Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A054102.290ON26626612381e-174
SAKL0E07590g2.290ON2602376962e-91
TDEL0G022002.290ON2612376926e-91
Ecym_33292.290ON2582376883e-90
KAFR0J013502.290ON2642386832e-89
Kpol_1003.402.290ON2612376797e-89
ZYRO0A01958g2.290ON2632666762e-88
NDAI0B035402.290ON2612406762e-88
NCAS0B062402.290ON2602396762e-88
KLTH0G10450g2.290ON2612376711e-87
KLLA0E08273g2.290ON2612306614e-86
TBLA0B059602.290ON2662376572e-85
Kwal_27.115092.290ON2612326544e-85
TPHA0C034202.290ON2682406467e-84
Smik_9.862.290ON2642396432e-83
Skud_9.802.290ON2642396397e-83
Suva_9.1062.290ON2642396292e-81
YIL093C (RSM25)2.290ON2642396241e-80
CAGL0D04158g2.290ON2722376093e-78
ADL211C2.290ON2251795091e-63
TDEL0D009304.325ON255110740.61
NCAS0B01030singletonON33797740.67
Skud_13.814.325ON25591720.85
KAFR0C05290singletonON56593721.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A05410
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   481   e-174
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   272   2e-91
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   271   6e-91
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   269   3e-90
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   267   2e-89
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   266   7e-89
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   265   2e-88
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   265   2e-88
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   265   2e-88
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   263   1e-87
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   259   4e-86
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   257   2e-85
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   256   4e-85
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   253   7e-84
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   252   2e-83
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   250   7e-83
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   246   2e-81
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   244   1e-80
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   239   3e-78
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   200   1e-63
TDEL0D00930 Chr4 (169201..169968) [768 bp, 255 aa] {ON} Anc_4.32...    33   0.61 
NCAS0B01030 Chr2 (163625..164638) [1014 bp, 337 aa] {ON}               33   0.67 
Skud_13.81 Chr13 (144597..145364) [768 bp, 255 aa] {ON} YML063W ...    32   0.85 
KAFR0C05290 Chr3 (1060077..1061774) [1698 bp, 565 aa] {ON}             32   1.4  

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  481 bits (1238), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 236/266 (88%), Positives = 236/266 (88%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRM 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSXXX 240
                      AAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS   
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSESW 240

Query: 241 XXXXXXXXXXXXXXXKDGQEVENLFL 266
                          KDGQEVENLFL
Sbjct: 241 NPEELEGENEETAEEKDGQEVENLFL 266

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  272 bits (696), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 131/237 (55%), Positives = 167/237 (70%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MK+QTNAVN+LERTSA+L +G++ K PAWYNVVA+ PP K F R+P   NPS  K   +L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
             + ++    +  YKTR S +D++VS N LY+ PKL Y ED+LR+LFY QHPWE SRP +
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           LIEN     +DWS IQQLGK LDGESVVQR L+LL+     +L  AYD+ARFEFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      A M+GSV+  S+IE+GLEKE KVIETWK++ I++TE M AR + PS
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  271 bits (692), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 171/237 (72%), Gaps = 1/237 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+LERTSA+L SG+++  PAWY+VVA+ PPK KF R+P  +NPS  K   +L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           K   D   NA   +KTR S  DK++++  LYR PKL ++EDQLR++FY QHPWE SRP +
Sbjct: 61  KDHADEP-NAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           L+EN+   +FDWS IQQL K LDGESV+QR LFLL+     SL+ AYD+ARFEFYR+RM 
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      + M+GS+Y  SAI+FG+++E K I+ WK++ I+ET+ + ARRA+PS
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPS 236

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  269 bits (688), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 129/237 (54%), Positives = 163/237 (68%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNA NILERTS+FL  G++ + P WY+V+  +PP  KF R+P  VNPSTG     L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           + F D++ ++   YKTR +  +K+VS +A+YR PKL Y ED+LR LFY QHPWE SRP I
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           L+EN    K DWSRIQQLGK LDGESVVQR L+LL  G   +L  AYD+ARFEFYR+RM 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      A M GSV+  SA+EFGL KE +VI+ WK++ +K+ E M A+R+  S
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQS 237

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  267 bits (683), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 170/238 (71%), Gaps = 2/238 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNA NILERTSA+L++G+++  PA+Y+V+A  PP  KF R+P  VNPSTG+ R   
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           +   D K N   +YKTRY+ +D+  S + LY+  +L YLED LRQLFYDQHPWE SRP I
Sbjct: 61  RELTD-KVNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 121 LIENNV-TPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRM 179
           +IENN+     DWS IQQLGK +DGESVVQR LFL++    D+L+  YD+ARFEFY++RM
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 180 XXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                       AAM+GS++  +A+E+G+++E  VI  WK+R I+ETE + A+RA+PS
Sbjct: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPS 237

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  266 bits (679), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 165/237 (69%), Gaps = 1/237 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQ NAVN+LERTSA+L +G++ K PAWYNVVA+ PP KKFER P   NPS  +    L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
            S LDS    + ++KTRY+  D+  +   LY   KL Y+EDQLR++FY QHPWE SRP I
Sbjct: 61  HS-LDSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           LIENN   K+DWS +QQ+GK LDGESVVQR L+L++     SL  AYD AR+EFYR+RM 
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      A M+GSV+  SAIE+G++KE KVI+TWKR+ I +TE M ARR +PS
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPS 236

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  265 bits (676), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 175/266 (65%), Gaps = 3/266 (1%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MK+QTNAVN+LERTSA+L SG++++ PAWY VVA+ PP  KF R+  F+NPSTGK  V  
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           K F D   N    YKTR S  D++   + LY+ PKL +LEDQLR++FY QHPWE SRP +
Sbjct: 61  KEF-DEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           L+EN +   FDWS + QLGK LDGESVVQR ++LL+      +  AYD+ RFEFYR+RM 
Sbjct: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSXXX 240
                      A M+GSV++ SAI++G+E+E +VI+ WK++ I+ETE + ARRASP+   
Sbjct: 180 EEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPA--E 237

Query: 241 XXXXXXXXXXXXXXXKDGQEVENLFL 266
                          +DGQE E L L
Sbjct: 238 SWGQEKQEGEPNKSDEDGQETEELHL 263

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  265 bits (676), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 170/240 (70%), Gaps = 7/240 (2%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN++ERTSA+L SG++Q  PAWY+VVA+ PP KKF R+P   NP+TG+     
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRN---- 56

Query: 61  KSFLDSKR---NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSR 117
           K+F    R   N   +YKTR +  D++ S N LY+PPKL+YLED+LR LF++QHPWE SR
Sbjct: 57  KTFFKDDRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSR 116

Query: 118 PMILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRI 177
           P ILIEN++   FDWS IQQ  K+LDGESVVQR L+LL+     ++  AY+KARFEFYR+
Sbjct: 117 PKILIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRL 176

Query: 178 RMXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           R+            A M+GS++ Q++ E G+EKE KVIE WK++ I+ET+ M  R ++PS
Sbjct: 177 RIQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPS 236

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  265 bits (676), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 130/239 (54%), Positives = 173/239 (72%), Gaps = 6/239 (2%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           M++QTNA+NI+ERTSA+L+SG+++  PAWY VVA  PP KKF R+P  +NPST +   +L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNE---DL 57

Query: 61  KSFLDSKR--NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRP 118
               D++   N    YKTR +  D++V+ N LY+PPKL Y+EDQLR LF+DQHPWE SRP
Sbjct: 58  AVLRDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRP 117

Query: 119 MILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178
            IL+EN++  +FDWS IQQLGK LDGESVVQR ++LL+    D + TAY++ARFEFYR R
Sbjct: 118 KILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKMDMI-TAYNQARFEFYRFR 176

Query: 179 MXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           +            A M+GSV+ QS I+FG+EKE KVI+ WK++  +ETE + ARRA+PS
Sbjct: 177 IQQEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPS 235

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  263 bits (671), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 166/237 (70%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MK+Q NAVN+LERTS++L++G+++K PAWY+VVA  PP K+F R+P  VNPST K    L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
             F +     +  YKTR S +++QVS + L+  PKL Y ED+LR++FY+QHPWE SRP +
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           L+EN+ T  +DWS IQQLGK LDGESVVQR L+LL       L  AYD+ARFEFYR+R+ 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      A M+GSV+  SAI+FGLEKE K+I+ WK++ I +TE M AR  +PS
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPS 237

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  259 bits (661), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 122/230 (53%), Positives = 164/230 (71%), Gaps = 1/230 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MK+Q  AVN+LERTSA+L+SG+++K PAWYNV+A  PP KKF R P   +P  GK+R  L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
             + + K N+  +YKTR +  +K+   + LY+ PKLVY+ED+LR+LF+ QHPWE SRP I
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 LIENNV-TPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRM 179
           L+EN + T ++DWS IQQLGK LDGESVVQR LFLL+ G    L  AYD+ARFEFYR+R+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 180 XXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAM 229
                       A M+GSV+  ++IE+G+ KE KVI+TWKR+ +++ E M
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELM 230

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  257 bits (657), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 124/237 (52%), Positives = 166/237 (70%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQ NAVN+LERTSA+L++G+I+K P WY+VVAA PP KKF R+P F+NPST K  V  
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           K   D       +YKTR +  DK+ + ++LY+ PKL Y+ED+LR+LFY+QHPWE +RP I
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           ++EN+    +DWSR+ QLGK LDGESVVQR LFLL+      L  AY++ARFEFYR+RM 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      + M+G+V+  + IEFG+EKE ++I++WK   IKETE   A+R+  S
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKES 237

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  256 bits (654), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 123/232 (53%), Positives = 160/232 (68%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MK+Q NAVN+LERTS++L +G+++K PAWY VVA  PP K+F R+P  VNPST      L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
             F +S    +  YKTR S  DKQVS N LY+ PKL Y ED+LR+LF++QHPWE SRP +
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           L+EN+    +DWS +QQLGK LDGESVVQR L+LL+      L  AYD+ARFEFYR+R+ 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLAR 232
                      A M GSV+  SAI+FGL+KE K+I+ WK++ I ++E + AR
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSAR 232

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  253 bits (646), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 127/240 (52%), Positives = 162/240 (67%), Gaps = 3/240 (1%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQ NAVN+LERTS++L SG++ K PAWYNVVA  PP KKFER P F NPS  K    L
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  KSF---LDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSR 117
           +     L S RN   ++K+RY+  DK+ S   +Y+P KL Y+EDQLR++FY QHPWE SR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 118 PMILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRI 177
           P I++ENN    +DWS IQQLGK LDGE+VVQRA++L++            KAR+EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 178 RMXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           RM            A M+GSV+  S IEFG+++E KVI+ WKR+ I ETE M A+R +PS
Sbjct: 181 RMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNPS 240

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  252 bits (643), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 119/239 (49%), Positives = 169/239 (70%), Gaps = 2/239 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+L+RTSA+L+SG+++  PAWYNVVA+ PP  KF R+P F NPS G     L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  KSFLDSKR-NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPM 119
              ++++  N++ +YKTR +  DK++    LY+PPKL Y+ED+LR LFY QHPWE SRP 
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 120 ILIENNVTPK-FDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178
           IL+EN +  + +DWS + QLGK LDGESV+QR ++LL+    ++   AYD AR+EFY +R
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 179 MXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           M            A M+GS++ +SAIE G++KE +V+  W+++VI+ETE M AR ++P+
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPA 239

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  250 bits (639), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 121/239 (50%), Positives = 166/239 (69%), Gaps = 2/239 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+L+RTSA+L+SG++++ PAWYNVVA+ PP  KF R+P F NPS G     L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  KSFLDSKR-NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPM 119
                 +  N + +YKTR +  DK+VS   LY+PPKL Y+ED+LR LFY QHPWE SRP 
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 120 ILIENNVTPK-FDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178
           IL+EN +  + +DW R+ QLGK LDGESVVQR + LL+    + +  AYD AR+EFY +R
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 179 MXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           M            A M+GS++  SAIE G++KE +V++ W+++VI+ETE M A+ ++P+
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPA 239

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  246 bits (629), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 167/239 (69%), Gaps = 2/239 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+L+RTSA+L+SG+++  PAWYNVVA+ PP  KF R+P F NPS G+    L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  KSFLDSKR-NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPM 119
               + ++ NA+ +YKTR +  D++V    LY+PPKL Y+ED+LR LFY QHPWE SRP 
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 120 ILIENNVTPK-FDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178
           IL+EN V  + +DWS + QLGK LDGESV+QR + LL+      +  AYD AR+EFY +R
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 179 MXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           M            A M+GS++  S+IE G++KE +V++ W+++VI+ETE M AR ++P+
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPA 239

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  244 bits (624), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 117/239 (48%), Positives = 165/239 (69%), Gaps = 2/239 (0%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+L+RTSA+L+SG++++ PAWYNVVA+ PP  KF R+P F NPS G     L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  KSFLDSKR-NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPM 119
               +    N   +YKTR + +DK+V    LYRPPKL Y+ED+LR LFY QHPWE SRP 
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 ILIENNVTPK-FDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178
           IL+EN +  + +DWS + Q+G+ LDGESV+QR ++L++      +  AYD AR+EFY +R
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 MXXXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
           M            A M+GS++  SAIE G++KE +V++ W+++V++ETE M AR ++P+
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPA 239

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  239 bits (609), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 117/237 (49%), Positives = 161/237 (67%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+LERTSA+L +GVI++ PAWYNVVA+ PP  KF R+P  +NPST K    L
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
           K       N + +YKTR++  +++V++  +Y+PPKLVYLED++R LFY QHPWE +RP I
Sbjct: 61  KDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPKI 120

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMX 180
           + EN +    DW  + QLG+ LDGE+VVQR L+LL+     +++ AYD+AR EFYR+RM 
Sbjct: 121 VSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRMQ 180

Query: 181 XXXXXXXXXXXAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPS 237
                      A M+GSV+  S IE G+ KE +VIE WKR    ++E + A++ + S
Sbjct: 181 QELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  200 bits (509), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 96/179 (53%), Positives = 128/179 (71%), Gaps = 2/179 (1%)

Query: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60
           MKIQTNAVN+L+RTS +L++G+++K PAWYNVVA  PP  KF R+P   +P +GK +  L
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120
               D      E YKTR   +D+Q +  A+++P KL ++ED+LR LF+ QHPWE SRP +
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRM 179
           L+EN    ++DWSR+ QLGK LDGESVVQR L+LL+ G    +  AYD+ARFEFYR+RM
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>TDEL0D00930 Chr4 (169201..169968) [768 bp, 255 aa] {ON} Anc_4.325
           YLR441C
          Length = 255

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 19/110 (17%)

Query: 29  WYNVVAANPPKKKFERKPIFVNPSTGKARVNLKSFLDSKRNAHEIYKTRYSMADKQVSHN 88
           WY++ A +           F N + GK  VN  + L S  +A +       +AD Q S +
Sbjct: 29  WYDIKAPST----------FKNRNVGKTLVNKSTGLKSASDALKGRVVEVCLADLQGSED 78

Query: 89  ALYRPPKLVYLEDQLRQLFYDQHPW----ERSRPMI-----LIENNVTPK 129
             +R  KL   E Q + L  + H      ++ R M+     LIE NVT K
Sbjct: 79  HSFRKVKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQTLIEANVTVK 128

>NCAS0B01030 Chr2 (163625..164638) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 33.1 bits (74), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 62  SFLDSKRNA--HEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQH-PWERSRP 118
           + L S  NA  +  Y +    A  Q   N L+  P +  L   +RQ+FY ++  W  S P
Sbjct: 73  TLLISMFNAFGYFTYASNLGWAGIQAEFNHLHVHPSITGLSPGVRQIFYAKYCAWFLSWP 132

Query: 119 MILIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLL 155
           +++  N +T       I + GK LD  SVV     LL
Sbjct: 133 LLIFLNEMTGM----SISEEGK-LDELSVVDTVHSLL 164

>Skud_13.81 Chr13 (144597..145364) [768 bp, 255 aa] {ON} YML063W
           (REAL)
          Length = 255

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 48  FVNPSTGKARVNLKSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLF 107
           F N + GK  VN  + L S  +A +       +AD Q S +  +R  KL   E Q + L 
Sbjct: 38  FENRNVGKTLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLL 97

Query: 108 YDQHPW----ERSRPMI-----LIENNVTPK 129
            + H      ++ R M+     LIE NVT K
Sbjct: 98  TNFHGMDFTTDKLRSMVRKWQTLIETNVTVK 128

>KAFR0C05290 Chr3 (1060077..1061774) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 46/93 (49%), Gaps = 14/93 (15%)

Query: 34  AANPPKKKF-ERKPIFVNPSTGKARVNLKSFLDSKRNAHEIYKTRYSMADKQVSHNALYR 92
            +NP   +F +   +++N +   + +   SFL + R  H+ Y +++ +A  ++       
Sbjct: 279 GSNPELARFSDTWQMYINTAVAVSLLICTSFLQNIRARHDKYISKFLLATFEIDEK---- 334

Query: 93  PPKLVYLEDQLRQLFYDQHPWERSRPMILIENN 125
                 +E +LR+ F+D   +E S P++ I +N
Sbjct: 335 ------IETKLREHFHD---FETSNPVVTIYSN 358

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,884,055
Number of extensions: 917416
Number of successful extensions: 2071
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2105
Number of HSP's successfully gapped: 29
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)