILLEICPNGSLMDLL--KKRKLLTEPEVRFFTTQICGAIK 193

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N +E +Y         T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 242

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  +G   V L  +L+     + ++V  +  R     + 
Sbjct: 243 PNYIAPEVLMGKHSGHSYEVDIWSIG---VMLYALLIGKPPFQSKDVNTIYERIKCCDFS 299

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P     S+  K +++ LLS  P++RP+I ++++ +
Sbjct: 300 FPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 111/230 (48%), Gaps = 34/230 (14%)

Query: 12   GFVIKVGSHQAKILKY-LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLR 70
            G +I  GS  A  L   +T+G    +  VE+ PK  + + + A +        S +  LR
Sbjct: 1177 GEMIGKGSFGAVYLGLNVTTGEMMAVKQVEV-PK--FGSQDEATI--------SVVEALR 1225

Query: 71   TEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
            +EV  +K L ++ ++V Y+       E  N  Y +FL  EY   GS+   +  +L  R  
Sbjct: 1226 SEVSTLKNL-DHLNIVQYLGF-----ENKNSIYSLFL--EYVAGGSVGSLI--RLYGRFD 1275

Query: 131  EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
            E  +  +  QV +G++ +H     ++HRD+K +N+L+  DG+ K+ DF    GI R   +
Sbjct: 1276 ESLIRFLTVQVLRGLSYLHSR--GILHRDMKADNLLLDLDGVCKISDF----GISRKSND 1329

Query: 191  PQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240
                 Y   D+    T  + +PEM+D  +G+  +  I  LG  CV L++ 
Sbjct: 1330 ----IYCNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLG--CVVLEMF 1373

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/348 (22%), Positives = 141/348 (40%), Gaps = 73/348 (20%)

Query: 18  GSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVP--NKSGLNVLRTEVDA 75
           G H A I + L  GGF+ +Y V+        N+++  LK++  P  N   ++    EV++
Sbjct: 25  GQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCPFGNIESVSEAMREVNS 78

Query: 76  MKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE--RLQEQE 133
            K  ++  ++   + S   + +  +GS  VF+L+ Y   GSLLD +NT L +   + E+E
Sbjct: 79  YKKFRS-PYITHCVSSQVLQEQ--DGSKTVFILLPYFPTGSLLDKINTHLLDGTTISEEE 135

Query: 134 VLNIMNQVCQGIAAMH---------------------------------KLLPPLIHRD- 159
           ++ I+  V +G+  MH                                 +LL   +  D 
Sbjct: 136 IVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLELDV 195

Query: 160 -------------------IKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHD 200
                              IK  N++ S DGL  +CD GS         +  +L   Q  
Sbjct: 196 LSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEW 255

Query: 201 VMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------A 253
             ++ T  +RSPE++++     I+ K+      C    +      F  + ++       A
Sbjct: 256 CNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYA 315

Query: 254 ILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQN 301
           I  G++  P    YS  L  +++  +     KRP+I +LL  +  +Q 
Sbjct: 316 IATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 126/276 (45%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ +         +    +A L    + ++     L +E+   K +KN  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + +  V++L+E C  GSL+D +  K R+ L E EV     Q+C  I 
Sbjct: 144 QFIDC------FEDDT-NVYILLEICPNGSLMDLL--KKRKSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    D   K+ DFG    +     N +E +Y         T
Sbjct: 195 YMHS--RRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 243

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  +G   V L  +L+     + ++V  +  R     + 
Sbjct: 244 PNYIAPEVLMGKHTGHSYEVDIWSIG---VMLYALLIGKPPFQSKDVNTIYERIKCCDFT 300

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P     S   K +++ LLS  P++RP++ ++++ +
Sbjct: 301 FPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 121/287 (42%), Gaps = 69/287 (24%)

Query: 31  GGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNV--LRTEVDAMKLLKNNRHVVSY 88
           G F  +Y      K  Y  +N  C  +V+  + +   V  ++ EV  +  LK   ++  Y
Sbjct: 28  GKFGIVY------KGYYIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY 81

Query: 89  IDSNAAKSEFGNGSY----EVFLLMEYCERGSLLDFMNTKLR-ERLQEQEVLNIMNQVCQ 143
                       GSY    E++++MEYC  GSL     T LR  ++ EQ +  IM ++  
Sbjct: 82  Y-----------GSYLNNTELWVIMEYCAGGSL----RTLLRPGKIGEQYIGVIMRELL- 125

Query: 144 GIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMK 203
            IA MH     +IHRDIK  NVLI+ DG  K+CDFG               Q  Q  + +
Sbjct: 126 -IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRR 172

Query: 204 NTTAQ---YRSPEMIDLVKGFPIERKIRHLG-----------SWC--VALQIMLLHYTFR 247
            T A    + +PE+I     +  +  I  LG            +C   AL+ M L    +
Sbjct: 173 QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSK 232

Query: 248 EDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
             R    L GR        +S  LK  + + L   P +RP+  +LL+
Sbjct: 233 PPR----LEGRQ-------HSSALKEFIALCLDEDPKERPSAEELLK 268

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 42/93 (45%), Gaps = 7/93 (7%)

Query: 380 FNSHHTPPPIGIVSNKTIAKPLYNSLEDGN-NGLENHYLSSSVPAISYLANQHANDNIRN 438
           + S HT P     S    +K L    EDG+ N  +  Y  S+    S LA +HA+DN+++
Sbjct: 416 YQSKHTLPNTSKNSETKASKALLQLFEDGDDNSTDVDYARSA----SALAGKHADDNLKS 471

Query: 439 TTKLNIPAQNSTGSKNKTYVDSETQTLEEPSLQ 471
            T L    Q+    K   Y    T +L  P LQ
Sbjct: 472 ATPLPDRGQHPDAFKGPIYHSQSTPSL--PMLQ 502

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/281 (25%), Positives = 124/281 (44%), Gaps = 43/281 (15%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLL------K 80
           +L  GGFA+ + ++      +    +A L             ++TE    KLL      K
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS------------IKTEKTRKKLLSEIQIHK 153

Query: 81  NNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIM 138
           + RH  +V +ID    ++        V++L+E C  GSL++ +  K R+ L E EV    
Sbjct: 154 SMRHANIVQFIDCFEDETN-------VYILLEICPNGSLMELL--KKRKTLTEPEVRFFT 204

Query: 139 NQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQ 198
            Q+C GI  MH     +IHRD+K+ N+    +   K+ DFG    +     N +E +Y  
Sbjct: 205 TQICGGIKYMHS--RRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA----NDRERKYTV 258

Query: 199 HDVMKNTTAQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AIL 255
                  T  Y +PE ++    G   E  I  +G    AL I    +  ++   +   I 
Sbjct: 259 -----CGTPNYIAPEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIK 313

Query: 256 NGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
              + +P     S   + +V+ LLS  P++RP+I ++L+ +
Sbjct: 314 CCDFVFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar to
           Ashbya gossypii AER223C
          Length = 893

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 102/224 (45%), Gaps = 31/224 (13%)

Query: 76  MKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQE 133
           + LLKN RH  +V Y         F   S+E+++L+EYC RGSL D +    +E L E +
Sbjct: 65  IDLLKNLRHENIVKY-------HGFIQSSHELYILLEYCIRGSLRDLIK---KEALSEAK 114

Query: 134 VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQE 193
               + Q  +G+  +H     +IHRDIK  N+L++ +G+ K+ DFG     +        
Sbjct: 115 AKVYVKQTVRGLQYLHD--QGVIHRDIKAANLLLTENGIVKLADFG-----VSTRVTNMA 167

Query: 194 LQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIML--LHYTFREDRE 251
           + Y         +  + +PE++ L KG      I  LG+  V L       H    E   
Sbjct: 168 MTYA-------GSPNWMAPEVM-LGKGASTVSDIWSLGATVVELLTGNPPFHNLVNEAAC 219

Query: 252 VAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295
            AI+N  Y  P +   S + KN +      +  KRP   QLL++
Sbjct: 220 YAIVNDVYYPPEH--LSTQCKNFIERCFQKNMFKRPQAHQLLQQ 261

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 128/290 (44%), Gaps = 28/290 (9%)

Query: 10  PPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVL 69
           PP  +IK      +  ++L  GGFA+ + ++      +    +A   ++ +  +     L
Sbjct: 131 PPS-LIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKL 186

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERL 129
            +E+   K +K+ +++V ++D              V++L+  C  GSL++ +  K R+ L
Sbjct: 187 LSEIQIHKSMKH-QNIVQFVDC-------FEDHINVYILLGMCPNGSLMELL--KKRKIL 236

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPR 189
            E EV     Q+C  I  MH     +IHRD+K+ N+    +   K+ DFG    +     
Sbjct: 237 TEPEVRFFTVQICGAIKYMHS--RRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLA---- 290

Query: 190 NPQELQYVQHDVMKNTTAQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE 248
           N +E +Y         T  Y +PE ++    G   E  I  +G    AL I    +  ++
Sbjct: 291 NDRERKYTVCG-----TPNYIAPEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKD 345

Query: 249 DREV--AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
              +   I N  Y +P     S   K +++ +L   P+ RP+I +++E +
Sbjct: 346 VNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 97/372 (26%), Positives = 157/372 (42%), Gaps = 67/372 (18%)

Query: 457 YVDSETQTLEEPSLQHTRILPHISTDRTDN----------TGNSIVSRLGVQLRNVITND 506
           YVDSETQT +  ++  +++ P ++    ++          +G +IV  L  +L+ VIT +
Sbjct: 463 YVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGE 522

Query: 507 SSASSSIDTVQETGNSIKSAIESLKNSVSGMA-NNVKALSVENARNHLERLXXXXXXXXX 565
           S  SS I + Q TG+S +SA+  L++  +G + NN ++ S ++                 
Sbjct: 523 SRGSSPIKSRQNTGDSTRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRRLGSS 582

Query: 566 XXXAKPNSAPIIPAVVTTHTSNSLKTAVSSPTHSELSDENEL-----------YDTLHLP 614
              +     P             L+   S P+ S LSD ++            Y   H P
Sbjct: 583 STSSLSVFNPDTKRQEEIDKKQKLENRRSMPS-SILSDFDQHERINSRTGSRDYYRSHSP 641

Query: 615 DPK---TSFQSPSPLKYAV------DRKMKASIEKRVLNLLKNAEDSPVKKTAAGYGKYT 665
             K   TS  +P P+   V      +++ K SI++RV NLLK++ED    K+A+GYGKYT
Sbjct: 642 VKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYT 701

Query: 666 KRPKMVSPTNPHYHLVRQNSVSQTPLI---LSARGSSGHPVVVPALINRDNDNGXXXXXX 722
                 S         R +SV  TP+      +R  +G    +     +DND        
Sbjct: 702 DTDTETSN--------RHSSVRITPITEEKFKSRNKNG----LSNNKTKDNDRHKSRPPR 749

Query: 723 XXXXXXXXXXDHLRPKPPK-------KPAHLSSLKINKKHSTTVLNTPADLLSDTAVDEL 775
                      HLR +  K           LSS +I+   + T++        +  VD+L
Sbjct: 750 PPPKPL-----HLRAEIQKVRSSSRLHSGELSSERISSDATETIV--------EVNVDDL 796

Query: 776 EKSFKQRYPSTV 787
           E  F++R+PS V
Sbjct: 797 EADFRKRFPSKV 808

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 127/301 (42%), Gaps = 71/301 (23%)

Query: 31  GGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNV--LRTEVDAMKLLKNNRHVVSY 88
           G F  +Y      K  YT +   C  +V+  + +   V  ++ E+  +  LK   ++  Y
Sbjct: 28  GKFGVVY------KGYYTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHY 81

Query: 89  IDSNAAKSEFGNGSY----EVFLLMEYCERGSLLDFMNTKLR-ERLQEQEVLNIMNQVCQ 143
                       GSY    +++++MEYC  GSL     T LR  ++ EQ +  IM ++  
Sbjct: 82  Y-----------GSYLNDTKLWVIMEYCAGGSL----RTLLRPGKIGEQYIGVIMRELLT 126

Query: 144 GIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMK 203
            +  +HK    +IHRDIK  NVLI+ DG  K+CDFG               Q  Q  + +
Sbjct: 127 ALMHIHK--DGVIHRDIKAANVLITNDGHIKLCDFGVAA------------QLSQTKIRR 172

Query: 204 NTTAQ---YRSPEMIDLVKGFPIERKIRHLG-----------SWC--VALQIMLLHYTFR 247
            T A    + +PE+I     +  +  I  LG            +C   AL+ M L    +
Sbjct: 173 QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSK 232

Query: 248 EDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNIPCP 305
             R    L GR        +S  LK ++ + L   P +RP+   LL+   I   +N+P  
Sbjct: 233 PPR----LEGRQ-------HSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNVPVS 281

Query: 306 I 306
           I
Sbjct: 282 I 282

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 97/206 (47%), Gaps = 31/206 (15%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E    + E++L++EY + G L D++ +K   +L E E ++   Q+  GI+  H     + 
Sbjct: 202 EVWENNNELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSF--NIC 257

Query: 157 HRDIKIENVLISGD-GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPE 213
           HRD+K EN+L+     + K+ DFG              LQ V + +++ +     Y SPE
Sbjct: 258 HRDLKPENLLLDKKRRIIKIADFGMAA-----------LQ-VSNRLLQTSCGSPHYASPE 305

Query: 214 MI--DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR----EVAILNGRYQYPAYPIY 267
           ++      G P +  I   G   +   ++  H  F +D      + + NGRYQ P+Y   
Sbjct: 306 IVMGKCYNGAPSD--IWSCG--IILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--I 359

Query: 268 SDRLKNVVRVLLSPHPVKRPNICQLL 293
           S   KN++  +L   P KR +  Q+L
Sbjct: 360 SQEAKNLISRILVVDPSKRISTEQIL 385

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 125/276 (45%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + +       +    +A   ++ + ++     L +E+   K +K+  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID     +        V++L+E C  GSL+D +  K R+ L E EV     Q+C  I 
Sbjct: 156 QFIDCFEDDTN-------VYILLEICPNGSLMDLL--KKRKSLTEPEVRFFTTQICGAIK 206

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+        K+ DFG    +     N +E +Y         T
Sbjct: 207 YMHS--RKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLA----NDRERKYTV-----CGT 255

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE ++    G   E  I  +G    AL I    +   + ++V  +  R     + 
Sbjct: 256 PNYIAPEVLMGKHSGHSYEVDIWSIGVMIYALIIGRPPF---QSKDVNTIYERIKCRDFS 312

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +P   + S   K +++ +LS  P++RP++ ++++ I
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 125/274 (45%), Gaps = 27/274 (9%)

Query: 26  KYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHV 85
           ++L  GGFA+ + ++      +    +A   ++ + ++     L +E+   K + +  ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHT-NI 140

Query: 86  VSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGI 145
           V +ID           +  V++L+E C  GSL++ +  K R+ + E EV   M Q+C GI
Sbjct: 141 VQFIDC-------FEDNVNVYILLEICPNGSLMELI--KKRKTITEPEVRFFMTQICGGI 191

Query: 146 AAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNT 205
             MH     +IHRD+K+ N+        K+ DFG    +     N +E ++         
Sbjct: 192 QYMHS--NRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLA----NDRERKFTI-----CG 240

Query: 206 TAQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQYP 262
           T  Y +PE ++    G   E  I  +G    AL I    +  ++   +   I    + YP
Sbjct: 241 TPNYIAPEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYP 300

Query: 263 AYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
                S   K ++  +LS +P++RP+I ++++ +
Sbjct: 301 KDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 71/127 (55%), Gaps = 17/127 (13%)

Query: 55  LKRVIVPNKSGLNVLRTEVDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYC 112
           +K++   ++S LN    E+D   LLKN RH  +V Y         F   ++E+++++EYC
Sbjct: 38  IKQIEFEDESELNEHMLEID---LLKNLRHQNIVEY-------RGFIQKAHELYIILEYC 87

Query: 113 ERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGL 172
            RGSL D +       L E + +N + Q   G+  +H+    +IHRDIK  N+L++ +G+
Sbjct: 88  ARGSLRDILK---HGPLLEDDTVNYVTQTLYGLQYLHE--QGVIHRDIKAANLLLTEEGI 142

Query: 173 FKVCDFG 179
            K+ DFG
Sbjct: 143 VKLADFG 149

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 67.4 bits (163), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 118/255 (46%), Gaps = 31/255 (12%)

Query: 56  KRVIVPNKSGLNVLRTEVDAMKLL--KNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCE 113
           K+V  PNK     +  E++  K++   ++ H+V+  D+     ++G  S  ++++++YC 
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDA----FQWGKESC-IYMILDYCS 124

Query: 114 RGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLF 173
             SL   +  + R  L E E   +M Q+C GI  +H  L  +IH D+K+ N+L       
Sbjct: 125 NNSLQSIL--QYRGSLNEVECKELMIQLCGGIYWLH--LNNVIHGDLKLSNILFDEGQQL 180

Query: 174 KVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRS---PEMIDLVKGFPIERKIRHL 230
           K+CDFGS       PR P E+    + +   T   +++     M  L+  FPI+  I  +
Sbjct: 181 KICDFGSSFIATSSPRGPGEIMGTPYYLAPETVYTHKNINKSGMAILLISFPID--IWSM 238

Query: 231 GSWCVALQIML------------LHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVL 278
           G   + L  +L            LH    ++    I +G  ++P         + ++  +
Sbjct: 239 G---IVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQLILKM 295

Query: 279 LSPHPVKRPNICQLL 293
           LS +P++R  + +++
Sbjct: 296 LSQNPLERITLVEIV 310

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 95/201 (47%), Gaps = 30/201 (14%)

Query: 48   TNSNIACLKRVIVPNKSGLN--------VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFG 99
            T   +  +K+V VP     N         LR E+  +K L ++ ++V Y+        F 
Sbjct: 1145 TTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKNL-DHLNIVQYLG-------FE 1196

Query: 100  NGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRD 159
               +   L +EY   GS+   +  ++  R  E  + ++  QV +G++ +H     ++HRD
Sbjct: 1197 AKDHMNSLFLEYVAGGSVGSLI--RMYGRFDEVMIKHLTTQVLRGLSYLHSR--GILHRD 1252

Query: 160  IKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVK 219
            +K +N+L+  +G+ K+ DF    GI R  ++     Y   ++    T  + +PEM+D  +
Sbjct: 1253 MKADNLLLDQEGVCKISDF----GISRKSKD----IYSNSEMTMRGTVFWMAPEMVDTAQ 1304

Query: 220  GFPIERKIRHLGSWCVALQIM 240
            G+  +  I  +G  CV L++ 
Sbjct: 1305 GYSAKVDIWSMG--CVVLEMF 1323

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 111/244 (45%), Gaps = 50/244 (20%)

Query: 72  EVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQE 131
           E++  KL+  +++++S ID     +        +++++E C  GSL D +  + +  L+E
Sbjct: 99  EIEIHKLVNGHKNIISMIDHFEIDAT-------MYMVLELCGAGSLYDII-CRSKRSLRE 150

Query: 132 QEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNP 191
            E   +M Q+C  +  +H+    ++H D+K+ N+LI      ++CDFG            
Sbjct: 151 WEAKRLMIQLCGAVDWIHE--KNIVHADLKLSNILIDSSNNLQLCDFGH----------- 197

Query: 192 QELQYVQHDVMKNT-----TAQYRSPEMI---------DLVKGFPIERKIRHLGSWCVAL 237
               +V  D+  N+     T  Y SPE+I         DL   FP E  I  +G   + L
Sbjct: 198 ---SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY--FPKESDIWSIG---IVL 249

Query: 238 QIMLLH------YTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQ 291
             M+         T R   E  I+  +Y +      S+++K +++ +L   P++R  I +
Sbjct: 250 YAMIFDKTPFEATTLRSTYE-NIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVE 308

Query: 292 LLEE 295
           ++ +
Sbjct: 309 IVSD 312

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/337 (22%), Positives = 136/337 (40%), Gaps = 63/337 (18%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVD 74
           + +   + +I K L  GG + +Y VE    + +       LK+   P  S    + +   
Sbjct: 19  VSINGRKYRIQKLLGEGGLSFVYLVESKEGELFA------LKKTRCPFGS----IGSISP 68

Query: 75  AMKLLKNNR-----HVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE-- 127
           AMK + N +     ++   +DS   + +  +GS  V++L+ Y  +GSL D +N  L +  
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQEK--DGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 128 RLQEQEVLNIMNQVCQGIAAMHKLLP---------------------------------- 153
           ++ E ++L +   + +G+  +H+  P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 154 -PLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNP-QELQYVQHDVMKNTTAQYRS 211
               HRD+K  N++IS + L  + D GS C   R   N  Q L   Q     N T  Y +
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 212 PEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AILNGRYQYPAY 264
           PE++D+     I  K       C    +      F  + ++       AI  G+Y  P  
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 265 PIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQN 301
             YS  L  ++   LS +P +RP++ +L+  + ++Q 
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 118/262 (45%), Gaps = 29/262 (11%)

Query: 37  YSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKS 96
           Y V     +++T+  +A +K ++  N   LN +  E+  +K L N+ ++V Y        
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-------H 86

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
            F   SYE+++L+EYC  GSL   + ++    L E E    + Q   G+  +H     +I
Sbjct: 87  GFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           HRDIK  N+L+S D   K+ DFG V  I+    N   L           T  + +PE++ 
Sbjct: 144 HRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG 191

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQYPAYPIYSDRLKNV 274
             +G      I  LG+  V +      Y    D  +  A+ N  Y  P+   +S+ LK+ 
Sbjct: 192 -NRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSS--FSESLKDF 248

Query: 275 VRVLLSPHPVKRPNICQLLEEI 296
           +      +  KRP   QLL+ +
Sbjct: 249 LSKCFVKNMYKRPTADQLLKHV 270

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 107/239 (44%), Gaps = 28/239 (11%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY + G L D++ +K   +L E E ++   Q+ QG++  H     + 
Sbjct: 193 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSF--NIC 248

Query: 157 HRDIKIENVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMI 215
           HRD+K EN+L+   + + K+ DFG     +  P    E            +  Y SPE  
Sbjct: 249 HRDLKPENLLLDKKNKVIKIADFG--MAALELPNKLLETSC--------GSPHYASPE-- 296

Query: 216 DLVKGFPIERKIRHLGSWCVALQIMLL-HYTFREDREVAIL----NGRYQYPAYPIYSDR 270
            +V G P       + S  + L  +L  H  F +D    +L     GR+Q P Y   ++ 
Sbjct: 297 -IVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTND 353

Query: 271 LKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNIPCPIDNF-YLERSRHQGAVSVMPVN 326
            K+++  +L  +P KR  I ++L    I K +N P  I     L R +    + V+  N
Sbjct: 354 AKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYN 412

>TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.423
           YCR008W
          Length = 540

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 90/205 (43%), Gaps = 18/205 (8%)

Query: 98  FGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIH 157
           F +     F +MEYC  G L   + +    +L + E      Q+  G+  MH +   + H
Sbjct: 331 FADNEKNYFEVMEYCPGGDLFTLITSSENGKLTQIEADCFFKQILSGVNYMHDM--GVAH 388

Query: 158 RDIKIENVLISGDGLFKVCDFGSV-CGIIRPPRNPQELQYV----QHDVMKNTTAQYRSP 212
           RD+K EN+L++  G+ K+ DFGS  C  +    N     Y+    Q+   +  T +   P
Sbjct: 389 RDLKPENILLTATGIVKIIDFGSSECFRMAWETNVHYTDYICGSTQYIAPEEYTKEKFDP 448

Query: 213 EMIDLVKGFPIERKI---RHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSD 269
             +D+     I   +   RHL  W  A +   ++ TF  D  +   +G   +     +SD
Sbjct: 449 RAVDVWACGMIYMAMVIGRHL--WTTAQKSDEIYSTFLND--IKTEDG---FEPIENFSD 501

Query: 270 -RLKNVVRVLLSPHPVKRPNICQLL 293
              KNV+  +L P P +R    Q++
Sbjct: 502 VNCKNVIYSILEPSPSRRLTTKQIM 526

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 92/203 (45%), Gaps = 37/203 (18%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           E++L++EY + G L D++ +K   +L E E +    Q+ +G+   H     + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSF--NICHRDLKPE 289

Query: 164 NVLISGD-GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPEMI--DLV 218
           N+L+     L K+ DFG              LQ V + ++K +     Y SPE++     
Sbjct: 290 NLLLDKKRKLIKIADFGMAA-----------LQ-VSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 KGFPIERKIRHLGSWCVALQIMLL---HYTFREDR----EVAILNGRYQYPAYPIYSDRL 271
            G P +        W   + +  L   H  F +D      + + NGRYQ P Y   S   
Sbjct: 338 NGGPSD-------VWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDA 388

Query: 272 KNVVRVLLSPHPVKRPNICQLLE 294
           K+++  +L  +P  R    Q+LE
Sbjct: 389 KDLISRILLVNPKARLTTEQILE 411

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 73/143 (51%), Gaps = 12/143 (8%)

Query: 37  YSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKS 96
           Y V     +++T+  +A +K V+  N   LN +  E+  +K L N+ ++V Y        
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEVVYENDEELNDIMAEISLLKNL-NHNNIVKY-------H 86

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
            F   SYE+++L+EYC  GSL   + ++    L E E    + Q   G+  +H     +I
Sbjct: 87  GFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  N+L+S D   K+ DFG
Sbjct: 144 HRDIKAANILLSADNTVKLADFG 166

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 89/194 (45%), Gaps = 20/194 (10%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           ++ ++E+   G LL  +  +   RL E+    I +Q+   +  MH     +IHRD+K EN
Sbjct: 87  LYYVLEFVSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHA--KGVIHRDLKPEN 142

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIE 224
           VL+S +G   + DFG+ C        P         V    TA+Y SPE++ L       
Sbjct: 143 VLLSQEGRIVITDFGAACCASEGGSAPGAADRAASFV---GTAEYVSPELL-LHSQCSFG 198

Query: 225 RKIRHLGSWCVALQIMLLHYTFREDRE------VAILNGRYQYPAYPIYSDRLKNVVRVL 278
             +  LG  C+  Q+      FR D E      +  L+ R+ Y A P+    +  +V+ +
Sbjct: 199 SDVWALG--CIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVALVQSI 252

Query: 279 LSPHPVKRPNICQL 292
           L   P++RP+  QL
Sbjct: 253 LVLDPLQRPSAKQL 266

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 101/218 (46%), Gaps = 31/218 (14%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY + G L D++ +  R +L E+E ++   Q+ +G++  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVS--RGKLPEREAIHYFKQIVEGVSYCHSF--NIC 236

Query: 157 HRDIKIENVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPE 213
           HRD+K EN+L+   +   K+ DFG +  +  P +           ++K +     Y SPE
Sbjct: 237 HRDLKPENLLLDKKNKKIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPE 284

Query: 214 MIDLVKGFPIERKIRHLGSWCVALQIMLL-HYTFREDREVAIL----NGRYQYPAYPIYS 268
              +V G P       + S  + L  +L  H  F +D    +L    +G+YQ P     S
Sbjct: 285 ---IVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LS 339

Query: 269 DRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNIPC 304
              +N++  +L   P KR    ++LE   I K  N+P 
Sbjct: 340 LEARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV 377

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 95/205 (46%), Gaps = 35/205 (17%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           + +++EY   G    ++  K   RL+E    N+ +Q+  G+  MH     L+HRD+K+EN
Sbjct: 152 IGIVLEYASGGEFYKYIQKK--RRLKESVASNLFSQLVSGVYYMH--CKGLVHRDLKLEN 207

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ--YRSPEMIDLVKGFP 222
           +L+   G   + DFG V           E      ++MK +     Y +PE++  +   P
Sbjct: 208 LLLDKYGNLIITDFGFV----------NEFSKFS-ELMKTSCGSPCYAAPELV--ISTRP 254

Query: 223 IERKIRHLGSWCVALQIMLLHYTFRED-------REVAILNGRYQYPA-----YPIY-SD 269
            E +   + S  + L  ML  Y   +D        ++A L   Y+Y       +P Y S 
Sbjct: 255 YEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKL---YKYITTTPLKFPEYISP 311

Query: 270 RLKNVVRVLLSPHPVKRPNICQLLE 294
             ++++R +L P+P KR  + Q+L+
Sbjct: 312 MARDLLRNILIPYPQKRATLKQILK 336

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 42/229 (18%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY E G L D++    R +L EQE ++   Q+ QG++  H     + 
Sbjct: 131 EVWENKSELYLVLEYVEGGELFDYLIA--RGKLPEQEAIHYFKQIVQGVSYCHNF--NIC 186

Query: 157 HRDIKIENVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA-QYRSPEM 214
           HRD+K EN+L+   +   K+ DFG              L+     +  +  +  Y SPE+
Sbjct: 187 HRDLKPENLLLDKKNKTVKIADFGMAA-----------LETTNRLLETSCGSPHYASPEI 235

Query: 215 IDLVK--GFPIERKIRHLGSWCVALQIMLL---HYTFREDREVAIL----NGRYQYPAYP 265
           +   K  G P +        W   + +  L   H  F +D    +L    +GRYQ P+  
Sbjct: 236 VMGQKYHGSPSD-------VWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN- 287

Query: 266 IYSDRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQN-----IPCPID 307
             S   K+++  +L   P KR  + ++LE   + K  N     + CP++
Sbjct: 288 -VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPLE 335

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/273 (24%), Positives = 125/273 (45%), Gaps = 27/273 (9%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + +       +    +A L    +  +     L +E+   K +K+ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + +  V++L+E C  GSL++ +  K R++L E EV     Q+C  I 
Sbjct: 206 QFIDC------FEDDT-NVYILLEICPNGSLMELL--KKRKQLTEPEVRFFTTQICGAIK 256

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N +E ++         T
Sbjct: 257 YMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLA----NDRERKFTV-----CGT 305

Query: 207 AQYRSPE-MIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQYPA 263
             Y +PE ++    G   E  +  +G    AL +    +  ++   +   I    + +P 
Sbjct: 306 PNYIAPEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFIFPK 365

Query: 264 YPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
               S   K +V+ LLS  P++RP+I ++++ +
Sbjct: 366 EKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (57%), Gaps = 2/80 (2%)

Query: 100 NGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRD 159
           N  Y ++++MEYC  GS  D + T  RE L E +V  ++  V  G+  +H      IHRD
Sbjct: 82  NEDYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRD 139

Query: 160 IKIENVLISGDGLFKVCDFG 179
           IK  N+L++  GL KV DFG
Sbjct: 140 IKAANILLTDSGLVKVADFG 159

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 98/197 (49%), Gaps = 29/197 (14%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRE-RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           V++++EYC    L + +   L+E RL  +E   + +Q+   +   H+L    +HRD+K+E
Sbjct: 103 VWMVLEYCSGHELYEHL---LKEQRLSLEESKKLFSQIASAVYYAHEL--KCVHRDLKLE 157

Query: 164 NVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID--LVKGF 221
           NVL+ G+G  K+ DF    G  R      +L+ +        T  Y +PE+I+     GF
Sbjct: 158 NVLLDGNGHAKLTDF----GFTREMATRSQLETI------CGTTVYMAPELIERKCYDGF 207

Query: 222 PIERKIRHLGSWCVALQIMLLHYT-FREDREV----AILNGRYQYPAYPIYSDRLKNVVR 276
            ++  I  LG   + L  M+  Y  F ED ++     I+N    +    I  D + ++++
Sbjct: 208 KVD--IWSLG---IILYTMINGYMPFDEDDDIKTKLKIVNDELDFNQEWISDDAI-DLIQ 261

Query: 277 VLLSPHPVKRPNICQLL 293
            +L  +P +R ++ Q+L
Sbjct: 262 GMLRKNPNERISLAQVL 278

>KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.192
           YGR052W
          Length = 384

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 80/159 (50%), Gaps = 22/159 (13%)

Query: 28  LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLL-KNNRHVV 86
           + SG F+ +Y    S  ++Y         +VI   K     +  E   MKLL +N+ ++ 
Sbjct: 8   IQSGSFSTVYKAWSSTLEQYV------ALKVIPKKKYSSEGMDNEYKIMKLLGRNHPNIC 61

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE------RLQEQEVLNIMNQ 140
           S +D       + + SY V +++EYCE G L DF++   ++       L + +  N++NQ
Sbjct: 62  SMLDF------YEDDSYYV-VVLEYCECGDLYDFLDIAKKQGDPYSPALIQLDFRNLINQ 114

Query: 141 VCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           +   I   H L   + HRDIK EN+L++ DG  K+ D+G
Sbjct: 115 LFSAINYAHSL--GIAHRDIKPENILLTKDGNIKLADWG 151

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 94/204 (46%), Gaps = 39/204 (19%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           E++L++EY E G L D++ +  R +L EQE ++   Q+ QG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLIS--RGKLPEQEAVHYFKQIVQGVSYCHHF--NICHRDLKPE 196

Query: 164 NVLISGDGL-FKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA---QYRSPEMIDLVK 219
           N+L+    L  K+ DFG              L+    D +  T+     Y SPE++   K
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-----------LETT--DKLLETSCGSPHYASPEIVMGQK 243

Query: 220 --GFPIERKIRHLGSWCVALQIMLL---HYTFREDREVAIL----NGRYQYPAYPIYSDR 270
             G P +        W   + +  L   H  F +D    +L    +G+YQ P     S+ 
Sbjct: 244 YHGSPSD-------VWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNE 294

Query: 271 LKNVVRVLLSPHPVKRPNICQLLE 294
            K+++  +L   P  R  I ++LE
Sbjct: 295 AKDLIAKILIVDPAMRITIDEVLE 318

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 64/287 (22%), Positives = 118/287 (41%), Gaps = 63/287 (21%)

Query: 74  DAMKLLKNNRH-----VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE- 127
           +A+K + N R+     ++  +DS   +    +GS  V +L+ Y   GSL D ++  L + 
Sbjct: 103 NALKEIDNYRYFKSPYIMQCLDSQVIQRR--DGSKTVLILLPYLPLGSLRDAIDRNLLDG 160

Query: 128 -RLQEQEVLNIMNQVCQGI--------------------------------AAM------ 148
            R+ E EV+ +M   C+G+                                AAM      
Sbjct: 161 IRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTP 220

Query: 149 --------HKL-LPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQH 199
                   H + +    H +IK  N+L S DGL  + + GS+  +     N + L+ ++ 
Sbjct: 221 FEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKE 280

Query: 200 DVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV------- 252
              ++ T  Y  PE+++L  G  ++  +      C    ++     F+ + +V       
Sbjct: 281 WTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKY 340

Query: 253 AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKI 299
            I   RY +P   +YS +L +V+   L  +P  RP + +LL ++  I
Sbjct: 341 GISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQLQDI 387

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 67/273 (24%), Positives = 127/273 (46%), Gaps = 27/273 (9%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      +    +A   ++ + ++     L +E+   K +K+  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKHP-NIV 137

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            +ID       F + +  V++L+E C  GSL+D +  K R+ L E EV     Q+   I 
Sbjct: 138 QFIDC------FEDDT-NVYILLEICPNGSLMDLL--KKRKVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N +E +Y         T
Sbjct: 189 YMHN--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA----NDRERKYTV-----CGT 237

Query: 207 AQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQYPA 263
             Y +PE++     G   E  I  +G    AL I    +  +E   +   I +G Y +P 
Sbjct: 238 PNYIAPEVLAGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDYIFPR 297

Query: 264 YPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
               S  +  +++ +LS  P++RP++ ++++ +
Sbjct: 298 EKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 123/270 (45%), Gaps = 31/270 (11%)

Query: 37  YSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKS 96
           Y V     +++T+  +A +K ++  +   LN +  E+  +K L N+ ++V Y        
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-------H 86

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
            F   SYE+++L+EYC  GSL   + ++    L E E  + + Q   G+  +H     +I
Sbjct: 87  GFIRKSYELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           HRDIK  N+L+S D   K+ DFG V  I+    N   L           T  + +PE++ 
Sbjct: 144 HRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG 191

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQYPAYPIYSDRLKNV 274
             +G      I  LG+  V +      Y    D  +  A+ N  Y  P+   +S+ LK+ 
Sbjct: 192 -NRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSS--FSESLKDF 248

Query: 275 VRVLLSPHPVKRPNICQLLEE--ISKIQNI 302
           +      +  KRP   QLL+   I+  +N+
Sbjct: 249 LSKCFVKNMYKRPTADQLLKHAWITSTENV 278

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/305 (23%), Positives = 135/305 (44%), Gaps = 34/305 (11%)

Query: 10  PPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVL 69
           PP  +   G    + + +L  GGFA+ + ++      +    +A   ++ + ++     L
Sbjct: 62  PPSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKL 117

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERL 129
            +E+   K +K+  ++V + D       F + +  V++L+E C  GSL+D +  K R++L
Sbjct: 118 LSEIQIHKSMKHP-NIVQFTDC------FEDDT-NVYILLEICPNGSLMDLL--KQRKQL 167

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPR 189
            E EV     Q+   I  MH     +IHRD+K+ N+        K+ DFG    +     
Sbjct: 168 TEPEVRFFTTQIVGAIKYMHS--RRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA---- 221

Query: 190 NPQELQYVQHDVMKNTTAQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE 248
           N +E +Y         T  Y +PE++     G   E  I  +G    AL I    +   +
Sbjct: 222 NDRERKYT-----ICGTPNYIAPEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPF---Q 273

Query: 249 DREVAILNGR-----YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNIP 303
            +EV  +  R     + +P     S   K +++ +LS  P++RP++ +++E +      P
Sbjct: 274 AKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYVWFRNVFP 333

Query: 304 CPIDN 308
             I+ 
Sbjct: 334 ARING 338

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 130/289 (44%), Gaps = 37/289 (12%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      +    +A   ++ + ++     L +E+   ++ K+ RH  
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHFN 137

Query: 85  VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQG 144
           +V +ID       F + +  V++L+E C  GSL+D +  K R+ L E EV     Q+   
Sbjct: 138 IVQFIDC------FEDDT-NVYILLEICPNGSLMDLL--KRRKVLTEPEVRFFTTQIVGA 188

Query: 145 IAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKN 204
           +  MH     +IHRD+K+ N+        K+ DFG    +     N +E +Y        
Sbjct: 189 VKYMHS--RRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA----NDRERKYTV-----C 237

Query: 205 TTAQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILN-----GR 258
            T  Y +PE++     G   E  I   G   V +  +L+     + +EV I+      G 
Sbjct: 238 GTPNYIAPEVLTGKHTGHSYEVDIWSCG---VMIYALLIGKPPFQAKEVNIIYERIKCGD 294

Query: 259 YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNIPCPID 307
           Y +P     S     ++R +LS  P++RP++ ++++ +      P  ID
Sbjct: 295 YVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRID 343

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 88/189 (46%), Gaps = 23/189 (12%)

Query: 111  YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            + E GS+  F   +L+  + E E   I  QV  GI  +H+    ++HRDIK ENV++   
Sbjct: 1065 HGETGSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLHE--QGIVHRDIKDENVIVDSK 1122

Query: 171  GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
            G  K+ DFGS   +   P           DV   T   Y +PE++    G P E K + +
Sbjct: 1123 GFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---GGEPYEGKPQDI 1168

Query: 231  GSWCVALQIMLLHYTFREDREV---AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
              W V   I+L    F+E+       I+ G  ++      S+   N+++ +L+ +  KRP
Sbjct: 1169 --WAVG--ILLYTIVFKENPFYNIDEIMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRP 1224

Query: 288  NICQLLEEI 296
             I  + +++
Sbjct: 1225 TIQDIYDDV 1233

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 82/182 (45%), Gaps = 23/182 (12%)

Query: 111  YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            + E G +  F   +L+  + E EV  I  Q+  GI  +H     +IHRDIK ENV++   
Sbjct: 1268 HGETGCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLHD--QAIIHRDIKDENVIVDAT 1325

Query: 171  GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
            G  K+ DFGS   +   P           DV   T   Y +PE++    G P E K + +
Sbjct: 1326 GFVKLIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVL---SGDPYEGKPQDI 1371

Query: 231  GSWCVALQIMLLHYTFREDREV---AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
              W  A+ I+L    F+E+       IL G   +      S   K ++ ++L+ +  KRP
Sbjct: 1372 --W--AIGILLYTIVFKENPFYNIDEILEGELTFSESSDVSAECKALISMILNRNVQKRP 1427

Query: 288  NI 289
             I
Sbjct: 1428 TI 1429

>ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL025C
          Length = 578

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 7/79 (8%)

Query: 104 EVFLL-MEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKI 162
           E+FL+ MEYC      DF N  +  ++ + EV     Q+C+G+  +H     L HRD+K+
Sbjct: 336 ELFLVVMEYCP----YDFFNLVMSNQMTKHEVWCYFKQICRGVDYLHS--QGLAHRDLKL 389

Query: 163 ENVLISGDGLFKVCDFGSV 181
           +N +++ DG+ K+ DFGS 
Sbjct: 390 DNCVVTADGILKLIDFGSA 408

>KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {ON}
           Anc_1.149 YJL187C
          Length = 751

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/341 (21%), Positives = 143/341 (41%), Gaps = 72/341 (21%)

Query: 28  LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNK-SGLNVLRTEVDAMKLLKNNR--- 83
           L    F+ +Y V     DE T    A   + I PNK + L+ +  E+  +  +++++   
Sbjct: 421 LGQSQFSTVYQVTF---DE-TKKRYAV--KSITPNKHNSLHRILQEIGLLAEIRDSKLDE 474

Query: 84  ----HVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKL---RERLQEQEVLN 136
               +VV +I S   +S F       +++ +Y E G+L  F+  ++   + RL++  +  
Sbjct: 475 EGKEYVVDFITSWKFESSF-------YVMTDYYENGNLDKFLQEQVISKKARLEDWRIWK 527

Query: 137 IMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI-IRPP--RNPQE 193
           I+ ++C G+  +H+    ++H DIK  N++++ +G  K+ DFG    + +  P   N  +
Sbjct: 528 IIVEICLGLRFIHETCR-IVHLDIKPSNIMVTFEGNLKLGDFGMATHLPLEDPNFENEGD 586

Query: 194 LQYVQHDVMKNTTAQY------------------------------RSPEMIDLVKGFPI 223
            +Y+  +++   T  +                              RS ++ D  +    
Sbjct: 587 REYIAPEIISKCTYDFRADIFSLGLMIVEIAANVILPDNGNAWHKLRSGDLSDAGRLSST 646

Query: 224 ERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYP----IYSDRLKNVVRVLL 279
           +     L S    +   L   T  +D   +  N   + PA+     I  + L+ VV+ ++
Sbjct: 647 DIHSESLFSGATKIDTHLTELTIGKDDRNSRKNSISKIPAWVPRFLIDGESLERVVKWMI 706

Query: 280 SPHPVKRPNICQLLEEISKIQNIPCPIDNFYLERSRHQGAV 320
            P+  KRP    LL      Q   C     Y+ER+R  GA+
Sbjct: 707 DPNYRKRPTASDLL------QTEEC----LYVERTRKAGAI 737

>AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAR019C
           (CDC15)
          Length = 902

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 101/223 (45%), Gaps = 31/223 (13%)

Query: 76  MKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQE 133
           + LLKN +H  +V Y         F   S+E+++L+EYC RGSL D +    +E L E +
Sbjct: 65  IDLLKNLKHENIVKY-------HGFIQSSHELYILLEYCIRGSLRDLIK---KEALSEAK 114

Query: 134 VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQE 193
               + Q  +G+  +H     +IHRDIK  N+L++ +G+ K+ DFG     +    N   
Sbjct: 115 AKTYVRQTLRGLQYLHD--QGVIHRDIKAANLLLTENGVVKLADFG-----VSTRVNNMA 167

Query: 194 LQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM--LLHYTFREDRE 251
           + Y         +  + +PE++ L KG      I  LG+  V L       +    E   
Sbjct: 168 MTYA-------GSPNWMAPEVM-LGKGASTVSDIWSLGATVVELLTGNPPFYNLVNEAAC 219

Query: 252 VAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
            AI+N  Y  P +   S   K  + +    +  KRP   QLL+
Sbjct: 220 YAIVNDVYYPPEH--LSAECKAFMELCFQKNMFKRPQAHQLLQ 260

>Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W
           (REAL)
          Length = 369

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 95/199 (47%), Gaps = 38/199 (19%)

Query: 25  LKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPN-KSGLNVLRTEVDAMKLLKN-N 82
           L+ + SG F+ +Y    +  + Y       LK  I P  K+    ++ E D MK+L + N
Sbjct: 5   LRSIQSGTFSTVYKAWSTKHNRYV-----ALK--ITPKYKTSEASMKNEYDVMKMLSSCN 57

Query: 83  RH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE------RLQEQEV 134
            H  + S +D       + + SY V +++EYCE G L DF++    +       L + ++
Sbjct: 58  PHPNICSMLDF------YTDDSYYV-MVLEYCECGDLYDFLDIAKSQGTPSSPSLIQIDM 110

Query: 135 LNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQEL 194
             I+ Q+C  I+  H L   + HRDIK ENVL++ +G  K+ D+G              +
Sbjct: 111 QKIIKQLCSAISFAHSL--GIAHRDIKPENVLLTINGDIKLADWG------------HAI 156

Query: 195 QYVQHDVMKNTTAQYRSPE 213
           Q  + +  +  T  YR+PE
Sbjct: 157 QSSKSNDFQIGTDNYRAPE 175

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 66/114 (57%), Gaps = 15/114 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFM-----NTKL 125
           V+ + +++++RH  +V+++++     +      +++++MEY E GSL D +     N   
Sbjct: 700 VNEILVMQDSRHKNIVNFLEAYLKTED------DLWVVMEYMEGGSLTDIIENSPENVTN 753

Query: 126 RERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           +  L E ++  I+ + CQG+  +H+    +IHRDIK +NVL+   G  K+ DFG
Sbjct: 754 KSPLTEPQIAYIVRETCQGLKFLHERH--IIHRDIKSDNVLLDNQGRVKITDFG 805

>Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {ON}
            YCR073C (REAL)
          Length = 1334

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 85/166 (51%), Gaps = 27/166 (16%)

Query: 27   YLTSGGFAQIYSV------EISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLK 80
            ++  G F Q+YS       EI    E    +I  +K+ I P      +++ E+  +++L 
Sbjct: 1039 FIGGGTFGQVYSAINLENGEILAVKEIKMHDIKTMKK-IFP------LIKEEMTVLEML- 1090

Query: 81   NNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN- 139
            N+ +VV Y      + +       V + MEYCE GSL   ++   R R++++ V  +   
Sbjct: 1091 NHPNVVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLD---RGRIEDEMVTQVYTL 1140

Query: 140  QVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
            ++ +G+  +HK    ++HRDIK EN+L+  +G+ K  DFG+   ++
Sbjct: 1141 ELLEGLVYLHK--SGVVHRDIKPENILLDFNGIIKYVDFGTARTVV 1184

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 124/302 (41%), Gaps = 55/302 (18%)

Query: 13  FVIKVGSHQAK----------ILKYLTSGGFAQI---YSVEISPKDEYTNSNIACLKRVI 59
           F++  G H+ K          +   L  G F ++   +S   SP +      I  ++R  
Sbjct: 25  FMLNGGQHRQKRKHVTFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDT 84

Query: 60  VPNKSGLNV-LRTEVDAMKLLKNNRHVVSYIDSNAAKSE--FGNGSYEVFLLMEYCERGS 116
           +P  S   + +  E++A+K L +          N  K E    N  Y + +++EY   G 
Sbjct: 85  IPKNSDKEIKIYREINALKHLSH---------PNIVKLEEVLQNSKY-IGIVLEYASGGE 134

Query: 117 LLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVC 176
              ++  K   RL+E     +  Q+  G+  MH     L+HRD+K+EN+L+       + 
Sbjct: 135 FYKYIQKK--RRLKEAVACRLFAQLISGVQYMHS--KGLVHRDLKLENLLLDKHENLVIT 190

Query: 177 DFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ--YRSPEMIDLVKGFPIERKIRHLGSWC 234
           DFG V              +   ++MK +     Y +PE++  V   P E +   + S  
Sbjct: 191 DFGFVNEF-----------FAHSELMKTSCGSPCYAAPELV--VSSKPYEARKADIWSCG 237

Query: 235 VALQIMLLHYTFREDR----EVAILNGRYQYPA-----YPIYSDRL-KNVVRVLLSPHPV 284
           V L  ML  Y   +D     +   +   YQY       +P Y   L ++++R +L P P 
Sbjct: 238 VILYAMLAGYLPWDDDTKNPDGNDIGKLYQYITRTPLKFPEYITPLPRDLLRRILYPDPK 297

Query: 285 KR 286
           +R
Sbjct: 298 RR 299

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
           Anc_3.60 YNL298W
          Length = 883

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 15/142 (10%)

Query: 54  CLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCE 113
            +K++I+  +    ++  E+  MK  K+ +++V++I+S     +      +++++MEY E
Sbjct: 633 AIKQMILSKQPRKELIVNEIHVMKDSKH-KNIVNFIESYLKTED------DLWVVMEYME 685

Query: 114 RGSLLDFM-----NTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLIS 168
            GSL D +     N      L E ++  I+ + CQG+  +H     +IHRDIK +NVL+ 
Sbjct: 686 GGSLTDIIENSPTNGSTHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLD 743

Query: 169 GDGLFKVCDFGSVCGIIRPPRN 190
                K+ DFG  C  +   RN
Sbjct: 744 THARVKITDFG-FCAKLTDQRN 764

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 125/278 (44%), Gaps = 37/278 (13%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRH-- 84
           +L  GGFA+ + ++      +    +A   ++ + ++     L +E+   ++ K+ RH  
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEI---QIHKSMRHPN 131

Query: 85  VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQG 144
           +V + D     +        V++L+E C  GSL+D +  K R++L E EV     Q+   
Sbjct: 132 IVQFTDCFEDDTN-------VYILLEICPNGSLMDLL--KQRKQLTEPEVRFFTTQIVGA 182

Query: 145 IAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKN 204
           I  MH     +IHRD+K+ N+        K+ DFG    +     N +E +Y        
Sbjct: 183 IKYMHS--RRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA----NDRERKYT-----IC 231

Query: 205 TTAQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR----- 258
            T  Y +PE++     G   E  +  +G    AL I    +   + +EV  +  R     
Sbjct: 232 GTPNYIAPEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPF---QAKEVNTIYERIKVCD 288

Query: 259 YQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           + +P     S   K +++ +LS  P++RP++ +++E +
Sbjct: 289 FNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {ON}
           Anc_3.60 YNL298W
          Length = 885

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 65/114 (57%), Gaps = 15/114 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFM-----NTKL 125
           V+ + ++K++RH  +V+++++     +      +++++MEY E GSL D +     +  +
Sbjct: 651 VNEILVMKDSRHKNIVNFLEAYLKTED------DLWVVMEYMEGGSLTDIIENSPADESI 704

Query: 126 RERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
              L E ++  I+ + CQG+  +H     +IHRDIK +NVL+   G  K+ DFG
Sbjct: 705 NSPLTESQIAYIVRETCQGLKFLHDRH--IIHRDIKSDNVLLDTQGRVKITDFG 756

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 107/234 (45%), Gaps = 31/234 (13%)

Query: 66   LNVLRTEVDAMKLLK--NNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNT 123
            L  + +E+  M  L   +N++++S +D       F +  Y       + + G +  F   
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDF------FEDDDYYYVEQPVHGKTGCIDLFDLI 1102

Query: 124  KLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCG 183
            + +  + E E   I  Q+  GI+ +H+    ++HRDIK ENV++   G  K+ DFGS   
Sbjct: 1103 EFKTNMTEFEAKLIFKQIISGISHLHE--SGIVHRDIKDENVIVDAKGFVKLIDFGSAAY 1160

Query: 184  IIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLH 243
            +   P           DV   T   Y SPE++   +G   E K + +  W  AL I+L  
Sbjct: 1161 VKNGP----------FDVFVGTI-DYASPEVL---RGEKYEGKPQDI--W--ALGILLYT 1202

Query: 244  YTFRED---REVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
              F+E+       IL G  ++P     S    ++++++L+   ++RP+I  + E
Sbjct: 1203 IVFKENPFYNIDEILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 483

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 4/79 (5%)

Query: 101 GSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDI 160
           G   ++++MEYC  GSLL+ +  +   RL EQ    I+ QVC  +  +H+    LIHRD+
Sbjct: 85  GDCNLYIVMEYCSNGSLLNLL--RYYSRLTEQTTCFIILQVCHALEYLHE--KRLIHRDL 140

Query: 161 KIENVLISGDGLFKVCDFG 179
           K  N+L++ DG  ++ D G
Sbjct: 141 KAANILLNDDGEVRLADLG 159

>YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putative
           protein of unknown function; the authentic, non-tagged
           protein is detected in highly purified mitochondria in
           high-throughput studies; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 369

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 95/199 (47%), Gaps = 38/199 (19%)

Query: 25  LKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPN-KSGLNVLRTEVDAMKLLKN-N 82
           L+ + SG F+ +Y    +  + Y       LK  I P  K+    ++ E D MK+L + N
Sbjct: 5   LRSIQSGTFSTVYKAWSTTHNRY-----VALK--ITPKYKTSEANMKNEYDVMKILSSCN 57

Query: 83  RH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE------RLQEQEV 134
            H  + S +D       + + SY + +++EYCE G L DF++    +       L + ++
Sbjct: 58  PHPNICSMLDF------YTDDSYYI-MVLEYCECGDLYDFLDIAKSQGSPSSPSLIQIDM 110

Query: 135 LNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQEL 194
             I+ Q+C  I+  H L   + HRDIK EN+L++ +G  K+ D+G    I  P  N  ++
Sbjct: 111 QKIIKQLCSAISFAHSL--GIAHRDIKPENILLTINGDIKLADWGH--AIQSPKSNDFQI 166

Query: 195 QYVQHDVMKNTTAQYRSPE 213
                      T  YR+PE
Sbjct: 167 ----------GTDNYRAPE 175

>KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6.341
            YNR031C
          Length = 1594

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 83/165 (50%), Gaps = 23/165 (13%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F  ++S          N  I  +K + +P+ + +     +++ E+  +++L N+
Sbjct: 1273 FVGGGTFGTVFSAI-----NLDNGEILAVKEIKIPDSNAMKKVFPLIKEEMTVLEML-NH 1326

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             +VV Y      + +       V + MEYCE GSL   +      R++++ V  +   ++
Sbjct: 1327 PNVVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLE---HGRIEDEMVTQVYTLEL 1376

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIR 186
             +G+A +H+    ++HRDIK EN+L+  +G+ K  DFG+   I R
Sbjct: 1377 LEGLAYLHQ--SGVVHRDIKPENILLDFNGIIKYVDFGTAKKIAR 1419

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 64/123 (52%), Gaps = 26/123 (21%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLR-ERLQEQEVLNIMNQVCQGIAAMHKLLPPL 155
           GSY    +++++MEYC  GSL     T LR  ++ E+ +  IM ++   +  +HK    +
Sbjct: 90  GSYLYDTKLWIIMEYCAGGSL----RTLLRPGKIDEKYIGVIMRELLVALLYIHK--DNV 143

Query: 156 IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ---YRSP 212
           IHRDIK  NVLI+ DG  K+CDFG               Q  Q +V + T A    + +P
Sbjct: 144 IHRDIKAANVLITNDGRVKLCDFGVAA------------QLTQSNVRRQTMAGTPYWMAP 191

Query: 213 EMI 215
           E+I
Sbjct: 192 EVI 194

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 81/163 (49%), Gaps = 17/163 (10%)

Query: 17  VGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAM 76
           V   Q  ++  +  G F  +Y       +  TN  IA +K+V   N   LN + +E++ +
Sbjct: 74  VTKAQYGLINVIGKGSFGVVYKA----VNRQTNQVIA-IKQVNYDNDEELNDIMSEINLL 128

Query: 77  KLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLN 136
           K L N++H+V Y         F   S  +++L+EYC  GSL + +++   + + E++   
Sbjct: 129 KNL-NHKHIVKY-------HGFMQKSDTLYILLEYCAHGSLKNLISSS--KGIPEKDAQQ 178

Query: 137 IMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
            + Q   G+  +H     +IHRDIK  N+L+  D   K+ DFG
Sbjct: 179 YIIQTLYGLVYLHA--QGVIHRDIKAANILLDKDNTVKLADFG 219

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 132/290 (45%), Gaps = 58/290 (20%)

Query: 24  ILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVI----------VPNKSGLNVLRTEV 73
           +L+ +  GGFA++ S+ ++ +D+Y    +  +K+V             NK G N+ R E+
Sbjct: 672 VLQDMGEGGFAKV-SLCLNKEDKY----VVVIKKVFKEKVLEETWTSDNKFG-NIPR-EI 724

Query: 74  DAMKLLKN--NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGS--LLDFMNTKLRERL 129
             M  L    N++ +  +D       F + ++     + +  +GS  L DF+  K  +++
Sbjct: 725 QIMSTLHKYPNKNTLRMLDF------FEDENFYYIETLVHSMKGSIDLFDFIEKK--DKI 776

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPR 189
            E E   I  Q+  GI  +H L   +IHRDIK EN++I  +G  +V DFGS       P 
Sbjct: 777 DEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVIDFGSAAYATNGPF 834

Query: 190 NPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE- 248
                  V H      T  Y SPE++   KG P E K + +  W  AL I+L   TF++ 
Sbjct: 835 Q------VFH-----GTIDYASPEVL---KGEPYEGKPQDV--W--ALGILLYIITFKQT 876

Query: 249 --DREVAILNGRYQYPAYPIYSDRLKNVVRVL----LSPHPVKRPNICQL 292
             +    I+    +    P +S+ + +  RVL    L      RP I ++
Sbjct: 877 PFNSVAEIIENELEID--PAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 125/288 (43%), Gaps = 48/288 (16%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVI-VPNKSGLNVLRTE 72
           ++ +G++  KI+K +  G F ++Y           N  +   K V+   NK+  NV+R E
Sbjct: 31  LVDIGNY--KIVKLIGEGSFGKVY---------LANHRLTHQKVVLKTGNKNDPNVVR-E 78

Query: 73  VDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQ 132
           V   +   +  H+    +    +S+       V++ +EYC    L +++   ++ R+  +
Sbjct: 79  VFYHRQF-DFPHITKLYEVIVTESK-------VWMALEYCPGKELYEYL--LMQHRISLE 128

Query: 133 EVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQ 192
           E   +  Q+   +   H L    +HRD+K+EN+L+   G  K+ DF    G  R      
Sbjct: 129 ESGKLFAQIVSAVYYAHSL--QCVHRDLKLENILLDKKGRAKITDF----GFTRECATKT 182

Query: 193 ELQYVQHDVMKNTTAQYRSPEMIDL--VKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
            L+ V        T  Y +PE+I+     GF I+  I  LG   V L  M +H T   D 
Sbjct: 183 MLETVC------GTTVYMAPELIERKSYDGFKID--IWSLG---VILYTM-IHGTMPFDE 230

Query: 251 EVAILNGRYQYPAYPIYSDRL-----KNVVRVLLSPHPVKRPNICQLL 293
           E             P Y+D +     K+++  LL   P +RP + Q+L
Sbjct: 231 EDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {ON}
           Anc_8.140 YGL179C
          Length = 870

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 27/171 (15%)

Query: 18  GSH-QAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAM 76
           G H + K+ K + +  F  +  V+   K ++ N      K++I  +K     ++ E+  M
Sbjct: 172 GQHGKVKLAKDINTEEFVAVKIVDRHEKRKFPN----FFKKIIENDK-----IKKEIAIM 222

Query: 77  KLLKNNRHVVSYIDS-NAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER------- 128
           K L N++HVV  I+  +  KS       +++L++EYC RG +  + ++K  E        
Sbjct: 223 KKL-NHKHVVRLIEVLDDLKSR------KIYLVLEYCLRGEIKWYNDSKCMEMDAKGPPI 275

Query: 129 LQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           L  Q +  I+  V  G+  +H     +IHRDIK  N+LIS DG  K+ DFG
Sbjct: 276 LDFQHIRKIIRGVVLGLEYLH--YQGIIHRDIKPANLLISEDGTVKISDFG 324

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/320 (21%), Positives = 133/320 (41%), Gaps = 40/320 (12%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEV 73
           +I+ G    K  + +  G ++ +  +  + KD      +  L +  +  +  +  +  E 
Sbjct: 174 IIRKGIKDFKFGEMVGDGAYSTV--MLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEK 231

Query: 74  DAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQE 133
           +A++ L N+R +V    +   +S        ++ L+EY   G  L  M  K    L E  
Sbjct: 232 NALQRLNNSRGIVKLFFTFQDESS-------LYFLLEYAPNGDFLSVM--KKYGSLSEDC 282

Query: 134 VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQ- 192
                 Q+  GI  +H     +IHRDIK EN+L+  D   K+ DFG+   I+ P    + 
Sbjct: 283 TRYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGT-AKILEPKNEDED 339

Query: 193 --ELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
             E   +        TA+Y SPE+++      ++ +       C+  Q++     F+   
Sbjct: 340 NPEFNLLTRSKSFVGTAEYVSPELLN---DSYVDARCDIWAFGCMVFQMIAGKPPFKATN 396

Query: 251 EV----AILNGRYQYPA-YPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNIPCP 305
           E      ++  +Y + A +P+    ++++V+ +L   P +R  I Q+ +           
Sbjct: 397 EYLTFQKVMKVQYAFTAGFPVV---VRDLVKRILLKVPEQRLTIPQIEKH---------- 443

Query: 306 IDNFYLERSRHQGAVSVMPV 325
             +FY + S   G+V   P 
Sbjct: 444 --HFYKDISFEDGSVWTAPA 461

>YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Member
           of the PAK family of serine/threonine protein kinases
           with similarity to Ste20p and Cla4p; involved in
           down-regulation of sterol uptake; proposed to be a
           downstream effector of Cdc42p during polarized growth
          Length = 655

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRER-------LQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E++++MEY E G L D ++   R         L E ++  I+ + CQG+  +H     +I
Sbjct: 447 ELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHN--KKII 504

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK +N+L++  GL K+ DFG
Sbjct: 505 HRDIKSDNILLNSQGLVKITDFG 527

>TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1038

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 120/274 (43%), Gaps = 53/274 (19%)

Query: 69  LRTEVDAMKLLKNNRHVVSYIDS-NAAKSEFGNGSYEVFLLMEYCERGSLL----DFMNT 123
           ++ E++ MK   NN H+V  ++  +  KS+      +++L++EYC RG +     D M T
Sbjct: 193 IKREINIMKRC-NNEHIVKLLEVLDDLKSK------KIYLILEYCSRGEVKWCPGDVMET 245

Query: 124 KLRE--RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG-S 180
           + R    L  Q V  I+  V  G+  +H     +IHRDIK  N+L+S DG  K+ DFG S
Sbjct: 246 EARGPPLLSFQRVRKILRDVTLGLEYLHSR--GIIHRDIKPANLLLSEDGSVKISDFGVS 303

Query: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEM---------IDLVKGFPIERKIRHL- 230
           V    +       +  ++      T A + +PE+          +L K    + K+ ++ 
Sbjct: 304 VISHNKEENGTNSIDELELAKTAGTPA-FFAPEICLGSEAKSKFNLKKDPSKDSKLIYMV 362

Query: 231 GSWCVALQIMLLHYT---FREDREV----AILNGRYQYPAYPIYS-------------DR 270
             W +   +  L +    F  D E+     I+N    +P Y I               + 
Sbjct: 363 DVWALGTTLYCLLFGMLPFISDYELKLFEKIVNDPLIFPDYEIMQKNGTSNIFSEEEYEA 422

Query: 271 LKNVVRVLLSPHPVKRPNICQLLEEISKIQNIPC 304
            KN+++ LL+ +P KR +I  +     KI    C
Sbjct: 423 AKNILKELLTKNPAKRMSIKDI-----KIHRFTC 451

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 3/82 (3%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           ++++MEYC  GS  D +     E L E +V  I   V +G+  +H+     IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE--QRKIHRDVKAAN 149

Query: 165 VLISGDGLFKVCDFGSVCGIIR 186
           VL++ DGL K+ DFG V G +R
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLR 170

>KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.341
            YNR031C
          Length = 1656

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 80/161 (49%), Gaps = 23/161 (14%)

Query: 26   KYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVL----RTEVDAMKLLKN 81
            KY+  G F  +YS          N +I  +K + + +   +  +    + E+  M++L N
Sbjct: 1362 KYVGGGTFGSVYSAV-----NLDNGDILAVKEIKIQDSKAMEKIFPSVKEEMSVMEML-N 1415

Query: 82   NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-Q 140
            + +++ Y      + +       V + MEYCE GSL   +      R++++ V  +   +
Sbjct: 1416 HPNIIQYYGVEVHRDK-------VNIFMEYCEGGSLASLLE---HGRIEDEMVTQVYTLE 1465

Query: 141  VCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSV 181
            + +G+A +H+    ++HRDIK EN+L+  +G+ K  DFG+ 
Sbjct: 1466 LLEGLAYLHE--SGIVHRDIKPENILLDFNGIIKYVDFGAA 1504

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 100/218 (45%), Gaps = 31/218 (14%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY + G L D++ +K   +L E+E ++   Q+ +G++  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSF--NIC 236

Query: 157 HRDIKIENVLISGDGL-FKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPE 213
           HRD+K EN+L+       K+ DFG +  +  P           + ++K +     Y SPE
Sbjct: 237 HRDLKPENLLLDKKNRKIKIADFG-MAALELP-----------NKLLKTSCGSPHYASPE 284

Query: 214 MIDLVKGFPIERKIRHLGSWCVALQIMLL-HYTFREDREVAIL----NGRYQYPAYPIYS 268
              +V G P       + S  + L  +L  H  F +D    +L    +G+YQ P     S
Sbjct: 285 ---IVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LS 339

Query: 269 DRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNIPC 304
              ++++  +L  +P KR    ++L    I K  N+P 
Sbjct: 340 AEARDLISKILVINPEKRITTQEILNHPLIKKYDNLPI 377

>Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)
          Length = 614

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 92/204 (45%), Gaps = 18/204 (8%)

Query: 98  FGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIH 157
           F +   E   +MEYC  G L   +      +L+  E      Q+ +G+  MH++   + H
Sbjct: 403 FQDAKGEYCEVMEYCAGGDLFTLVIAA--GKLEYMEADCFFKQLIRGVVYMHEM--GVCH 458

Query: 158 RDIKIENVLISGDGLFKVCDFG-SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           RD+K EN+L++ DG+ K+ DFG S C  +   +N      +        ++ Y +PE   
Sbjct: 459 RDLKPENLLLTHDGMLKITDFGNSECFKMAWEKN------IHLSGGVCGSSPYIAPEEYI 512

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILN---GRYQYPAY-PIYS---D 269
             +  P    I   G   +A++     ++  E  +   LN   GR +   Y PI S    
Sbjct: 513 KAEFDPRPVDIWACGVIYMAMRTGRQLWSSAEKDDPFYLNYLKGRKEKGGYEPIESLKRA 572

Query: 270 RLKNVVRVLLSPHPVKRPNICQLL 293
           R +NV+  +L P P +R N  Q+L
Sbjct: 573 RCRNVIYSMLDPVPYRRINGKQIL 596

>SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weakly
           similar to uniprot|P47116 Saccharomyces cerevisiae
           YJR059W PTK2 Putative serine/threonine protein kinase
           involved in regulation of ion transport across plasma
           membrane enhances spermine uptake
          Length = 818

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 107 LLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVL 166
            +MEYC  G L   +     +R   +E   +  QV QG+  MH     ++HRDIK ENVL
Sbjct: 371 FVMEYCPGGDLHSLITRTGWKRSPLKERFCLFKQVTQGLRFMHNQ--GVVHRDIKPENVL 428

Query: 167 ISGDGLFKVCDFG 179
           IS DG+ K+ DFG
Sbjct: 429 ISKDGIAKLTDFG 441

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 86/197 (43%), Gaps = 27/197 (13%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           +V++ +EYC    L D + +K   RL   E   +  Q+   +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTL--NCVHRDLKLE 162

Query: 164 NVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDL--VKGF 221
           NVL+  +G  K+ DF    G  R       L+ V        T  Y +PEMI      GF
Sbjct: 163 NVLLDKNGNAKLTDF----GFTRESMTKAVLETVCG------TTVYMAPEMIQHKPYDGF 212

Query: 222 PIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRL-----KNVVR 276
            ++  I  LG     L    L +    D +  +L  +      P+  +R+     +N++ 
Sbjct: 213 KVD--IWSLGVILYTLLCGCLPF----DEDDDLLTKQKIINDTPVIDERITIPEAQNLIE 266

Query: 277 VLLSPHPVKRPNICQLL 293
            LLS  P +RPN   +L
Sbjct: 267 QLLSKDPTERPNTSAIL 283

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 94/203 (46%), Gaps = 39/203 (19%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           E++L++EY + G L D++ +  R RL E+E ++   Q+ QG++  H     + HRD+K E
Sbjct: 190 ELYLVLEYVDGGELFDYLVS--RGRLCEREAVHYFKQIIQGVSYCHAF--NICHRDLKPE 245

Query: 164 NVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPEMIDLVKG 220
           N+L+   +   K+ DFG                 V + +++ +     Y SPE   +V G
Sbjct: 246 NLLLDKKNSTIKIADFGMAA------------LEVSNKLLQTSCGSPHYASPE---IVMG 290

Query: 221 FPIERKIRHLG---SWCVALQIMLL---HYTFREDREVAIL----NGRYQYPAYPIYSDR 270
                K  H G    W   + +  L   H  F +D    +L    +G+YQ P     S  
Sbjct: 291 -----KQYHGGPSDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN--LSKE 343

Query: 271 LKNVVRVLLSPHPVKRPNICQLL 293
            ++++  +L+ +P KR    ++L
Sbjct: 344 AQDLIAKILTVNPAKRLTTEEIL 366

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 83/156 (53%), Gaps = 22/156 (14%)

Query: 30  SGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYI 89
           SGG    Y +        TN+++A +K++ +  +    ++  E+  MK  ++N ++V++I
Sbjct: 694 SGGVYTAYEIG-------TNASVA-IKQMNLEKQPKKELIINEILVMKGSRHN-NIVNFI 744

Query: 90  DSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMH 149
           DS   K +       ++++MEY E GSL D +   +   L E ++  +  +  +G+  +H
Sbjct: 745 DSYLLKGD-------LWVIMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFLH 794

Query: 150 KLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                +IHRDIK +N+L+S DG  K+ DFG  C  I
Sbjct: 795 S--KGVIHRDIKSDNILLSMDGNIKLTDFG-FCAQI 827

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 64/115 (55%), Gaps = 15/115 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
           ++ + ++K +RH  +V++IDS   K +        +++MEY E GSL D +   +   L 
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKGDL-------WVVMEYMEGGSLTDVVTHCI---LT 770

Query: 131 EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
           E ++  +  +   G+A +H     +IHRDIK +N+L+S +G  K+ DFG  C  I
Sbjct: 771 EGQIGTVCKETLGGLAFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFG-FCAQI 822

>TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON} 
          Length = 616

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 96/192 (50%), Gaps = 17/192 (8%)

Query: 105 VFLLMEYCERGSL--LDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKI 162
           ++L+ EY E   L  + F +   +  + ++ + +IM Q+  G++ +H+    ++HRD+K 
Sbjct: 286 IYLVYEYAEHDLLQIIHFHSHPEKRMIPQRMIRSIMWQILDGVSYLHQNW--ILHRDLKP 343

Query: 163 ENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFP 222
            N++++  G+ KV D     G+ R   N  +  Y    V+   T  YR+PE++   K + 
Sbjct: 344 ANIMVTSSGVVKVGDL----GLARKFHNMVQTLYTVDKVV--VTIWYRAPELMLGAKHYM 397

Query: 223 IERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPH 282
               +  +G  C+  +++ L   F+   E A ++ +      P  +++L+ ++ VL +P 
Sbjct: 398 PAIDLWAVG--CIFAELIGLQPIFKG--EEAKMDSK---KTVPFQANQLQKIIEVLGTPS 450

Query: 283 PVKRPNICQLLE 294
           P   PNI Q  E
Sbjct: 451 PKNWPNIEQYPE 462

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 102/218 (46%), Gaps = 31/218 (14%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY + G L D++ +K   +L E+E ++   Q+ +G++  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSF--NIC 236

Query: 157 HRDIKIENVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPE 213
           HRD+K EN+L+   +   K+ DFG +  +  P +           ++K +     Y SPE
Sbjct: 237 HRDLKPENLLLDKKNRRIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPE 284

Query: 214 MIDLVKGFPIERKIRHLGSWCVALQIMLL-HYTFREDREVAIL----NGRYQYPAYPIYS 268
              +V G P       + S  + L  +L  H  F +D    +L    +G+YQ P+    S
Sbjct: 285 ---IVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN--LS 339

Query: 269 DRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNIPC 304
              ++++  +L   P KR    ++L+   I K  ++P 
Sbjct: 340 SEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPV 377

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 89/202 (44%), Gaps = 24/202 (11%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +      ++ E+ +  IM ++   +  +HK    +I
Sbjct: 99  GSYLKNTSLWIIMEYCGGGSLRSLLRPG---KIDEKYIGVIMREILIALKYIHK--DNVI 153

Query: 157 HRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           HRDIK  NVLI+ DG  K+CDFG    + +     Q +           T  + +PE+I 
Sbjct: 154 HRDIKAANVLINNDGSIKLCDFGVAAQLNQTKSRRQTMA---------GTPYWMAPEVI- 203

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLH--YTFREDREVAILNGRYQYPAYPI--YSDRLK 272
            ++G   + K     +   A ++   +  Y   E      L  + + P      YS  +K
Sbjct: 204 -MEGVYYDTKADIWSTGITAYEVTTGNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIK 262

Query: 273 NVVRVLLSPHPVKRPNICQLLE 294
             +   L   P +RP   +LL+
Sbjct: 263 EFIATCLDEDPSERPTADELLK 284

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 128/287 (44%), Gaps = 33/287 (11%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      +    +A   ++ + ++     L +E+   K +++  ++V
Sbjct: 84  FLGEGGFARCFQIKDDGGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHT-NIV 139

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            ++D       F + +  V++L+E C  GSL+D +  K R+ L E EV     Q+   + 
Sbjct: 140 QFVDC------FEDDT-NVYILLEICPNGSLMDLL--KRRKMLTEPEVRFFTTQIVGAVK 190

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+        KV DFG    +     N +E +Y         T
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLA----NDRERKYTV-----CGT 239

Query: 207 AQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILN-----GRYQ 260
             Y +PE++     G   E  I   G    AL I    +   + +EV I+      G + 
Sbjct: 240 PNYIAPEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPF---QAKEVNIIYERIKCGDFV 296

Query: 261 YPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNIPCPID 307
           +P     S     +++ +LS  P++RP++ ++++ +      P  ID
Sbjct: 297 FPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRID 343

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 88/190 (46%), Gaps = 14/190 (7%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           ++ ++EY   G LL  +  +   RL E    +I  Q+   +  MH     +IHRD+K EN
Sbjct: 87  LYFVLEYVSGGELLALI--QRLGRLTEDLSRHITAQLVDTVDYMHS--KGVIHRDLKPEN 142

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIE 224
           VL+S +G   + DFG+ C         ++ +  +       TA+Y SPE++ L       
Sbjct: 143 VLLSQEGRVVITDFGAACTAA-----DRKFENTKRTASFVGTAEYVSPELL-LHSQCGFS 196

Query: 225 RKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSD--RLKNVVRVLLSPH 282
             I  LG  C+  Q+      FR + E+             ++S+  ++ ++V+ +L   
Sbjct: 197 SDIWALG--CIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIVQSILVTD 254

Query: 283 PVKRPNICQL 292
           P+KRP+  QL
Sbjct: 255 PLKRPSAAQL 264

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 92/210 (43%), Gaps = 53/210 (25%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           +V++++EYC    L D++ +K  +R+   E   I  Q+   +   H L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLE 159

Query: 164 NVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNT-------TAQYRSPEMID 216
           N+L+  D   K+ DFG                    D  KNT       T  Y +PE++ 
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPELLR 202

Query: 217 LVK--GFPIERKIRHLGSWCVALQIMLLHYT-------FREDR----EVAILNGRYQYPA 263
             K  G+ I+        W  AL I+L  YT       F ED     E+ I++    Y  
Sbjct: 203 REKYDGYKID-------IW--ALGILL--YTIINGTMPFDEDDPKKTELKIISASPDYDN 251

Query: 264 YPIYSDRLKNVVRVLLSPHPVKRPNICQLL 293
              ++D   ++V  LLS  P  RP I Q+L
Sbjct: 252 -KYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 123/285 (43%), Gaps = 44/285 (15%)

Query: 24   ILKYLTSGGFAQIYSVEISPKDEYTNSNIACLK-----RVIVPN---KSGLNVLRTEVDA 75
            IL+ +  G + ++ ++ I  K++Y    I C+K     R++V        L  + +E+  
Sbjct: 1153 ILQKMGEGAYGKV-NLCIHKKEKY----IVCIKMIFKERILVDTWVRDRKLGTIPSEIQI 1207

Query: 76   MKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQE 133
            M  L    H  ++  +D       F + +Y       + E G +  F   + +  + E E
Sbjct: 1208 MATLNKKPHENILRLLDF------FEDDNYYYIETPIHGETGCIDLFDLIEFKTNMTEFE 1261

Query: 134  VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQE 193
               I  QV  GI  +H     ++HRDIK ENV++   GL K+ DFGS   +   P     
Sbjct: 1262 AKLIFKQVVSGIKHLHH--QGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGP----- 1314

Query: 194  LQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFRED---R 250
                  DV   T   Y +PE++    G P E K + +  W  AL I+L    F+E+    
Sbjct: 1315 -----FDVFVGTI-DYAAPEVL---SGEPYEGKPQDI--W--ALGILLYTIVFKENPFYN 1361

Query: 251  EVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295
               IL G  ++ +    ++    +++ +L      RP I ++ ++
Sbjct: 1362 IDEILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFDD 1406

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 73/134 (54%), Gaps = 14/134 (10%)

Query: 51  NIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLME 110
           N   +K++I+  +    ++  E+  MK  K+N ++V+++++     +      +++++ME
Sbjct: 626 NKVAIKQMILSKQPRKELIVNEILVMKDSKHN-NIVNFLEAYLKTED------DLWVVME 678

Query: 111 YCERGSLLDFM-----NTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENV 165
           Y E GSL D +      +  +  L E ++  I+ + CQG+  +H     +IHRDIK +NV
Sbjct: 679 YMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNV 736

Query: 166 LISGDGLFKVCDFG 179
           L+   G  K+ DFG
Sbjct: 737 LLDTRGRVKITDFG 750

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
           similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 83/156 (53%), Gaps = 22/156 (14%)

Query: 30  SGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYI 89
           SGG    Y +        TN+++A +K++ +  +    ++  E+  MK  K+ +++V++I
Sbjct: 847 SGGVYTAYEIG-------TNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-KNIVNFI 897

Query: 90  DSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMH 149
           DS   K +       ++++MEY E GSL D +   +   L E ++  +  +  +G+  +H
Sbjct: 898 DSYLLKGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIAAVSRETLRGLHFLH 947

Query: 150 KLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                +IHRDIK +N+L+S DG  K+ DFG  C  I
Sbjct: 948 S--KGVIHRDIKSDNILLSMDGNIKLTDFG-FCAQI 980

>KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]
           {ON} similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 868

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 17/110 (15%)

Query: 72  EVDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERL 129
           E+D   LLKN +H  +V Y         F   S+++F+L+EYC +GSL D +    R  +
Sbjct: 68  EID---LLKNLKHENIVKY-------HGFIQKSHQLFILLEYCSQGSLRDLIK---RGPV 114

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
            EQE    + Q   G+  +H+    +IHRDIK  N+L+  + + K+ DFG
Sbjct: 115 DEQECKTYIRQTLHGLKYLHE--QGVIHRDIKAANLLLDAENVVKLADFG 162

>KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa]
           {ON} Anc_3.60 YNL298W
          Length = 829

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 35/190 (18%)

Query: 23  KILKYLTSGGFAQIYSVEI--SPKDEYTNSNIA--------------CLKRVIVPNKSGL 66
           K+++    G    +Y  E   SP  EY N ++                +K++I+  +   
Sbjct: 532 KMIEKAGQGASGSVYLAERLESPPSEYQNDHVVSIENNEPQAIGDKVAIKQMILSKQPRK 591

Query: 67  NVLRTEVDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFM--- 121
            ++  E+  MK   N+RH  +V+++++     +      +++++ME+ E GSL D +   
Sbjct: 592 ELIVNEILVMK---NSRHKNIVNFLEAYLKTED------DLWVVMEFMEGGSLTDIIENS 642

Query: 122 --NTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
             N      L E ++  I+ + CQG+  +H     +IHRDIK +NVL+      K+ DFG
Sbjct: 643 PTNGSNHSPLTEPQIAYIVRETCQGLKFLHD--KHIIHRDIKSDNVLLDTRARVKITDFG 700

Query: 180 SVCGIIRPPR 189
             C  +   R
Sbjct: 701 -FCAKLTDKR 709

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 66/115 (57%), Gaps = 15/115 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
           V+ + ++K +RH  +V++IDS      F NG+  ++++MEY + GSL D +   +   L 
Sbjct: 608 VNEILVMKASRHENIVNFIDS-----YFLNGN--LWVIMEYMKGGSLTDVVTHCI---LT 657

Query: 131 EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
           EQ++  +  +   G+  +H     +IHRDIK +NVL+S  G  K+ DFG  C  I
Sbjct: 658 EQQISTVTRETLNGLRFLHS--KGVIHRDIKSDNVLLSLSGDIKLTDFG-FCAQI 709

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 101/218 (46%), Gaps = 31/218 (14%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY + G L D++ +K   +L E+E ++   Q+ +G++  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSF--NIC 236

Query: 157 HRDIKIENVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPE 213
           HRD+K EN+L+   +   K+ DFG +  +  P +           ++K +     Y SPE
Sbjct: 237 HRDLKPENLLLDKKNRRIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPE 284

Query: 214 MIDLVKGFPIERKIRHLGSWCVALQIMLL-HYTFREDREVAIL----NGRYQYPAYPIYS 268
              +V G P       + S  + L  +L  H  F +D    +L    +G+YQ P     S
Sbjct: 285 ---IVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LS 339

Query: 269 DRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNIPC 304
              ++++  +L   P KR    ++L+   I K  ++P 
Sbjct: 340 AEARDLISKILVIDPAKRITTQEILKHPLIKKYDDLPV 377

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/334 (22%), Positives = 131/334 (39%), Gaps = 62/334 (18%)

Query: 15  IKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNS---NIACLKRVIVP--NKSGLNVL 69
           + +   +  I K L    F+ IY V+       +++   N+  LKR+  P  N   ++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER- 128
             EVD  K  ++  +++  +DS  A+    +GS  V++L+ Y   GSL D  +  L    
Sbjct: 86  MKEVDNYKRFQSP-YIIHLVDSQVAQQR--DGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 129 -LQEQEVLNIMNQVCQGIAAMHK---------------------------LLP--PL--- 155
            + E E + I+  + +G+  +H                            LL   PL   
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 156 -------------IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVM 202
                         HRDIK  N+L S DGL  + + GS            +L  +Q  V 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 203 KNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV-------AIL 255
            + T  Y +PE++ +     ++ K+      C    ++     F  + ++       AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 256 NGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNI 289
            G + +P+   YS+ L  ++   L  +P  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 29/198 (14%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           V++ +EYC    L D++   L++R+   E   +  Q+   +   H L    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSL--QCVHRDLKLEN 158

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMI--DLVKGFP 222
           +L+  +G   + DF    G  R      +L+ V        T  Y +PE+I  +   G+ 
Sbjct: 159 ILLDKNGYAMLTDF----GFTRECATKTQLETV------CGTTVYMAPELIKREAYDGYK 208

Query: 223 IERKIRHLGSWCVA--LQIMLLHYT-FREDREVAI-LNGRYQYPAY--PIYSDRLKNVVR 276
           ++       +W +   L  ML  Y  F ED  V   L   ++ PA      S + K+++ 
Sbjct: 209 VD-------TWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIV 261

Query: 277 VLLSPHPVKRPNICQLLE 294
            LL  +  +RPN+ ++L+
Sbjct: 262 RLLDKNAAQRPNLNEVLQ 279

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 131/304 (43%), Gaps = 40/304 (13%)

Query: 28  LTSGGFAQIY-SVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           L  G ++ +  +  I  K +Y    +  L +  +  +  +  +  E +A++ + N++ +V
Sbjct: 185 LGDGAYSTVMLATSIDSKKQYA---VKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIV 241

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
               +   +S        ++ L+EYC  G  L  M  K    L E        QV   I 
Sbjct: 242 KLFFTFQDESS-------LYFLLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAID 292

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            +H     +IHRDIK EN+L+  +   K+ DFG+   +     N  +L       +   T
Sbjct: 293 YLH--TNGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GT 348

Query: 207 AQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV----AILNGRYQYP 262
           A+Y +PE+++    F ++ +       C+  Q++     F+   E      ++  +Y + 
Sbjct: 349 AEYVAPELLN--DSF-VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFT 405

Query: 263 A-YPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNIPCPIDNFYLERSRHQGAVS 321
           A +P+    ++++V+ +L     +RP+I Q+ +             +F+ E++   G+V 
Sbjct: 406 AGFPLI---IRDLVKKILVKDLNQRPSISQIEKH------------HFFREKNFQNGSVW 450

Query: 322 VMPV 325
             PV
Sbjct: 451 SDPV 454

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 88/197 (44%), Gaps = 23/197 (11%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           ++ ++EY   G LL  +  +    L      +   Q+   I A+H +   +IHRDIK EN
Sbjct: 219 LYFVLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSV--GVIHRDIKPEN 274

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKN--TTAQYRSPEMIDLVKGFP 222
           VL+      K+ DFG+   +   P+    L+ V   V  +   TA+Y  PE+  L  G  
Sbjct: 275 VLLDSHYRAKLTDFGTAALL---PQTHSNLEQVSRHVTTSFVGTAEYVPPEL--LAAGH- 328

Query: 223 IERKIRHLGSW-CVALQIMLLHYTFREDREVA----ILNGRYQYPAYPIYSDRLKNVVRV 277
                  L +W CV  Q++     F+   E      ++  RY YP  P +   LK+++R 
Sbjct: 329 -ADGTCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRR 385

Query: 278 LLSPHPVKR---PNICQ 291
           +L   P +R   P I Q
Sbjct: 386 VLRHEPRQRLLQPQITQ 402

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 108/227 (47%), Gaps = 34/227 (14%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F Q+YS          N  I  +K + + + + +     +++ E+  +++L N+
Sbjct: 1039 FIGGGTFGQVYSA-----INLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEML-NH 1092

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++V Y      + +       V + MEYCE GSL   ++     R++++ V  +   ++
Sbjct: 1093 PNIVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFEL 1142

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII----RPPRNPQELQY- 196
             +G+A +H+    ++HRDIK EN+L+  +G+ K  DFG+   ++    R  RN     + 
Sbjct: 1143 LEGLAYLHQ--SGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFG 1200

Query: 197  VQHDVMKNT--TAQYRSPEMI--DLVKGFPIERKIRHLGSWCVALQI 239
            V+   +     T  Y +PE I    VKG      +  LG  CV L++
Sbjct: 1201 VETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALG--CVVLEM 1245

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 63/289 (21%), Positives = 126/289 (43%), Gaps = 34/289 (11%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEV 73
           V+K G    K  + L  G ++ +  +  + K+      +  L +  +  +  +  +  E 
Sbjct: 159 VVKKGIKDFKFGETLGDGSYSTV--MLATSKESGKKYAVKVLSKEYLIRQKKVKYVNIEK 216

Query: 74  DAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQE 133
           +A++ L N+R +V    +   +S        ++ L+EY   G  L  M  K    L E  
Sbjct: 217 NALQRLNNSRGIVKLYFTFQDESS-------LYFLLEYAPNGDFLSIM--KKYGSLNEDC 267

Query: 134 VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQE 193
                 Q+   I  +H     ++HRDIK EN+L+  D   K+ DFG+   I+ P  N  +
Sbjct: 268 ACYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGT-AKILEPKPNTTD 324

Query: 194 LQYVQHDVMKNT-----TAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE 248
                +D++  +     TA+Y SPE+++      ++ +       C+  Q++     F+ 
Sbjct: 325 ----SYDLLSRSKSFVGTAEYVSPELLN---DNYVDYRCDIWAFGCILFQMIAGKPPFKA 377

Query: 249 DREV----AILNGRYQYPA-YPIYSDRLKNVVRVLLSPHPVKRPNICQL 292
             E      ++  +Y + A +P+    ++++V+ +L   P +R  I Q+
Sbjct: 378 TNEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIKQPAQRLTIPQI 423

>NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192
          Length = 356

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 102/223 (45%), Gaps = 40/223 (17%)

Query: 28  LTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVP-NKSGLNVLRTEVDAMKLL-KNNRHV 85
           + +G F+ +Y    S ++EY       LK  I+P +K     +  E + MK+L +++ ++
Sbjct: 9   IQTGTFSTVYKAWSSQRNEY-----VALK--IMPKSKYSSGGMANEFEIMKILGRSHPNI 61

Query: 86  VSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ------EQEVLNIMN 139
            S +D       + + +Y V L++EYCE G L DF++   R+  Q      + +   ++ 
Sbjct: 62  CSMLDF------YQDTNYYV-LVLEYCEYGDLYDFLSVAKRQGDQIHPSTIQLDFAKVLR 114

Query: 140 QVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQH 199
           Q+   I   H L   + HRDIK EN+L++ +G  K+ D+G     IR   + +       
Sbjct: 115 QISSAIMYSHSL--GIAHRDIKPENILLTKEGDIKLADWGHA---IRDSFSKES------ 163

Query: 200 DVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLL 242
                 T  YR+PE  D      IE     +  W + +  + L
Sbjct: 164 ---HIGTDNYRAPETFDCT----IEYDTFKIDYWSLGVTSLYL 199

>KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1468

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 80/160 (50%), Gaps = 23/160 (14%)

Query: 26   KYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKN 81
            KY+  G F  ++S          N  I  +K + + +   +     +++ E++ +++L N
Sbjct: 1161 KYIGGGTFGAVFSAV-----NLDNGEILAVKEIKIQDNKSMEKFFPLIKDEMNVLEML-N 1214

Query: 82   NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-Q 140
            + +VV Y      +         V + MEYCE GSL   +      R++++ V  +   Q
Sbjct: 1215 HPNVVQYYGVEVHRDR-------VNIFMEYCEGGSLATLLE---HGRIEDELVTQMYTLQ 1264

Query: 141  VCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180
            + +G+A +H+    +IHRDIK EN+L+  +G+ K  DFG+
Sbjct: 1265 LLEGLAYLHE--SGIIHRDIKPENILLDYNGIIKYVDFGA 1302

>Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON}
           (193193..194923) [1731 nt, 577 aa]
          Length = 576

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 103/207 (49%), Gaps = 18/207 (8%)

Query: 105 VFLLMEYCERGSL--LDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKI 162
           ++++ EY E   L  + F +   +  + ++ + +I+ Q+  G++ +H+    ++HRD+K 
Sbjct: 244 IYMVYEYAEHDLLQIIHFHSHPEKRMIPQRMIRSILWQILDGVSYLHQNW--ILHRDLKP 301

Query: 163 ENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFP 222
            N++++ +G+ KV D     G+ R   N  +  Y    V+   T  YR+PE++   + + 
Sbjct: 302 ANIMVTSNGVVKVGDL----GLARKFHNMLQTLYTGDKVV--VTIWYRAPELMLGARHYT 355

Query: 223 IERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPH 282
               +  +G  C+  +++ L   F+   E A ++ +    + P  +++L+ ++ VL +P 
Sbjct: 356 PAIDLWAVG--CIFAELIGLQPIFKG--EEAKMDSK---KSVPFQANQLQRIIEVLGTPS 408

Query: 283 PVKRPNICQLLEEISKIQNIPCPIDNF 309
           P   PNI Q   E  ++   P   DN 
Sbjct: 409 PKNWPNI-QKYPEYDQLAKFPKCRDNL 434

>YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}
            SSK2MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; interacts with
            Ssk1p, leading to autophosphorylation and activation of
            Ssk2p which phosphorylates Pbs2p; also mediates actin
            cytoskeleton recovery from osmotic stress
          Length = 1579

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 83/163 (50%), Gaps = 23/163 (14%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F ++YS       +  N  I  +K + + +   +     +++ E+  +++L N+
Sbjct: 1271 FIGGGTFGRVYSAV-----DLDNGEILAVKEINIQDSKSMQKIFPLIKEEMSVLEIL-NH 1324

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++VSY      + +       V + MEYCE GSL   +      R++++ V  +   Q+
Sbjct: 1325 PNIVSYYGVEVHRDK-------VNIFMEYCEGGSLAALLE---HGRIEDEMVTQVYTLQL 1374

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI 184
             +G+A +H+    ++HRD+K EN+L+  +G+ K  DFG+   I
Sbjct: 1375 LEGLAYLHE--SGIVHRDVKPENILLDFNGVIKYVDFGAAKKI 1415

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 112/255 (43%), Gaps = 38/255 (14%)

Query: 52  IACLKRVIVPNKSGLNV-LRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLME 110
           I  ++R  +P  S   V +  E++A+K L N+ ++V          E    S  + +++E
Sbjct: 74  IKLIRRDTIPKNSEKEVKIYREINALKHL-NHPNIVRL-------EEVLQNSKYIGIVLE 125

Query: 111 YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
           Y   G    ++  K   RL+E     +  Q+  G+  MH     L+HRD+K+EN+L+  +
Sbjct: 126 YASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHS--KGLVHRDLKLENLLLDKN 181

Query: 171 GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ--YRSPEMIDLVKGFPIERKIR 228
               + DFG V   +  P N         ++MK +     Y +PE++  V   P E +  
Sbjct: 182 ENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPELV--VTARPYEARKA 228

Query: 229 HLGSWCVALQIMLLHYTFREDR----EVAILNGRYQYPA-----YPIYSDRL-KNVVRVL 278
            + S  V +  ML  Y   +D     +   +   Y+Y       +P Y   + ++++R +
Sbjct: 229 DIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPDYIAPVPRDLLRAI 288

Query: 279 LSPHPVKRPNICQLL 293
           L   P KR  I Q L
Sbjct: 289 LVADPKKRITIAQTL 303

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 61/115 (53%), Gaps = 20/115 (17%)

Query: 69  LRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSY----EVFLLMEYCERGSLLDFMNTK 124
           +R E+  +  LK   ++  Y            GSY    +++++MEYC  GSL   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYY-----------GSYLIDTKLWVIMEYCAGGSLRTLLRPG 107

Query: 125 LRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           +   ++E+ +  IM ++   + ++H+    +IHRDIK  N+LI+ +G  K+CDFG
Sbjct: 108 I---IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFG 157

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 93/213 (43%), Gaps = 43/213 (20%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E++L++EY E G L D++ +K   +L E E ++   Q+ Q +A  H     + 
Sbjct: 141 EVWENKSELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGF--NIC 196

Query: 157 HRDIKIENVLISGDGL-FKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA---QYRSP 212
           HRD+K EN+L+       K+ DFG                    D +  T+     Y SP
Sbjct: 197 HRDLKPENLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASP 243

Query: 213 EMIDLVKGFPIERKIRHLGS----WCVALQIMLL---HYTFREDREVAIL----NGRYQY 261
           E++       + RK  + GS    W   + +  L   H  F +D    +L    +G+YQ 
Sbjct: 244 EIV-------LGRK--YHGSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQM 294

Query: 262 PAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
           P +   S   K+++  +L   P +R  I Q+L+
Sbjct: 295 PQW--LSVEAKDLISRILVVDPNRRITIDQILQ 325

>TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {ON}
           Anc_3.177 YAR019C
          Length = 980

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 78/159 (49%), Gaps = 17/159 (10%)

Query: 21  QAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLK 80
           Q ++   +  G F  +Y   I+ K     + I  +K V   N   LN + +E+  +K L 
Sbjct: 59  QYQLKGVIGKGSFGVVYKA-INKK----TAQIVAIKEVNYDNDEELNDIMSEIHLLKNL- 112

Query: 81  NNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQ 140
           NNR++V Y         F      +++++EYC +GSL   +++   + + E +    + Q
Sbjct: 113 NNRNIVKY-------HGFIQKMDTLYIILEYCSKGSLKKLISS--NKGISEADAKMFIRQ 163

Query: 141 VCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
              G+  +H+    +IHRDIK  N+L+  D + K+ DFG
Sbjct: 164 TLHGLVYLHE--QGVIHRDIKAANLLLDSDNVVKLADFG 200

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 106/238 (44%), Gaps = 45/238 (18%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
           ++ + ++K ++H  +V++IDS     +        +++MEY E GSL D +   +   L 
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYLLDGDL-------WVIMEYMEGGSLTDVVTHCI---LT 719

Query: 131 EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
           E ++  +  +   G+  +H     ++HRDIK +N+L+S +G  K+ DFG  C        
Sbjct: 720 EGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSINGNIKLTDFG-FCA------- 769

Query: 191 PQELQYVQHDVMKNTTA----QYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM------ 240
                 V    +K TT      + +PE++   +  P       +  W + + I+      
Sbjct: 770 -----QVNETTLKRTTMVGTPYWMAPEVVSRKEYGP------KVDIWSLGIMIIEMIEGE 818

Query: 241 --LLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
              L+ T      +   NG  +       SD LK+ +   LS +P +R +  +LLE++
Sbjct: 819 PPYLNETPLRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +      ++ E+ +  IM +V   +  +HK    +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMREVLVALKCIHK--DNVI 141

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFG 164

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +   +   + E+ +  IM ++   +  +HK    +I
Sbjct: 108 GSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIHK--DNVI 162

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 163 HRDIKAANVLITNEGKVKLCDFG 185

>TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {ON} 
          Length = 868

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 104/210 (49%), Gaps = 19/210 (9%)

Query: 105 VFLLMEYCERGSL--LDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKI 162
           ++L+ EY E   L  + F +   +  + ++ + +IM Q+  G++ +H+    ++HRD+K 
Sbjct: 439 IYLVYEYAEHDLLQIIHFHSHPEKRMIPQRMIRSIMWQILDGVSYLHQNW--ILHRDLKP 496

Query: 163 ENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFP 222
            N++++ DG+ K+ D     G+ R   N  +  Y    V+   T  YR+PE++   + + 
Sbjct: 497 ANIMVTVDGVVKIGDL----GLARKFHNMVQTLYTGDKVV--VTIWYRAPELLLGARHYT 550

Query: 223 IERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPH 282
               +  +G  C+  +++ L   F+   E A ++ +      P   ++++ ++ VL +P 
Sbjct: 551 PAIDLWAVG--CIFAELIGLQPIFKG--EEAKMDSK---KTVPFQVNQIQRILEVLGTPT 603

Query: 283 PVKRPNICQL--LEEISKIQNIPCPIDNFY 310
               PN+ +    +++SK Q     + N+Y
Sbjct: 604 QKTWPNLYKYPEFDQLSKFQKFRDNLPNWY 633

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 82/165 (49%), Gaps = 18/165 (10%)

Query: 16  KVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDA 75
           K  S + ++ K + +G  A   +++I PK    ++N +  K+    N +    +  E+  
Sbjct: 69  KGSSGRVRLAKNMETGKLA---AIKIVPKKVVRSTNAS--KKSNAANGNLPYGIEREIII 123

Query: 76  MKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVL 135
           MKL+ +   +  Y        E      E+FL++EY E G L D++ +K   +L EQE +
Sbjct: 124 MKLISHPNIMALY--------EVWENKSELFLVLEYVEGGELFDYLVSK--GKLPEQEAV 173

Query: 136 NIMNQVCQGIAAMHKLLPPLIHRDIKIENVLIS-GDGLFKVCDFG 179
           +   Q+ QG+A  H     + HRD+K EN+L+   +   K+ DFG
Sbjct: 174 HYFRQIIQGVAYCHNY--NICHRDLKPENLLVDKKNHQIKIADFG 216

>Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 133/310 (42%), Gaps = 45/310 (14%)

Query: 37  YSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKS 96
           Y V     +++T+  +A +K ++  N   LN +  E+ ++    NN ++V Y        
Sbjct: 36  YGVVYKAINKHTDQVVA-IKEIVYENDEELNDIMAEI-SLLKNLNNNNIVKY-------H 86

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
            F   SYE+++L+EYC  GSL   + ++    L E E    + Q   G+  +H     +I
Sbjct: 87  GFIRKSYELYILLEYCANGSLRRLV-SRSPTGLSENESKTYVTQTLWGLKYLHG--EGVI 143

Query: 157 HRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           HRDIK  N+L+S D   K+ DFG V  I+    N   L           T  + +PE++ 
Sbjct: 144 HRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG-------TLNWMAPEILG 191

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREV--AILNGRYQYPAYPIYSDRLKNV 274
             +G      I  LG+  V L      Y    D  +  A+ N  Y  P    +S+ LK+ 
Sbjct: 192 -NRGASTLSDIWSLGATVVELLTKNPPYHNLTDANIYYAVENDTYYPPT--AFSESLKDF 248

Query: 275 VRVLLSPHPVKRPNICQLLEE--ISKIQNIPCPID------------NFYLERSRHQGAV 320
           +      +  KRP   QLL+   I+  +N+   +D            N++ +    +  +
Sbjct: 249 LSKCFVKNMYKRPTADQLLKHAWITSTENV--KVDKLNKFKEDFSDANYHWDSDFQEEKL 306

Query: 321 SVMPVNFSRA 330
            + P  FS A
Sbjct: 307 DISPSKFSSA 316

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 23/182 (12%)

Query: 111  YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            + E GS+  F   + +  + E E   +  QV  G+  +H     ++HRDIK EN+++   
Sbjct: 1164 HGETGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLHD--QGIVHRDIKDENIIVDSQ 1221

Query: 171  GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
            G  K+ DFGS   +   P           DV   T   Y +PE++    G P E K + +
Sbjct: 1222 GFVKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---GGSPYEGKPQDI 1267

Query: 231  GSWCVALQIMLLHYTFRED---REVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
              W  A+ I+L    F+E+       IL G  ++ +  + S++   ++  +L+ +  KRP
Sbjct: 1268 --W--AIGILLYTIVFKENPFYNIDEILEGELKFNSSELVSEQCTTLIAKILNRNVQKRP 1323

Query: 288  NI 289
             I
Sbjct: 1324 TI 1325

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 109/236 (46%), Gaps = 43/236 (18%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
           ++ + ++K+++H  +V++IDS   K +       ++++ME+ E GSL D +   +   L 
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSFLLKGD-------LWVIMEFMEGGSLTDVVTHCI---LT 643

Query: 131 EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN 190
           E ++  +  +  +G+  +H     +IHRDIK +N+L+S  G  K+ DFG  C  I     
Sbjct: 644 EGQIGTVCRETLRGLQFLHS--NGVIHRDIKSDNILLSMKGDIKLTDFG-FCAQIN---- 696

Query: 191 PQELQYVQHDVMKNT---TAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM------- 240
                  +H++ + T   T  + +PE++   +  P       +  W + + I+       
Sbjct: 697 -------EHNLKRTTMVGTPYWMAPEVVSRKEYGP------KVDIWSLGIMIIEMIESEP 743

Query: 241 -LLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295
             L+ T      +   NG  +     + SD L + +   L  +P +R +   LLE+
Sbjct: 744 PYLNETPLRALYLIATNGTPKLKEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     +++LMEYC  GSL   +      ++ E+ +  IM ++   +  +HK    +I
Sbjct: 87  GSYLKDTSLWILMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKCIHK--DNVI 141

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 142 HRDIKAANVLITNEGSVKLCDFG 164

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 82/152 (53%), Gaps = 24/152 (15%)

Query: 31  GGFAQIYSV-EISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRH--VVS 87
           GG A +Y+  E+      TN ++A +K++ +  +    ++  E+  MK    ++H  +V+
Sbjct: 622 GGSALVYTAYEVG-----TNLSVA-IKQINLEKQPRKQLILNEIIVMK---KSQHPNIVN 672

Query: 88  YIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAA 147
           +IDS     +        +++MEY E GSL D +    R  L+E ++  +  +V +G+  
Sbjct: 673 FIDSYLVDGKL-------WVIMEYMEAGSLTDVVT---RCILREGQIGAVCREVLKGLVF 722

Query: 148 MHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           +H     +IHRDIK +NVL+S DG  K+ DFG
Sbjct: 723 LHS--KGVIHRDIKSDNVLLSMDGDIKLTDFG 752

>Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W
           (REAL)
          Length = 369

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 84/165 (50%), Gaps = 26/165 (15%)

Query: 25  LKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPN-KSGLNVLRTEVDAMKLL---K 80
           L+ + SG F+ +Y    +  + Y       LK  I P  K+    ++ E D MK L   K
Sbjct: 5   LRPIQSGTFSTVYKAWSTHHNRY-----VALK--ITPKYKTSEANMKNEYDVMKKLSSYK 57

Query: 81  NNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE------RLQEQEV 134
           ++ ++ S +D       + + SY V +++EYCE G L DF++    +       L + ++
Sbjct: 58  SHPNICSMLDF------YTDDSYYV-MVLEYCECGDLYDFLDIAKSQGTPSSPSLIQIDM 110

Query: 135 LNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
             I+ Q+C  I+  H L   + HRDIK ENVL++ +G  K+ D+G
Sbjct: 111 QRIIKQLCSAISFAHSL--GIAHRDIKPENVLLTINGDVKLADWG 153

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 83/156 (53%), Gaps = 22/156 (14%)

Query: 30  SGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYI 89
           SGG    Y V        TN+++A +K++ +  +    ++  E+  MK  K+ +++V++I
Sbjct: 634 SGGVYTAYEV-------GTNASVA-IKQMNLEKQPKKELIINEILVMKGSKH-QNIVNFI 684

Query: 90  DSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMH 149
           DS   K +       ++++MEY E GSL D +   +   L E ++  +  +  +G+  +H
Sbjct: 685 DSYVLKGD-------LWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLH 734

Query: 150 KLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                +IHRDIK +N+L+S +G  K+ DFG  C  I
Sbjct: 735 S--KGVIHRDIKSDNILLSMNGEIKLTDFG-FCAQI 767

>SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1558

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 79/296 (26%), Positives = 134/296 (45%), Gaps = 41/296 (13%)

Query: 27   YLTSGGFAQIYS-VEISPKDEYTNSNIACLKRV-IVPNKSGLNVLRTEVDAMKLLK--NN 82
            ++  G F  ++S V +   D      I  +K + I  +KS   V  +  D M +L+  N+
Sbjct: 1267 FIGGGTFGTVFSAVNLDTGD------ILAVKEIKIQDSKSMQQVFPSIKDEMTVLEMLNH 1320

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++V Y      + +       V + MEYCE GSL + +      R++++ V  +   Q+
Sbjct: 1321 PNIVQYYGVEVHRDK-------VNIFMEYCEGGSLANLLE---HSRVEDEMVTQVYALQL 1370

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPP------RNPQELQ 195
             +G+A +H+    ++HRDIK EN+L+  +G+ K  DFG+   + +            E +
Sbjct: 1371 LEGLAYLHQ--SGVVHRDIKPENILLDFNGIIKYVDFGAAKLLAKNSTKGNIDATSSEAK 1428

Query: 196  YVQHDVMKNTTAQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFRE-DREVA 253
              + + M   T  Y SPE I   +KG      I  LG  CV L+++     +   D E A
Sbjct: 1429 QDRINTMMG-TPMYMSPESITGTIKGKFGSDDIWSLG--CVILEMVTGRRPWANLDNEWA 1485

Query: 254  IL----NGRY-QYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE--ISKIQNI 302
            I+     G   Q+PA    S   +  +   L   P KR    +LL +  I++I+ I
Sbjct: 1486 IMYHVAAGHAPQFPARDEISRAGRKFLSRCLIQDPNKRATAVELLMDPWIAEIRKI 1541

>Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W
           (REAL)
          Length = 660

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 47/83 (56%), Gaps = 9/83 (10%)

Query: 104 EVFLLMEYCERGSLLDFMNTKLRER-------LQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E++++MEY E G L D ++             L E ++  I+ + CQG+  +H     +I
Sbjct: 452 ELWVIMEYMEGGCLTDILDAAAESSNGNKLSPLNESQMAYIVRETCQGLKFLHN--NKII 509

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK +N+L++  GL K+ DFG
Sbjct: 510 HRDIKSDNILLNSQGLVKITDFG 532

>Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W
           (REAL)
          Length = 655

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 61/112 (54%), Gaps = 18/112 (16%)

Query: 78  LLKNNRH---VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNT-------KLRE 127
           L+ N+ H   +V+++++     E      E++++MEY E G L D ++        K   
Sbjct: 424 LVMNDSHHENIVNFLEAYIIDDE------ELWVIMEYMEGGCLTDILDAAVGSNDGKKSS 477

Query: 128 RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
            L E ++  I+ + CQG+  +H     +IHRDIK +N+L++  GL K+ DFG
Sbjct: 478 ALNESQISYIVRETCQGLKFLHG--NNIIHRDIKSDNILLNSRGLVKITDFG 527

>Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] {ON}
            YNR031C (REAL)
          Length = 1583

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 83/163 (50%), Gaps = 23/163 (14%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F +++S       +  N  I  +K + + +   +     +++ E+  +++L N+
Sbjct: 1272 FIGGGTFGRVFSAV-----DLDNGEILAVKEINIQDSKAMQKIFPLIKEEMSVLEIL-NH 1325

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++VSY      + +       V + MEYCE GSL   +      R++++ V  I   Q+
Sbjct: 1326 PNIVSYYGVEVHRDK-------VNIFMEYCEGGSLAALLE---HGRIEDEMVTQIYTLQL 1375

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI 184
             +G+A +H+    ++HRD+K EN+L+  +G+ K  DFG+   I
Sbjct: 1376 LEGLAYLHE--SGIVHRDVKPENILLDFNGVIKYVDFGAAKKI 1416

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +      ++ E+ +  IM ++   +  +HK    +I
Sbjct: 80  GSYLRGTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKVIHK--DNVI 134

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 135 HRDIKAANVLITNEGQVKLCDFG 157

>Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W
           (REAL)
          Length = 603

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 92/204 (45%), Gaps = 18/204 (8%)

Query: 98  FGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIH 157
           F +   E   +MEYC  G L   +      +L+  E      Q+ +G+  MH++   + H
Sbjct: 392 FQDAKGEYCEVMEYCAGGDLFTLVIAA--GKLEYMEADCFFKQLIRGVVYMHEM--GVCH 447

Query: 158 RDIKIENVLISGDGLFKVCDFG-SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           RD+K EN+L++ DG+ K+ DFG S C  +   +N      +        ++ Y +PE   
Sbjct: 448 RDLKPENLLLTHDGVLKITDFGNSECFKMAWEKN------IHLSGGICGSSPYIAPEEYI 501

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLHYTFREDRE---VAILNGRYQYPAY-PIYS---D 269
             +  P    I   G   +A++     ++  E  +   +  L GR +   Y PI S    
Sbjct: 502 KEEFDPRPVDIWACGVIYMAMRTGRQLWSSAEKEDPFYMNYLKGRKEKGGYEPIESLKRA 561

Query: 270 RLKNVVRVLLSPHPVKRPNICQLL 293
           R +NV+  +L P P +R N  Q+L
Sbjct: 562 RCRNVIYSMLDPVPYRRINGKQIL 585

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (54%), Gaps = 15/115 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQ 130
           ++ + ++K +RH  +V++IDS   K +        +++MEY E GSL D +   +   L 
Sbjct: 665 INEILVMKGSRHPNIVNFIDSYVLKGDL-------WVIMEYMEGGSLTDVVTHCI---LT 714

Query: 131 EQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
           E ++  +  +   G+  +H     ++HRDIK +N+L+S +G  K+ DFG  C  I
Sbjct: 715 EGQIGAVCRETLSGLKFLHSK--GVLHRDIKSDNILLSMEGDIKLTDFG-FCAQI 766

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 80/156 (51%), Gaps = 22/156 (14%)

Query: 30   SGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYI 89
            SGG    Y V        TN+++A +K++ +  +    ++  E+  MK  K+ +++V++I
Sbjct: 1038 SGGVYTAYEVG-------TNASVA-VKQMNLEKQPKTELIINEIIVMKESKH-KNIVNFI 1088

Query: 90   DSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMH 149
            DS   K +        +++MEY E GSL D +   +   L E ++  +  +   G+  +H
Sbjct: 1089 DSYLLKGDL-------WVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLNGLKFLH 1138

Query: 150  KLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                 +IHRDIK +N+L+S  G  K+ DFG  C  I
Sbjct: 1139 S--KGVIHRDIKSDNILLSMQGDIKLTDFG-FCAQI 1171

>Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W
           (REAL)
          Length = 653

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 18/112 (16%)

Query: 78  LLKNNRH---VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRER------ 128
           L+ N+ H   +V+++++     E      E++++MEY E G L D ++            
Sbjct: 422 LVMNDSHHENIVNFLEAYIIDDE------ELWVIMEYMEGGCLTDILDATAEVNASNNSS 475

Query: 129 -LQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
            L E ++  I+ + CQG+  +H     +IHRDIK +N+L++  GL K+ DFG
Sbjct: 476 PLNENQMAYIVKETCQGLKFLHD--NKIIHRDIKSDNILLNSQGLVKITDFG 525

>AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL298W (CLA4) and
           YOL113W (SKM1)
          Length = 793

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 82/166 (49%), Gaps = 24/166 (14%)

Query: 29  TSGGFAQIYSVEISPKDEYT-------NSNIA---CLKRVIVPNKSGLNVLRTEVDAMKL 78
            SG       ++I P DE +       N NI     +K++I+  +    ++  E+  MK 
Sbjct: 508 ASGSVYLAQRLKIPPYDENSGVSQHELNDNIGDKVAIKQMILSKQPRKELIVNEILVMKD 567

Query: 79  LKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKL-----RERLQEQE 133
              ++++V+++++     +      +++++MEY E GSL D +   +        + E +
Sbjct: 568 -SQHKNIVNFLEAYLKTED------DLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQ 620

Query: 134 VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           +  I+ + CQG+  +H     +IHRDIK +NVL+   G  K+ DFG
Sbjct: 621 IAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTHGRVKITDFG 664

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 89/204 (43%), Gaps = 37/204 (18%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           + +++EY   G    ++  K   RL+E     +  Q+  G+  MH     L+HRD+K+EN
Sbjct: 124 IGIVLEYASGGEFYRYIQRK--RRLKETAGCRLFTQLVSGVNYMHS--KGLVHRDLKLEN 179

Query: 165 VLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ--YRSPEMIDLVKGFP 222
           +L+       + DFG V   ++            +D+MK +     Y +PE++   K  P
Sbjct: 180 LLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPELVISTK--P 226

Query: 223 IERKIRHLGSWCVALQIMLLHYTFRED-------REVA-----ILNGRYQYPAY--PIYS 268
            E +   + S  + L  ML  Y   +D        ++A     I     ++P Y  PI  
Sbjct: 227 YEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPEYISPIPR 286

Query: 269 DRLKNVVRVLLSPHPVKRPNICQL 292
           D    ++R LL   P KR NI Q+
Sbjct: 287 D----LLRRLLVSDPRKRLNIRQI 306

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/188 (27%), Positives = 86/188 (45%), Gaps = 23/188 (12%)

Query: 111  YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            + E GS+  F   +L+  + E E   I  QV  GI  +H     ++HRDIK EN+++   
Sbjct: 1102 HGETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLHD--NGIVHRDIKDENIIVDNK 1159

Query: 171  GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
            G  K+ DFGS   +   P           DV   T   Y +PE++    G P E K + +
Sbjct: 1160 GFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---GGDPYEGKPQDI 1205

Query: 231  GSWCVALQIMLLHYTFREDREV---AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
              W  A+ ++L    F+E+       IL+G  +  +    S+    ++R +L+    KRP
Sbjct: 1206 --W--AIGVLLYTIIFKENPFYNIDEILDGDLRISSSVTVSEECIALIRRILNRSVPKRP 1261

Query: 288  NICQLLEE 295
             I ++  +
Sbjct: 1262 TIEEIYND 1269

>Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] {ON}
            YNR031C (REAL)
          Length = 1579

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 83/163 (50%), Gaps = 23/163 (14%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F +++S       +  N  I  +K + + +   +     +++ E+  +++L N+
Sbjct: 1271 FIGGGTFGRVFSAV-----DLDNGEIMAVKEINIQDSKAMQKIFPLIKEEMSVLEIL-NH 1324

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++VSY      + +       V + MEYCE GSL   +      R++++ V  +   Q+
Sbjct: 1325 PNIVSYYGVEVHRDK-------VNIFMEYCEGGSLAALLE---HGRIEDEMVTQVYTLQL 1374

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI 184
             +G+A +H+    ++HRD+K EN+L+  +G+ K  DFG+   I
Sbjct: 1375 LEGLAYLHE--SGIVHRDVKPENILLDFNGVIKYVDFGAAKKI 1415

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 127/297 (42%), Gaps = 42/297 (14%)

Query: 9   YPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNI-ACLKRVIVPNKSGLN 67
           +  G  + +GS     L Y +S G  Q  ++++  K  + N N  A    ++ P+     
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNNDNANASDSALLTPDSLPYG 77

Query: 68  VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRE 127
           + R E+  MKLL N+ +V+   D     S        +++++EY E+G L +     L E
Sbjct: 78  IER-EIIIMKLL-NHPNVLRLYDVWETDSN-------LYMVLEYAEKGELFNL----LVE 124

Query: 128 R--LQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
           R  L E E +    Q+  GI+  H L   ++HRD+K EN+L+      K+ DFG      
Sbjct: 125 RGPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDHKYNIKIADFGMAA--- 179

Query: 186 RPPRNPQELQYVQHDVMKNTTA---QYRSPEMIDLVKGFPIERKIRHLGSWCVALQIMLL 242
                         D +  T+     Y +PE+I  +    +E  +   G    AL    L
Sbjct: 180 ----------LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRL 229

Query: 243 HYTFREDREV-----AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
            +   ED  +      + +G+++ P     S   ++++  +L+  P KR    ++L+
Sbjct: 230 PFD-EEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 109/241 (45%), Gaps = 32/241 (13%)

Query: 26   KYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKN 81
            +++  G F  ++S             I  +K + + ++  +      ++ E+  +++L N
Sbjct: 1253 QFVGGGAFGTVFSAV-----NLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEML-N 1306

Query: 82   NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-Q 140
            + +VV Y      + +       V L MEYCE GSL   +      R++++ V  I   Q
Sbjct: 1307 HPNVVQYYGVEVHRDK-------VNLFMEYCEGGSLAQLLE---HGRIEDEMVTQIYALQ 1356

Query: 141  VCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI----IRPPRNPQELQY 196
            + +G+A +H+    ++HRDIK EN+L+  +G+ K  DFG+   +     + P    E + 
Sbjct: 1357 MLEGLAYLHQ--SSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKA 1414

Query: 197  VQHDVMKNTTAQYRSPEMIDLV-KGFPIERKIRHLGSWCVALQIMLLHY-TFREDREVAI 254
               + M   T  Y SPE I    KG      I  LG  CV L+++      F  D E AI
Sbjct: 1415 DGVNSMMG-TPMYMSPESITGAKKGKFGSGDIWSLG--CVILEMVTGRRPWFNLDNEWAI 1471

Query: 255  L 255
            +
Sbjct: 1472 M 1472

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 81/156 (51%), Gaps = 22/156 (14%)

Query: 30  SGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYI 89
           SGG    Y +        TN+++A +K++ +  +    ++  E+  MK  K+ R++V++I
Sbjct: 666 SGGVYTAYEL-------GTNASVA-IKQMNLEKQPKKELIINEIMVMKGSKH-RNIVNFI 716

Query: 90  DSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMH 149
           DS   K +       ++++MEY E GSL D +   +   L E ++  +  +   G+  +H
Sbjct: 717 DSYLLKGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLH 766

Query: 150 KLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                +IHRDIK +N+L+S  G  K+ DFG  C  I
Sbjct: 767 S--KGVIHRDIKSDNILLSMTGEIKLTDFG-FCAQI 799

>TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa]
           {ON} Anc_1.180 YKL168C
          Length = 981

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 108 LMEYCERGSLLDFMNTKLRER--LQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENV 165
           +ME+C  G L   MN KL+        E   I  Q+   I  MH     + H DIK EN+
Sbjct: 761 VMEFCAAGDLFTLMNNKLKNNKVFHPLEADCIFKQILYAIKYMHDHC--VAHCDIKPENI 818

Query: 166 LISGDGLFKVCDFG 179
           L+  DGL KVCDFG
Sbjct: 819 LLHKDGLVKVCDFG 832

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +      ++ E+ +  IM ++   +  +HK    +I
Sbjct: 105 GSYLKNTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKFIHK--DNII 159

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 160 HRDIKAANVLITNEGGVKLCDFG 182

>TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1730

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/313 (21%), Positives = 134/313 (42%), Gaps = 60/313 (19%)

Query: 26   KYLTSGGFAQIYS-VEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLK 80
            K++ SG F  ++S V +   D      +  +K + + +   +     +++ E+  +++L 
Sbjct: 1413 KFIGSGTFGNVFSAVNLDSGD------VLAVKEIKIQDTKAMKKVFPLIKKEMTVLEML- 1465

Query: 81   NNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN- 139
            N+ ++V Y      + +       V + MEYCE GSL   +      R++++ V  +   
Sbjct: 1466 NHPNIVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLE---HGRIEDEMVTQVYTL 1515

Query: 140  QVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS----------VCGIIRPPR 189
            ++ +G++ +H+    ++HRDIK EN+L+  +G+ K  DFG+          +    +  +
Sbjct: 1516 ELLEGLSYLHQ--SGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKDHTRIASFSKDGK 1573

Query: 190  NPQELQYVQHDVMKNTTA-------------QYRSPEMIDLVKGFPIERKIRHLGSW--- 233
            + +E + +   +++   A              Y +PE I    G P + K      W   
Sbjct: 1574 DNKESKKIDDTLLETEEAGVGTGLYDMVGTPMYMAPEAI---SGSPNKNKFGSDDVWSLG 1630

Query: 234  CVALQIMLLHYTFRE-DREVAIL-----NGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
            CV L+++     +   D E AI+         Q P+    S    N ++  L   P KR 
Sbjct: 1631 CVVLEMITGRRPWANLDNEWAIMYHVAAGHSPQLPSKDEVSTNGNNFLKRCLQQDPYKRA 1690

Query: 288  NICQLLEEISKIQ 300
                LL ++  ++
Sbjct: 1691 TAVDLLMDVWIVE 1703

>KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {ON}
           similar to uniprot|Q12100 Saccharomyces cerevisiae
           YDL025C Protein of unknown function potentially
           phosphorylated by Cdc28p
          Length = 596

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 6/77 (7%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
             ++MEYC      DF    + + + + E+     Q+C G+A +HK    L HRD+K++N
Sbjct: 295 FLVVMEYCP----YDFFTLVMSDLMTKHEIACYFKQICNGVAYLHKT--GLAHRDLKLDN 348

Query: 165 VLISGDGLFKVCDFGSV 181
            +++  G+ K+ DFGS 
Sbjct: 349 CVVTSQGILKLIDFGSA 365

>Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W
           (REAL)
          Length = 864

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 64/114 (56%), Gaps = 15/114 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFM-----NTKL 125
           V+ + ++K++RH  +V+++++     +      +++++ME+ E GSL D +     N   
Sbjct: 630 VNEILVMKDSRHKNIVNFLEAYLRTDD------DLWVVMEFMEGGSLTDIIENSPANDTS 683

Query: 126 RERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           R  L E ++  I+ + CQG+  +H     +IHRDIK +NVL+      K+ DFG
Sbjct: 684 RSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRARVKITDFG 735

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 128/307 (41%), Gaps = 51/307 (16%)

Query: 8    NYPPGFVIKVGSHQAK-----ILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRV---- 58
            N    +VI    H  K     +L+ +  G + ++  + +  KD+Y    I  +KR+    
Sbjct: 950  NTSKSYVIGSQKHTKKFSDFLVLQKMGEGAYGKV-DLCMHKKDKY----IVVIKRIYKER 1004

Query: 59   -----IVPNKSGLNVLRTEVDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEY 111
                  V +++ L  + +E+  M  L    H  ++  +D       F +  Y       +
Sbjct: 1005 ILVDTWVRDRT-LGTIPSEIQIMVTLNRKPHENILRILDF------FEDDDYYYLETEMH 1057

Query: 112  CERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDG 171
             E GS+  F   +L+  + E E   +  QV  GI  +H     ++HRDIK ENV++   G
Sbjct: 1058 GETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLHD--NGIVHRDIKDENVIVDNKG 1115

Query: 172  LFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLG 231
              K+ DFGS   +   P           DV   T   Y +PE++    G P E K + + 
Sbjct: 1116 FVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---GGEPYEGKPQDI- 1160

Query: 232  SWCVALQIMLLHYT---FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPN 288
             W + + +  + Y    F    E  IL+G  +  +    S     ++R +L+    KRP 
Sbjct: 1161 -WAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPT 1217

Query: 289  ICQLLEE 295
            I  ++E+
Sbjct: 1218 IDDIMED 1224

>KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} similar
           to uniprot|P32944 Saccharomyces cerevisiae YJL187C SWE1
           Protein kinase that regulates the G2/M transition by
           inhibition of Cdc28p kinase activity localizes to the
           nucleus and to the daughter side of the mother-bud neck
           homolog of S. pombe Wee1p potential Cdc28p substrate
          Length = 722

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/196 (19%), Positives = 93/196 (47%), Gaps = 29/196 (14%)

Query: 31  GGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGL-NVLRTEVDAMKLLKNN------- 82
           G F+ +Y V       +  + +    + + P K    N +  E++ +  ++++       
Sbjct: 405 GQFSTVYQVT------FPETGLKYAIKSVRPTKHNFTNRILQEINMLSTIQDSVTNDTEG 458

Query: 83  -RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKL---RERLQEQEVLNIM 138
             ++V +I S + K  F       +++ E+CE G+L  F+   +   ++RL++  +  I+
Sbjct: 459 KEYIVEFISSWSHKGSF-------YIMTEFCENGNLDAFIQEHVIAKQQRLEDWRIWKII 511

Query: 139 NQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI---IRPPRNPQELQ 195
            ++C  +  +H     ++H D+K  NVLI+ +G  K+ DFG    +    +   N  + +
Sbjct: 512 VEICLALRFIHDSCS-IVHLDLKPANVLITFEGNLKLADFGMATKLPIEDKSFENEGDRE 570

Query: 196 YVQHDVMKNTTAQYRS 211
           Y+  +++++    +R+
Sbjct: 571 YIAPEIIRDGIYDFRA 586

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 91/195 (46%), Gaps = 42/195 (21%)

Query: 9    YPPGFVIKVGSHQAKILK-----------------YLTSGGFAQIYS-VEISPKDEYTNS 50
            Y  G VI    +Q+K+LK                 ++ SG F  +YS V +   D     
Sbjct: 1229 YSVGKVIDDTDNQSKLLKSLASSISNLSIRWQKRSFIGSGSFGTVYSAVNLDTGD----- 1283

Query: 51   NIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVF 106
             I  +K + + +   +      L+ E+  M++L N+ ++V Y      + +       V 
Sbjct: 1284 -ILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NHPNIVQYYGVEVHRDK-------VN 1334

Query: 107  LLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QVCQGIAAMHKLLPPLIHRDIKIENV 165
            + ME+CE  SL   +      R++++ V  +   Q+ +G+A +H+    ++HRDIK EN+
Sbjct: 1335 IFMEFCEGSSLASLLE---HGRIEDEMVTQVYTLQLLEGLACLHQ--SGVVHRDIKPENI 1389

Query: 166  LISGDGLFKVCDFGS 180
            L+  +G+ K  DFG+
Sbjct: 1390 LLDRNGVIKYVDFGA 1404

>Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C
           (CDC15) - protein kinase domain [contig 43] FULL
          Length = 868

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 17/110 (15%)

Query: 72  EVDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERL 129
           E+D   LLKN +H  +V Y         F   S+++F+L+EYC +GSL D +    R  +
Sbjct: 68  EID---LLKNLKHENIVKY-------HGFIQKSHQLFILLEYCSQGSLRDLIK---RGPV 114

Query: 130 QEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
           +EQ+    + Q   G+  +H     +IHRDIK  N+L+    + K+ DFG
Sbjct: 115 EEQQCKTYIRQTLHGLKYLHD--QGVIHRDIKAANLLLDAQNVVKLADFG 162

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 122/290 (42%), Gaps = 30/290 (10%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIY-SVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTE 72
           +IK G    K    +  G ++ +  +  I  K  Y       L +  +  +  +  +  E
Sbjct: 171 IIKKGIKDFKFGSVIGDGAYSTVMLATSIDTKKRYA---AKVLNKEYLIRQKKVKYVSIE 227

Query: 73  VDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQ 132
             A++ L N+  VV         S F + S  ++ L+EY   G  L  M  K    L E 
Sbjct: 228 KTALQKLNNSPSVVRLF------STFQDES-SLYFLLEYAPNGDFLSLM--KKYGSLDET 278

Query: 133 EVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQ 192
                  Q+   I  +H     +IHRDIK EN+L+ G+   K+ DFG+   ++ P  N  
Sbjct: 279 CARYYAAQIIDAIDYLHS--NGIIHRDIKPENILLDGEMKIKLTDFGT-AKLLNPTNN-- 333

Query: 193 ELQYVQHDVMKNT-----TAQYRSPEMIDLVKGFPIER-KIRHLGSWCVALQIMLLHYTF 246
            +   ++D+   +     TA+Y SPE+++    F   R  I   G  C+  Q++     F
Sbjct: 334 SVSKPEYDLSTRSKSFVGTAEYVSPELLN--DSFTDYRCDIWAFG--CILFQMIAGKPPF 389

Query: 247 REDREVAILNG--RYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
           +   E        + QY   P +   ++++V+ +L  +  +R  I Q+ E
Sbjct: 390 KATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKE 439

>YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Thr
           protein kinase involved in salt tolerance; funtions in
           regulation of Trk1p-Trk2p potassium transporter;
           partially redundant with Hal5p; has similarity to Npr1p
          Length = 603

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 92/204 (45%), Gaps = 18/204 (8%)

Query: 98  FGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIH 157
           F +   E   +MEYC  G L   +      +L+  E      Q+ +G+  MH++   + H
Sbjct: 392 FQDAKGEYCEVMEYCAGGDLFTLVVAA--GKLEYMEADCFFKQLIRGVVYMHEM--GVCH 447

Query: 158 RDIKIENVLISGDGLFKVCDFG-SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMID 216
           RD+K EN+L++ DG+ K+ DFG S C  +   +N      +        ++ Y +PE   
Sbjct: 448 RDLKPENLLLTHDGVLKITDFGNSECFKMAWEKN------IHLSGGVCGSSPYIAPEEYI 501

Query: 217 LVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILN---GRYQYPAY-PIYS---D 269
             +  P    I   G   +A++     ++  E  +   +N   GR +   Y PI S    
Sbjct: 502 KEEFDPRPVDIWACGVIYMAMRTGRQLWSSAEKDDPFYMNYLKGRKEKGGYEPIESLKRA 561

Query: 270 RLKNVVRVLLSPHPVKRPNICQLL 293
           R +NV+  +L P P +R N  Q+L
Sbjct: 562 RCRNVIYSMLDPVPYRRINGKQIL 585

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 124/290 (42%), Gaps = 30/290 (10%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIY-SVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTE 72
           ++K G    K    +  G ++ +  +  I  K +Y       L +  +  +  +  +  E
Sbjct: 175 IVKKGIKDFKFGAVIGDGAYSTVMLATSIDTKKKYA---AKVLNKEYLIRQKKVKYVSVE 231

Query: 73  VDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQ 132
             A++ L N+  VV         S F + S  ++ L+EY   G  L  M  K    L E 
Sbjct: 232 KIALQKLNNSHSVVRLF------STFQDES-SLYFLLEYAPNGDFLSLM--KKYGSLDEN 282

Query: 133 EVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQ 192
                 +Q+   I  +H  +  +IHRDIK EN+L+ G+   K+ DFG+   ++ P  N  
Sbjct: 283 CACYYGSQIIDAIDHLH--VSGIIHRDIKPENILLDGEMRIKLTDFGT-AKLLEPTNNSS 339

Query: 193 ELQYVQHDVMKNT-----TAQYRSPEMIDLVKGFPIER-KIRHLGSWCVALQIMLLHYTF 246
                ++D+   +     TA+Y SPE+++    F   R  I   G  C+  Q++     F
Sbjct: 340 SKS--KYDLSTRSKSFVGTAEYVSPELLN--DSFTDYRCDIWAFG--CILFQMIAGKPPF 393

Query: 247 REDREVAILNG--RYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
           +   E        + QY   P +   ++++V+ +L  +  +R  I Q+ E
Sbjct: 394 KATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILIKNLDQRLTINQIKE 443

>CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON}
           similar to uniprot|P39073 Saccharomyces cerevisiae
           YPL042c cyclin-dependent CTD kinase
          Length = 567

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 111/225 (49%), Gaps = 22/225 (9%)

Query: 105 VFLLMEYCERGSL--LDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKI 162
           ++++ E+ E   L  + F +   +  +  + + +IM Q+  G++ +H+    ++HRD+K 
Sbjct: 239 IYMVYEFAEHDLLQIIHFHSHPEKRMIPPRMIRSIMWQILDGVSYLHQNW--VLHRDLKP 296

Query: 163 ENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFP 222
            N++++ DG+ K+ D     G+ R   N  +  Y    V+   T  YR+PE++   + + 
Sbjct: 297 ANIMVTMDGVVKIGDL----GLARKFSNMLQTMYTGDKVV--VTIWYRAPELLLGARHYT 350

Query: 223 IERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPH 282
               +  +G  C+  +++ L   F+   E A ++ +      P  +++L+ ++++L +P 
Sbjct: 351 PAIDLWAVG--CIFAELIGLQPIFKG--EEAKMDSK---KTVPFQANQLQRILKILGTPT 403

Query: 283 PVKRPNICQLLEEISKIQNIPCPIDN----FYLERSRHQGAVSVM 323
           P   P++ Q   E  ++   P   DN    F+    R + A+S++
Sbjct: 404 PKSWPHL-QKYPEYEQLSKFPKYRDNLPGWFHSAGGRDKHALSLL 447

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 91/209 (43%), Gaps = 37/209 (17%)

Query: 97  EFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           E      E+FL++EY + G L D++ +  R RL E+E ++   Q+ +G A  H     + 
Sbjct: 124 EVWENKLELFLVLEYVDGGELFDYLVS--RGRLSEKEAIHYFRQIIEGTAYCHSF--NIC 179

Query: 157 HRDIKIENVLIS-GDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTA--QYRSPE 213
           HRD+K EN+L+   +   K+ DFG              LQ   + +++ +     Y SPE
Sbjct: 180 HRDLKPENLLLDKKNKRIKIADFGMAA-----------LQ-TSNKLLETSCGSPHYASPE 227

Query: 214 MI--DLVKGFPIERKIRHLGSWCVALQIMLL---HYTFREDREVAIL----NGRYQYPAY 264
           ++      G P +        W   + +  L   H  F +D    +L     G+YQ P  
Sbjct: 228 IVMGKTYNGGPSD-------VWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ- 279

Query: 265 PIYSDRLKNVVRVLLSPHPVKRPNICQLL 293
              S   ++++  +L   P KR  I  +L
Sbjct: 280 -AISLEAQDLISRILVVDPNKRITINDIL 307

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 125/277 (45%), Gaps = 35/277 (12%)

Query: 27  YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVV 86
           +L  GGFA+ + ++      +    +A L    + ++     L +E+   K +K+  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMKHP-NIV 150

Query: 87  SYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIA 146
            + D     +        V++L+E C  GS+++ +  + R+ L E EV   M Q+   I 
Sbjct: 151 QFTDCFEDDTN-------VYILLEICPNGSVMELL--RQRKHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTT 206
            MH     +IHRD+K+ N+    +   K+ DFG    +     N +E +Y         T
Sbjct: 202 YMHS--RRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLA----NDKERKYTI-----CGT 250

Query: 207 AQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDREVAILNGR-----YQ 260
             Y +PE++     G   E  I  +G   V L  +L      + +EV  +  R     + 
Sbjct: 251 PNYIAPEVLTGKHTGHSYEVDIWSIG---VMLYALLFGKPPFQAKEVETIYERIKCRDFI 307

Query: 261 YPA-YPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296
           +PA  P+ SD  KN++  LL  +P  RP++ ++ + +
Sbjct: 308 FPADKPVSSD-AKNLISHLLQLNPAARPSLYEITDNV 343

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 86/378 (22%), Positives = 157/378 (41%), Gaps = 35/378 (9%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEV 73
           +I+ G    K    L  G ++Q++ +  S  D      +  L +  +  +  +  +  E 
Sbjct: 110 IIRKGIKDFKFGDMLGDGSYSQVF-LATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEK 168

Query: 74  DAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQE 133
            A++ LK+   V   I+ +    +  N    ++ L+EY   G  L  +  K    L E+ 
Sbjct: 169 TALQNLKS---VTGVINLSFTFQDEAN----LYFLLEYAPNGDFLSLI--KKFGTLNEEC 219

Query: 134 VLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQE 193
            +    Q+   I +MH     +IHRDIK EN+L+ G+   K+ DFG+   + +      +
Sbjct: 220 TIYYSAQIIDAIGSMHS--HGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGK 277

Query: 194 LQY--VQHDVMKNTTAQYRSPEMI-DLVKGFPIERKIRHLGSWCVALQIMLLHYTFREDR 250
             Y  +        TA+Y SPE++ D    +  +  I   G  C+  Q++     F+   
Sbjct: 278 PHYNLLTRSSSFVGTAEYVSPELLSDNYTDYKCD--IWAFG--CLVYQMIAGKPPFKATN 333

Query: 251 EVAILNG--RYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKIQNIPCPIDN 308
           E        + Q+     +   ++++V+ +L   P KR  I Q+ E     +NI     N
Sbjct: 334 EYLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKEHCL-FENI-----N 387

Query: 309 FYLERSRHQGAVSVMPVNFSRANTTQFTD-------QSAKETTAIRVGKEISPLKPQLSP 361
           F      ++    ++P   +  +   F+        Q +K+   I VGK I  ++ + + 
Sbjct: 388 FSDNSVWNRDPPKILPYRINAKSMQPFSPPIPQSPFQKSKDDKHIIVGKNIKYIRKRTNL 447

Query: 362 IKSSYGPVLVMTKTTPNS 379
             S   P L  TK+ PNS
Sbjct: 448 PNSISSPNL-DTKSAPNS 464

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 94/215 (43%), Gaps = 50/215 (23%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLR-ERLQEQEVLNIMNQVCQGIAAMHKLLPPL 155
           GSY     +++++EYC  GSL     T LR  ++ E+ +  IM +V   +  +HK    +
Sbjct: 93  GSYLKDTTLWIIIEYCAGGSL----RTLLRPGKIDEKYIGIIMREVLIALKYIHK--DNV 146

Query: 156 IHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ---YRSP 212
           IHRDIK  NVLI+ +G  K+CDFG               Q  Q  + + T A    + +P
Sbjct: 147 IHRDIKAANVLITNEGHVKLCDFGVAA------------QLNQSSLKRQTMAGTPYWMAP 194

Query: 213 EMIDLVKGFPIERKIRHLG-----------SWC--VALQIMLLHYTFREDREVAILNGRY 259
           E+I     +  +  I  LG            +C   AL+ M L    +  R    L GR+
Sbjct: 195 EVIMEGVSYDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPR----LEGRH 250

Query: 260 QYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLE 294
                  YS  LK  + + L   P +R +   LL+
Sbjct: 251 -------YSPMLKEFIALCLDEDPKERLSADDLLK 278

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 93/211 (44%), Gaps = 42/211 (19%)

Query: 105 VFLLMEYCERGSLLDFMNTKLR-ERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIE 163
           ++++MEYC  GS+     T LR  ++ E+ +  IM ++   +  +HK    +IHRDIK  
Sbjct: 114 LWIIMEYCAGGSV----RTLLRPGKIDEKYIAVIMRELLVALHYIHK--DNVIHRDIKAA 167

Query: 164 NVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQ---YRSPEMIDLVKG 220
           N+LI+ +G  K+CDFG               Q  Q+ + + T A    + +PE+I  ++G
Sbjct: 168 NLLITNEGNVKLCDFGVAA------------QLNQNTMRRQTMAGTPYWMAPEVI--MEG 213

Query: 221 FPIERKIRHLGSWCVALQIMLLHYTFREDREV-----------AILNGRYQYPAYPIYSD 269
              + K         A +I   +  F E   +           A L G+   P       
Sbjct: 214 ISYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPL------ 267

Query: 270 RLKNVVRVLLSPHPVKRPNICQLLEEISKIQ 300
            LK  + + L   P +RP   +LL E + I+
Sbjct: 268 -LKEFIAMCLDEDPQERPTADKLLHESAFIK 297

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 64/110 (58%), Gaps = 15/110 (13%)

Query: 78  LLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVL 135
           ++K +RH  VV++I+++ +K   GN    ++++MEY E GSL D +   L   L E ++ 
Sbjct: 565 VMKESRHNNVVNFINAHLSK---GN----LWIVMEYMEGGSLTDVVTHCL---LSEGQIG 614

Query: 136 NIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
            +  +  +G+  +H     +IHRDIK +NVL+S  G  K+ DFG  C  I
Sbjct: 615 AVCRETLEGLKFLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFG-FCAQI 661

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 90/210 (42%), Gaps = 53/210 (25%)

Query: 105 VFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIEN 164
           V++ +EYC    L +++   +++R+   E  ++ +Q+   +   H +    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSM--KCVHRDLKLEN 158

Query: 165 VLISGDGLFKVCDFG------------SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSP 212
           +L+   G  K+ DFG            +VCG                      T  Y +P
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGILETVCG----------------------TTVYMAP 196

Query: 213 EMIDL--VKGFPIERKIRHLGSWCVALQI-MLLHYTFREDREVAILNGRYQYPAYPIYSD 269
           E+I+    +G+ I+       +W + + +  ++H     D E  I          P Y D
Sbjct: 197 ELIERKPYEGYKID-------TWSLGIILYTMIHGAMPFDEEDDIKTKYRIVNNEPFYDD 249

Query: 270 RL-----KNVVRVLLSPHPVKRPNICQLLE 294
                  K+++  LL   P +RP++ Q+L+
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQ 279

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +      ++ E+ +  IM ++   +  +HK    +I
Sbjct: 101 GSYLKDTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKYIHK--DNVI 155

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 156 HRDIKAANVLITNEGSVKLCDFG 178

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 9/83 (10%)

Query: 101 GSY----EVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLI 156
           GSY     ++++MEYC  GSL   +      ++ E+ +  IM ++   +  +HK    +I
Sbjct: 87  GSYLKDTSLWIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKCIHK--DNVI 141

Query: 157 HRDIKIENVLISGDGLFKVCDFG 179
           HRDIK  NVLI+ +G  K+CDFG
Sbjct: 142 HRDIKAANVLITNEGNVKLCDFG 164

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 61/110 (55%), Gaps = 15/110 (13%)

Query: 78  LLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVL 135
           +++ ++H  +V++IDS  AK +        +++MEY E GSL D +   L   L E ++ 
Sbjct: 668 VMRESKHSNIVNFIDSYLAKGDL-------WIVMEYMEGGSLTDVVTHCL---LSEGQIG 717

Query: 136 NIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
            +  +  +G+  +H     ++HRDIK +N+L+S  G  K+ DFG  C  I
Sbjct: 718 AVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNIKLTDFG-FCAQI 764

>Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W
           (REAL)
          Length = 838

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 63/114 (55%), Gaps = 15/114 (13%)

Query: 73  VDAMKLLKNNRH--VVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFM-----NTKL 125
           V+ + ++K++RH  +V+++++     +      +++++MEY E GSL D +     N   
Sbjct: 604 VNEILVMKDSRHKNIVNFLEAYLRTDD------DLWVVMEYMEGGSLTDIIENSPTNDTS 657

Query: 126 RERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179
              L E ++  I+ + CQG+  +H     +IHRDIK +NVL+      K+ DFG
Sbjct: 658 HSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRARVKITDFG 709

>SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {ON}
           similar to uniprot|P32944 Saccharomyces cerevisiae
           YJL187C SWE1 Protein kinase that regulates the G2/M
           transition by inhibition of Cdc28p kinase activity
           localizes to the nucleus and to the daughter side of the
           mother-bud neck homolog of S. pombe Wee1p potential
           Cdc28p substrate
          Length = 748

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 92/196 (46%), Gaps = 24/196 (12%)

Query: 28  LTSGGFAQIYSVEISPKD-EYTNSNIA-----CLKRVIVPNKSGLNVLRTEVDAMKLLKN 81
           + +G F+Q+Y V   P +  Y   +I        KR++   +    +  T +D     + 
Sbjct: 419 IGTGQFSQVYQVTFGPANTRYAVKSIQPKKYNSRKRILQEIELLSEISETTLDQ----EG 474

Query: 82  NRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKL---RERLQEQEVLNIM 138
             +VV+YI S   +     G+Y  +++ EYCE GSL  F+  ++     RL++  V  I+
Sbjct: 475 KEYVVAYISSWKHQ-----GAY--YVMTEYCENGSLDGFLREQVIAKNTRLEDWRVWKII 527

Query: 139 NQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI---IRPPRNPQELQ 195
            ++   +  +H     ++H D+K  NVLI+ +G  K+ DFG    +        N  + +
Sbjct: 528 VELSLALRFIHDSCR-VVHLDLKPANVLITFEGTLKLADFGMAAKLPISEEGFENEGDRE 586

Query: 196 YVQHDVMKNTTAQYRS 211
           Y+  +++ +    +R+
Sbjct: 587 YIAPEIIADGVYDFRA 602

>YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstream
           serine/threonine kinase for the SNF1 complex; partially
           redundant with Elm1p and Tos3p; members of this family
           have functional orthology with LKB1, a mammalian kinase
           associated with Peutz-Jeghers cancer-susceptibility
           syndrome
          Length = 1142

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 47/84 (55%), Gaps = 8/84 (9%)

Query: 102 SYEVFLLMEYCERGSLL----DFMNTKLR--ERLQEQEVLNIMNQVCQGIAAMHKLLPPL 155
           S +++L++EYC RG +     D M +  +    L  QE   I+  V  G+  +H     +
Sbjct: 216 SRKIYLVLEYCSRGEVKWCPPDCMESDAKGPSLLSFQETREILRGVVLGLEYLH--YQGI 273

Query: 156 IHRDIKIENVLISGDGLFKVCDFG 179
           IHRDIK  N+LISGDG  K+ DFG
Sbjct: 274 IHRDIKPANLLISGDGTVKISDFG 297

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 23/185 (12%)

Query: 111  YCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGD 170
            + E G +  F   +L+  + E E   I  QV   I  +H     ++HRDIK ENV++   
Sbjct: 1090 HGETGCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSK 1147

Query: 171  GLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHL 230
            G  K+ DFGS   +   P           DV   T   Y +PE++    G P + K + +
Sbjct: 1148 GFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDI 1193

Query: 231  GSWCVALQIMLLHYTFREDREV---AILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRP 287
              W  A+ ++L    F+E+       IL    ++      S+   N+++++L+ +P +RP
Sbjct: 1194 --W--AIGVLLYTIVFKENPFYNIDEILEVNLKFHGTKGVSEECINLIKMILNKNPSQRP 1249

Query: 288  NICQL 292
             I ++
Sbjct: 1250 TIDEV 1254

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/298 (22%), Positives = 130/298 (43%), Gaps = 48/298 (16%)

Query: 14  VIKVGSHQAKILKYLTSGGFAQIY-SVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTE 72
           VI  G    K  + L  G ++ +  +  I  K +Y    +  L +  +  +  +  +  E
Sbjct: 203 VILKGIKDFKFGEVLGDGSYSTVMLATSIETKKKYA---VKVLSKEYLIKQKKVKYVNIE 259

Query: 73  VDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQ 132
            +A++ L N+R +V    +   ++        ++ L+EY   G  L  +           
Sbjct: 260 KNALQKLNNSRGIVRLFFTFQDEAS-------LYFLLEYAPNGDFLSLIKK--------- 303

Query: 133 EVLNIMNQVC------QGIAAMHKLLP-PLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                MN+ C      Q I A+H +    +IHRDIK EN+L+  +   K+ DFG+   I+
Sbjct: 304 --FGSMNEDCASYYSAQIIDAIHFVHSRGIIHRDIKPENILLDSEMKVKLTDFGT-AKIL 360

Query: 186 RPPRNPQELQYVQHDVMKNT-----TAQYRSPEMIDLVKGFPIER-KIRHLGSWCVALQI 239
            P  +    ++  +D++  +     TA+Y SPE+++    +   R  I   G  C+  Q+
Sbjct: 361 EPKSSSSSSKHETYDLLTRSKSFVGTAEYVSPELLN--DSYADSRCDIWAFG--CIVFQM 416

Query: 240 MLLHYTFREDREV----AILNGRYQYPA-YPIYSDRLKNVVRVLLSPHPVKRPNICQL 292
           +     F+   E      ++  +Y + A +P+    ++++V+ +L   P +R  I Q+
Sbjct: 417 IAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVKRILIKAPEQRLTISQI 471

>Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] {ON}
            YNR031C (REAL)
          Length = 1581

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 83/163 (50%), Gaps = 23/163 (14%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F +++S       +  N  I  +K + + +   +     +++ E+  +++L N+
Sbjct: 1273 FVGGGTFGRVFSAV-----DLDNGEILAVKEINIQDSKAMKKIFPLIKEEMSVLEIL-NH 1326

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++VSY      + +       V + MEYCE GSL   +      R++++ V  +   Q+
Sbjct: 1327 PNIVSYYGVEVHRDK-------VNIFMEYCEGGSLAALLE---HGRIEDEMVTQVYTLQL 1376

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGI 184
             +G+A +H+    ++HRD+K EN+L+  +G+ K  DFG+   I
Sbjct: 1377 LEGLAYLHE--SGIVHRDVKPENILLDFNGVIKYVDFGAAKKI 1417

>SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} similar
           to uniprot|P27636 Saccharomyces cerevisiae YAR019C CDC15
           Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p
          Length = 912

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 112/264 (42%), Gaps = 39/264 (14%)

Query: 37  YSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRH--VVSYIDSNAA 94
           Y +     +  T   +A +K +   N+  LN    E+D   LLKN RH  +V Y      
Sbjct: 51  YGIVYKAVNRQTRKEVA-IKVIEYDNEEELNDHMLEID---LLKNLRHPNIVKY------ 100

Query: 95  KSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPP 154
              F    +++ +L+EYC RGSL D      +  + EQ+    + Q  QG+  +H     
Sbjct: 101 -HGFIQKRHQLCILLEYCSRGSLRDVFK---QHPIDEQQARVYVQQTLQGLQYLHS--QG 154

Query: 155 LIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEM 214
           +IHRDIK  N+L+      K+ DFG     +    N   + Y         +  + SPE+
Sbjct: 155 VIHRDIKAANLLLDAQNTVKLADFG-----VSTRVNSLAMTYA-------GSPNWMSPEV 202

Query: 215 IDLVKGFPIERKIRHLGSWCVALQIML----LHYTFREDREVAILNGRYQYPAYPIYSDR 270
           + L KG      +  LG+    ++I+      H    E    AI+N  Y  PA+   S  
Sbjct: 203 M-LGKGATTVSDVWSLGA--TVVEILTGNPPFHNLVNEAACYAIVNDVYYPPAW--LSRP 257

Query: 271 LKNVVRVLLSPHPVKRPNICQLLE 294
             + +      +  KRP+  +LL+
Sbjct: 258 CCDFIHRCFQKNMFKRPSATELLK 281

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 83/156 (53%), Gaps = 22/156 (14%)

Query: 30  SGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLNVLRTEVDAMKLLKNNRHVVSYI 89
           SGG    Y +        TN+++A +K++ +  +    ++  E+  MK  K+N ++V++I
Sbjct: 709 SGGVYTAYEL-------GTNASVA-IKQMNLEKQPKKELIVNEILVMKGSKHN-NIVNFI 759

Query: 90  DSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMNQVCQGIAAMH 149
           DS   + +       ++++MEY E GSL D +   +   L E ++  +  +  +G+  +H
Sbjct: 760 DSYLFRGD-------LWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGLQFLH 809

Query: 150 KLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGII 185
                +IHRDIK +N+L+S +G  K+ DFG  C  I
Sbjct: 810 S--KGVIHRDIKSDNILLSMNGDIKLTDFG-FCAQI 842

>ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} similar
           to uniprot|P39073 Saccharomyces cerevisiae YPL042C SSN3
           Component of RNA polymerase II holoenzyme involved in
           RNA pol II carboxy-terminal domain phosphorylation
          Length = 607

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 102/207 (49%), Gaps = 18/207 (8%)

Query: 105 VFLLMEYCERGSL--LDFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKI 162
           ++++ E+ E   L  + F +   +  + ++ + +IM Q+  G++ +H+    ++HRD+K 
Sbjct: 276 IYMVYEFAEHDLLQIIHFHSHPEKRMIPQKMIGSIMWQILDGVSYLHQNW--ILHRDLKP 333

Query: 163 ENVLISGDGLFKVCDFGSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFP 222
            N++++ DG  KV D     G+ R   N  +  Y    V+   T  YR+PE++   + + 
Sbjct: 334 ANIMVTVDGCVKVGDL----GLARKFYNMLQTLYTGDKVV--VTIWYRAPELLLGARHYT 387

Query: 223 IERKIRHLGSWCVALQIMLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPH 282
               +  +G  C+  +++ L   F+   E A ++ +    + P  S++L+ ++ VL SP+
Sbjct: 388 PAIDLWAVG--CIFAELIGLQPIFKG--EEAKMDSK---KSVPFQSNQLQRILEVLGSPN 440

Query: 283 PVKRPNICQLLEEISKIQNIPCPIDNF 309
               PNI +   E  ++   P   DN 
Sbjct: 441 QKNWPNIHK-YPEYEQLGKFPKYRDNL 466

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 115/270 (42%), Gaps = 56/270 (20%)

Query: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLL-- 118
           P ++  N ++ E+  MK   NN+HVV  I+     S     S +++L++EYCE+G +L  
Sbjct: 136 PKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLS-----SRKIYLVLEYCEKGPILWC 189

Query: 119 --DFMNTKLRE--RLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFK 174
             D +    R   +L  Q    I   V  G+  +H     +IHRDIK  N+L+  +G+ K
Sbjct: 190 PRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLHS--QGIIHRDIKPANLLMDKNGVVK 247

Query: 175 VCDFG-SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMI--------------DLVK 219
           + DFG S+        N  EL+  +       T  + +PE+               +L  
Sbjct: 248 ISDFGVSLAANGNIDTNDDELELTK----TVGTPVFYAPEICLGAAAMERFNLDKDELFN 303

Query: 220 GFPIERKIRHLGSWCVALQIMLLHYT---FREDREV----AILNGRYQYPAYPIYSD--- 269
           G  I  KI     W + + +  L +    F  + E+     I+N + ++P +    D   
Sbjct: 304 GSCISFKI---DIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHI 360

Query: 270 ----------RLKNVVRVLLSPHPVKRPNI 289
                       K+++  LL  +P KR +I
Sbjct: 361 SEISHIREFVHAKDLLNKLLEKNPAKRISI 390

>NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341
          Length = 1836

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 82/165 (49%), Gaps = 23/165 (13%)

Query: 27   YLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIVPNKSGLN----VLRTEVDAMKLLKNN 82
            ++  G F  ++S          N  I  +K + + + + +     +++ E+  +++L N+
Sbjct: 1534 FIGGGTFGTVFSAV-----NLDNGEILAVKEIRIQDSTTMKKIFPLIKEEMTVLEML-NH 1587

Query: 83   RHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLNIMN-QV 141
             ++V Y      + +       V + MEYCE GSL   +      R++++ V  I   ++
Sbjct: 1588 PNIVQYYGVEVHRDK-------VNIFMEYCEGGSLASLLE---HGRIEDEMVTQIYTLEL 1637

Query: 142  CQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIR 186
             +G+A +H+    ++HRDIK EN+L+  +G+ K  DFG+   I +
Sbjct: 1638 LEGLAYLHQ--AGVVHRDIKPENILLDFNGIIKYVDFGAARKIAK 1680

>CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {ON}
           similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054w SMK1 sporulation-specific MAP kinase or
           uniprot|Q00772 Saccharomyces cerevisiae YHR030c SLT2
           ser/thr
          Length = 432

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 22/204 (10%)

Query: 19  SHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRV--IVPNKSGLNVLRTEVDAM 76
           S + +I++ L  G +  + S +    +E        +K++  I   K  L     E+  M
Sbjct: 66  SGKYEIIQVLGKGSYGVVCSAKHKLDNEDQEQFTVAIKKITNIFYRKILLKRAIREIKFM 125

Query: 77  KLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDFMNTKLRERLQEQEVLN 136
              K ++H+V+ ID    + +  +G Y    L++Y     L   +++ ++  L E  + +
Sbjct: 126 NYFKGHKHIVNLIDIEIVQDKPYDGLYCYQELIDY----DLARVIHSSVQ--LSEFHIQH 179

Query: 137 IMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGSVCGIIRPPRN----PQ 192
            + Q+  G+  +H     +IHRD+K  N+L + +G  K+CDFG   G+ +   N    P 
Sbjct: 180 FIYQILCGVKYIHS--ADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPN 237

Query: 193 EL-QYVQHDVMKNTTAQYRSPEMI 215
           E+  YV        T  YR+PE+I
Sbjct: 238 EITNYV-------ATRWYRAPELI 254

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 86,105,315
Number of extensions: 3957402
Number of successful extensions: 15866
Number of sequences better than 10.0: 1937
Number of HSP's gapped: 15932
Number of HSP's successfully gapped: 2008
Length of query: 788
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 670
Effective length of database: 39,950,811
Effective search space: 26767043370
Effective search space used: 26767043370
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)