Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A054002.292ON72172136970.0
Suva_9.1082.292ON72271624680.0
Skud_9.822.292ON72271924660.0
Smik_9.882.292ON72471624530.0
KAFR0J013402.292ON72872524480.0
YIL091C (UTP25)2.292ON72171924460.0
NDAI0B035302.292ON73973624430.0
NCAS0B062302.292ON72372523840.0
SAKL0E07546g2.292ON71872123360.0
TBLA0B059702.292ON71972023110.0
CAGL0D04180g2.292ON70072422980.0
KLLA0E08229g2.292ON70472922800.0
TDEL0G022202.292ON71072122540.0
TPHA0D015202.292ON71672222470.0
KLTH0G10494g2.292ON74775322390.0
Kpol_1039.462.292ON70465622340.0
Kwal_27.115032.292ON72773422290.0
Ecym_33312.292ON70871722240.0
ZYRO0A02002g2.292ON70972321990.0
ADL209C2.292ON70472021930.0
KLLA0C15433g8.469ON539195850.15
Ecym_13958.469ON565200790.66
Ecym_83588.124ON56984790.69
Skud_4.5058.469ON604196790.71
CAGL0L10021g5.643ON50467781.0
KAFR0H028208.614ON611100771.3
Smik_4.4908.469ON587193742.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A05400
         (721 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...  1428   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   955   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   954   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   949   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   947   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   946   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   945   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   922   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   904   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   894   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   889   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   882   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   872   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   870   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   867   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   865   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   863   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   861   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   851   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   849   0.0  
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...    37   0.15 
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...    35   0.66 
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...    35   0.69 
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    35   0.71 
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...    35   1.0  
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...    34   1.3  
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    33   2.7  

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score = 1428 bits (3697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 695/721 (96%), Positives = 695/721 (96%)

Query: 1   MNNRSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXX 60
           MNNRSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNV           
Sbjct: 1   MNNRSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSD 60

Query: 61  XXXXXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQ 120
                RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNH          Q
Sbjct: 61  SDAEARKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQ 120

Query: 121 IDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQY 180
           IDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQY
Sbjct: 121 IDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQY 180

Query: 181 RSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLL 240
           RSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLL
Sbjct: 181 RSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLL 240

Query: 241 ENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKN 300
           ENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKN
Sbjct: 241 ENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKN 300

Query: 301 NQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYE 360
           NQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYE
Sbjct: 301 NQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYE 360

Query: 361 DSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVEN 420
           DSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVEN
Sbjct: 361 DSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVEN 420

Query: 421 TDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYI 480
           TDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYI
Sbjct: 421 TDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYI 480

Query: 481 NDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIF 540
           NDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIF
Sbjct: 481 NDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIF 540

Query: 541 QRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKT 600
           QRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKT
Sbjct: 541 QRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKT 600

Query: 601 RILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDP 660
           RILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDP
Sbjct: 601 RILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDP 660

Query: 661 EFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEF 720
           EFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEF
Sbjct: 661 EFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEF 720

Query: 721 K 721
           K
Sbjct: 721 K 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/716 (65%), Positives = 567/716 (79%), Gaps = 12/716 (1%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXXR 66
           KRGR+E+R +KRTT R   D    E   V ++ V    +   +                +
Sbjct: 18  KRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDA-ISDAGSESDLDIGDEEEK 76

Query: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGE-VDKILVHDDNHXXXXXXXXXXQIDNAI 125
           + KVY ALLTILKSEHPE K++KTK + +  E VD+  V+++            +I+N +
Sbjct: 77  QEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNENT--DSEPVDDQLEIENGL 134

Query: 126 LDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKL 185
           L ++     +D  +   +E DSEDEQDPFESHFNQ  E  ++ +  AFK+  ++Y+SVK 
Sbjct: 135 LSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDVSNAFKANNIKYKSVKS 194

Query: 186 QPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKPD 245
                    DE  IYS+P V G +   ++  +S    SI SYFLK+RLKIQN LL+ K D
Sbjct: 195 PLGD-----DESCIYSKPVVNGDETPVERPYKS---SSIYSYFLKQRLKIQNGLLDKKID 246

Query: 246 NLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQ 305
            L S+QK+LVDPMFQYKDILYEY++Y K EDEYR LY LHALNH+YKTRDRILKNNQRLQ
Sbjct: 247 PLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRILKNNQRLQ 306

Query: 306 ENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPP 365
           +N DTE LDQGFTRPKVLI+ PTRD AY +V  II KSGIDQVDK+GKF DQF +DSLPP
Sbjct: 307 DNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQFRDDSLPP 366

Query: 366 SSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKK 425
           SSKPKSFQ IF+GNT+DFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKKK
Sbjct: 367 SSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKK 426

Query: 426 RQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQAR 485
           RQDDFLSSIE+ +IDQLHSIEYQNISH++TIF+H+N IPD+QH+ADFSRIRMWYIN+QA+
Sbjct: 427 RQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAK 486

Query: 486 FFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEV 545
             RQTMVFTKYISP ANS+ING+CRN +GRWKNH+++ +E S IG+L L++RQIFQRF++
Sbjct: 487 LLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQIFQRFDI 546

Query: 546 TGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFG 605
            G SI++EPDYRFKFFTSVIIP I+KSTGYEDGILIYIP+YTD++R+RNY+KEKT ILFG
Sbjct: 547 IGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFG 606

Query: 606 DINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTE 665
           DINEYSSQKQL ANRSLFQQGR+KVLLYTERLHHYRRYEIKGVK+VIFYKPP++PEFY E
Sbjct: 607 DINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPNNPEFYNE 666

Query: 666 VVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
            VR IG+NAFLGNTDLNISTVRC+YSKLD L+LE +VGT+RAGVL H Q E+YEFK
Sbjct: 667 TVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVYEFK 722

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/719 (66%), Positives = 565/719 (78%), Gaps = 18/719 (2%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXXR 66
           KRGR+ELR +KR++ R   D    +   V ++ VG  D    V                +
Sbjct: 18  KRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDA-VSDVGSEDDLDVGDEDEK 76

Query: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXX-XXXXXQIDNAI 125
           K KVY ALLTILKSEHPE K+ KTK        D+    D N            +I+N +
Sbjct: 77  KKKVYDALLTILKSEHPEPKRMKTKAEESS---DRTTQSDGNENAESEPVDDQLEIENGL 133

Query: 126 LDNRTQSDSEDE--QDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSV 183
           L +R + +SED+  +D   ++ DSEDEQDPFESHFNQ PE +++ L  AFKSK ++Y+SV
Sbjct: 134 LGDR-EDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSV 192

Query: 184 KLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCS-IGSYFLKKRLKIQNDLLEN 242
           K  P       DE  IY++P V G     +  +ES  K S I SYFLK+RLKIQN L + 
Sbjct: 193 KA-PLN----GDESYIYAQPVVVG----EESSVESPYKSSSIYSYFLKQRLKIQNGLQDK 243

Query: 243 KPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQ 302
           K D L ++Q++LVDPMFQYKDILYEY++Y K EDEYR LY LH LNH+YKTRDRILKNNQ
Sbjct: 244 KIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQ 303

Query: 303 RLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDS 362
           RLQ+N DTE LDQGFTRPKVLI+ PTRD AY +V  II+KSGIDQVDK+GKF DQF +DS
Sbjct: 304 RLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDS 363

Query: 363 LPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTD 422
           LPP SKP+SFQ IFKGNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTD
Sbjct: 364 LPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTD 423

Query: 423 KKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYIND 482
           KKKRQDDFLSSIEI +IDQLHSIEYQNISH+ TIF+HLN IPD+QH+ADFSRIRMWYIN+
Sbjct: 424 KKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINE 483

Query: 483 QARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQR 542
           QA+FFRQTMVFTKYISPT NS+ING+CRN +GRWKNHR +  E S IG+L L++RQIFQR
Sbjct: 484 QAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQR 543

Query: 543 FEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRI 602
           F+  G SIV+EPDYRFKFFTSV+IP I+KSTGYEDGILIYIP+YTD++R+RNY+KEKT I
Sbjct: 544 FDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTI 603

Query: 603 LFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEF 662
           LFGDINEYSSQ+QL ANRSLFQQGRLKV+LYTERLHHYRRY+IKGVKSVIFYKPP++PEF
Sbjct: 604 LFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEF 663

Query: 663 YTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           Y+E VR IG+NAF GNTDLNISTVRCIYSKLD ++LE +VGT+RA VL H Q E+YEFK
Sbjct: 664 YSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/716 (64%), Positives = 563/716 (78%), Gaps = 10/716 (1%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXXR 66
           KRGR+ELR +KR++ R   D+   E   V D+ V    +                    +
Sbjct: 18  KRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLDVEDEEGK 77

Query: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDNAIL 126
           K KVY ALLTILKSEHPE K+RKT+   D     K   +++ +          +I+N +L
Sbjct: 78  KEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVNVEYEPVDEQLEIENGLL 137

Query: 127 DNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKLQ 186
            +R   + +D  +   ++ DSEDEQDPFESHFNQ  E  ++ L  AFKSK ++Y+SVK  
Sbjct: 138 GDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKAS 197

Query: 187 PAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCS-IGSYFLKKRLKIQNDLLENKPD 245
                   DE  IY++P + G     + L+ES  + S I SYFLK+RLK+QN LL+ K D
Sbjct: 198 LGD-----DESYIYAKPFMVG----EEALVESPYRSSSIYSYFLKQRLKVQNGLLDKKID 248

Query: 246 NLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQ 305
            L  +QK+L+DPMFQYKDILYEY++Y K E EYR LYALH LNH+YKTRDRILKNNQRLQ
Sbjct: 249 PLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDRILKNNQRLQ 308

Query: 306 ENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPP 365
           +N DTE LDQGFTRPKVLI+ PTR+ AY +V  II+KSGIDQVDK+GKF DQF +DSLPP
Sbjct: 309 DNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPP 368

Query: 366 SSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKK 425
            SKPKSFQ IFKGNT+DFFV+G+KFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKK
Sbjct: 369 ESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKK 428

Query: 426 RQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQAR 485
           RQDDFLSSIE+ +IDQLHSIEYQNISH++TIF+H+N IPD+QH+ADFSRIRMWYIN+QA+
Sbjct: 429 RQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMWYINEQAK 488

Query: 486 FFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEV 545
            FRQTMVFTKYISP ANS+ING+C N +GRWKNH+++ +E+S IG+L L+VRQIFQRF++
Sbjct: 489 LFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKVRQIFQRFDI 548

Query: 546 TGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFG 605
            G SI++EPDYRFKFFTSVIIP I+KS GYEDGIL+YIP+YTD++R+RNY+KEKT ILFG
Sbjct: 549 IGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYMKEKTTILFG 608

Query: 606 DINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTE 665
           DINEYS+Q+QL ANRSLFQQGRLKV+LYTERLHHYRRYEIKGVKSV+FYKPP++PEFY E
Sbjct: 609 DINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNE 668

Query: 666 VVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
            VR IG+NAFLGNTDLNISTVRCIYSKLD L+LE +VGT+RA VL H Q E+YEFK
Sbjct: 669 TVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEVYEFK 724

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/725 (64%), Positives = 569/725 (78%), Gaps = 22/725 (3%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVG-----PADQMVNVXXXXXXXXXXXX 61
           KRGRKELR+++R   R   D     +     +  G     P+                  
Sbjct: 16  KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDEVGDEASD 75

Query: 62  XXXXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXX---- 117
                K +VYGALLTILKSEHPE KK+K +K +      K+L+ ++              
Sbjct: 76  DEEEMKKQVYGALLTILKSEHPEPKKQKKEKVN------KVLLDNEQQDESDASEEEEDE 129

Query: 118 XXQIDNAILDNRTQSDSEDE-QDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSK 176
             QI+NA++ +     SED+ ++   +  +S++EQDPFE+HFN   E   + LD +FK+ 
Sbjct: 130 TQQIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNN 189

Query: 177 QLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQ 236
            ++Y+S KL  ++     DEY I+S+P +   +  S   +  N K SI SYFLK+RLK+Q
Sbjct: 190 DIKYKSTKLPISE-----DEYAIFSKPVIKSDEIESPVELSVN-KSSIHSYFLKQRLKMQ 243

Query: 237 NDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDR 296
           N+L++ K D L  +QK+LVDPMFQYKDILY+Y++YGK EDEYR LY+LH LNH+YKTRD+
Sbjct: 244 NNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDK 303

Query: 297 ILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKD 356
           ILKNNQRLQ+N+DTECLDQGFTRPKVLI+ PTRDTAY ++  II KSGIDQVDK+GKFKD
Sbjct: 304 ILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKD 363

Query: 357 QFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQM 416
           QF+EDSLPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+QM
Sbjct: 364 QFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQM 423

Query: 417 IVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIR 476
           I+ENTDKKKRQDDFLSSIE+ IIDQLHSIEYQNISHL+TI  H+N IP EQHDADFSR+R
Sbjct: 424 ILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVR 483

Query: 477 MWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRV 536
           MWYINDQA+ FRQTM+FTKYISP ANS++NGKC+NWSGRWKNH+++S  +S I K+ +++
Sbjct: 484 MWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKI 543

Query: 537 RQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYL 596
           RQIFQRFE   GS+VDEPDYRFKFFTSV +P I+K+TGYEDG LIYIPEYTDY+RVRNYL
Sbjct: 544 RQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYL 603

Query: 597 KEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKP 656
           K+KT ILFGDINEYS QKQL +NRSLFQQGR+KVLLYTERLHHYRRYEIKGVK+V+FY+P
Sbjct: 604 KDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQP 663

Query: 657 PSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNE 716
           P +PEFYTEVVR IG+NAFLGNTDLNISTVRC+YSKLDAL+LEN+VG++RAGVLCH QNE
Sbjct: 664 PKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNE 723

Query: 717 IYEFK 721
           +YEFK
Sbjct: 724 VYEFK 728

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/719 (66%), Positives = 565/719 (78%), Gaps = 19/719 (2%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVED-DFVGPADQMVNVXXXXXXXXXXXXXXXX 65
           KRGR+ELR +KR++ R             ED D     D++ +V                
Sbjct: 18  KRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDSGDDFDIEDEEG--- 74

Query: 66  RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQ--IDN 123
           +K KVY ALLTILKSEHPE K+R+  + +D        V +D H          Q  I+N
Sbjct: 75  KKEKVYDALLTILKSEHPEPKRRR--READESNKAPAEVGEDEHENTEHGPVDDQLEIEN 132

Query: 124 AILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSV 183
            +L N    + +D      ++ DSEDEQDPFESHFNQ PE  ++ L  AFK+K ++Y+SV
Sbjct: 133 GLLGNHEDDNDDDSS-GDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSV 191

Query: 184 KLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCS-IGSYFLKKRLKIQNDLLEN 242
           K   +       E  IY++P V G     + L+ES  + S I SYFLK+RLK+QN LL+ 
Sbjct: 192 KGSLSD-----SESYIYAKPVVIG----EEALVESPYRSSSIYSYFLKQRLKVQNGLLDK 242

Query: 243 KPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQ 302
           K D L ++QK+LVDPMFQYKDILYEY++Y K EDEYR LYALH LNH+YKTRDRILKNNQ
Sbjct: 243 KTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQ 302

Query: 303 RLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDS 362
           RLQ+N DTE LDQGFTRPKVLI+ PTR+ AY +V  II+KSGIDQVDK+GKF DQF +DS
Sbjct: 303 RLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDS 362

Query: 363 LPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTD 422
           LPP SKPKSFQ IF+GNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTD
Sbjct: 363 LPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTD 422

Query: 423 KKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYIND 482
           KKKRQDDFLSSIE+ +IDQLHSIEYQNISH++TIF+HLN IPD+QH+ADFSRIRMWYIN+
Sbjct: 423 KKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINE 482

Query: 483 QARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQR 542
           QA+ FRQTMVFTKYISP ANS+ING+CRN +GRWKNH+++ +E S IG+  L++RQIFQR
Sbjct: 483 QAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQR 542

Query: 543 FEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRI 602
           F++ G SI++EPDYRFKFFTSVIIPGI+KSTGYEDGILIYIP+YTD++R+RNY+KEKT I
Sbjct: 543 FDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTI 602

Query: 603 LFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEF 662
           LFGDINEYSSQ+QL ANRSLFQQGRLKV+LYTERLHHYRRYEIKGVKSV+FYKPP++PEF
Sbjct: 603 LFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEF 662

Query: 663 YTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           Y EVVR IG+NAFLGNTDLNISTVRCIYSKLD L+LE +VGT+RA VL H Q EIYEFK
Sbjct: 663 YNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/736 (63%), Positives = 569/736 (77%), Gaps = 33/736 (4%)

Query: 2   NNRSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXX 61
           N+   KRGR+ELR ++R+  + +  D         ++ +    +                
Sbjct: 21  NDHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEV 80

Query: 62  XXXXRKGKVYGALLTILKSEHPEAKKRKTKK---------------SSDGGEVDKILVHD 106
               RKGKVYGALLTIL++EHPE K ++  K               + D    D I+  D
Sbjct: 81  DEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEED 140

Query: 107 DNHXXXXXXXXXXQIDNAILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEI 166
           +            QI+N +LD   +   +D+ +  + + +S+DEQDPFESHFN+  E  +
Sbjct: 141 ETE----------QIENGLLDRDDEQSDDDQLN-DSNDVESDDEQDPFESHFNKPTEQFV 189

Query: 167 NTLDAAFKSKQLQYRSVKLQPAKVTKVKDEY-LIYSEPTVPGGKQLSKKLIESNTKCSIG 225
           + L AAF+S++++Y++ K+       + D + +I S+PT+ G +  + +L  S    SI 
Sbjct: 190 DKLHAAFESREIKYKATKIV------IDDSHSVISSKPTIFGEELETNRLSSSKHGQSIF 243

Query: 226 SYFLKKRLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALH 285
           SYF+K+RLKIQN+LL  K D L  +QKEL+DPMFQYKDILYEY++YGK EDEYR LYALH
Sbjct: 244 SYFIKQRLKIQNNLLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALH 303

Query: 286 ALNHVYKTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGI 345
           ALNHVYKTRDRILKNNQRLQ+N+DTE LDQGFTRPKVLI+ PTRDTAY +   II KSG+
Sbjct: 304 ALNHVYKTRDRILKNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGL 363

Query: 346 DQVDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSD 405
           DQVDK+GKF DQF +DSLPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSD
Sbjct: 364 DQVDKKGKFYDQFKDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSD 423

Query: 406 IIVCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPD 465
           IIVCSPLG+QMIVENTDKKKRQDDFLSSIE+ I+DQLHS+EYQN++H++TIF+HLN IP 
Sbjct: 424 IIVCSPLGMQMIVENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPT 483

Query: 466 EQHDADFSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNE 525
           EQHDADFSRIRMWYINDQA+ FRQTMVFTKY+SP AN+IIN +CRNW GRWKNH+IV+ E
Sbjct: 484 EQHDADFSRIRMWYINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPE 543

Query: 526 ASHIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPE 585
            S IGKL L+++QIFQRF++ GGSIVDEPDYRFK FTSVIIP I+KST Y+DGILIYIP+
Sbjct: 544 VSSIGKLGLKIKQIFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPD 603

Query: 586 YTDYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEI 645
           YTDYVR+RNYLKEKTRILFGDINEYS Q++L +NRSL QQGR+KVLLYTERLHHYRRYEI
Sbjct: 604 YTDYVRIRNYLKEKTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEI 663

Query: 646 KGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQ 705
           KGVKSV+FYKPP++PEFY EVVR IG+NAFLGNTDLNISTVR +Y KLD L+LE +VGT+
Sbjct: 664 KGVKSVVFYKPPTNPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTK 723

Query: 706 RAGVLCHGQNEIYEFK 721
           RAG+LCH QNE+YEFK
Sbjct: 724 RAGILCHAQNEVYEFK 739

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/725 (62%), Positives = 558/725 (76%), Gaps = 23/725 (3%)

Query: 5   SGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXX 64
           S KRGR+ELR ++R+            S+ V+D       +   +               
Sbjct: 14  SKKRGRQELRTIRRSAGAKVSSQEVFNSSIVDD-------EEQELNESNESEQEEDIDEE 66

Query: 65  XRKGKVYGALLTILKSEHPEAKKRKTKKSSD---GGEVDKILVHDDNHXXXXXXXXXXQI 121
            +K KVYGALLTILKSEHPE KK+K K+  D   G +    L  DD            QI
Sbjct: 67  EKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDG--KDDEIDEAQQI 124

Query: 122 DNAILDNRTQSDSEDEQDVAA----EEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQ 177
           ++ +        S+DE+D  A    E+ DSEDEQDPFESHFNQ  E   + L+ AF +  
Sbjct: 125 EDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNTGS 184

Query: 178 LQYRSVKLQPAKVTKVKD-EYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQ 236
           ++Y+S K      + + D + +I S PT+ G +   ++   +    SI SYFLK+RL++ 
Sbjct: 185 VKYKSTK------SVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVA 238

Query: 237 NDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDR 296
           ND+L++K D L  +QKELVDPMFQY+DIL EY +Y K EDEYR LYALHALNHVYKTRDR
Sbjct: 239 NDMLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDR 298

Query: 297 ILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKD 356
           ILK+N RLQ+NSDTE  DQGFTRPKVLI+ PTRDTAY +++ II+KSG+DQVDK+GKF D
Sbjct: 299 ILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFND 358

Query: 357 QFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQM 416
           QF++++LPPSSKPKSFQ IFKGNTNDFFVLG+KFTRKAIKLYSNFYQSDIIVCSPLG+QM
Sbjct: 359 QFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQM 418

Query: 417 IVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIR 476
           IVENTDKK RQDDFLSSIE+ IIDQLHSIEYQN++H++TIF+HLN IP++QH+ADFSRIR
Sbjct: 419 IVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIR 478

Query: 477 MWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRV 536
           MWYINDQAR FRQTM+FTKY++P AN++IN +CRNW+GRWKNH I+  EAS I +L L+V
Sbjct: 479 MWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKV 538

Query: 537 RQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYL 596
           +Q FQRF++ GGS++DEPDYRFK F+SVIIP I+KST Y DGILIYIP+YTDYVR+RNYL
Sbjct: 539 KQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYL 598

Query: 597 KEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKP 656
           KEKT +LFGDINEYS Q++L +NRSLFQQGR+KVLLYTERLHHYRRYE+KGVKSV+FYKP
Sbjct: 599 KEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKP 658

Query: 657 PSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNE 716
           P++PEFY EVVR IG++AFLGN DLNISTVR +Y KLD L+LE +VG++RAG+LCH QNE
Sbjct: 659 PTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNE 718

Query: 717 IYEFK 721
           +YEF+
Sbjct: 719 VYEFQ 723

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/721 (62%), Positives = 558/721 (77%), Gaps = 24/721 (3%)

Query: 4   RSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXX 63
           ++ K GRKELR + R   R A  +  ++    E D     +++ +               
Sbjct: 19  KAKKTGRKELRTITRANARHA--NESKDDFENEPDMSSEEEELAD--NKPRSDEEEEEDI 74

Query: 64  XXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDN 123
             +K KVY ALLT+L+SEHP    +K+KK+ +GG+ +K     +             I+N
Sbjct: 75  ETKKQKVYNALLTLLESEHPH---KKSKKNREGGK-EKQGNLQEGVETYSDEDEEEAIEN 130

Query: 124 AILDNRTQSDSEDEQDVAAE---EFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQY 180
           A+++      ++DE DV ++   + D ED+ D FE HFN   E +   L +AF+ K+++Y
Sbjct: 131 ALVET-----NDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRY 185

Query: 181 RSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLL 240
           +SVK+ P      +DE+ IYS PTV G    S  ++  + K S+ SYF+K++LKIQN+LL
Sbjct: 186 KSVKV-PVN----EDEFFIYSRPTVEGEDGSS--VVAPSCKKSLHSYFIKQKLKIQNNLL 238

Query: 241 ENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKN 300
           ++K + LA +QK LVDPMFQY+D+LYEY +Y + E+EYR LYALH LNHVYKTRDRIL+N
Sbjct: 239 DDKKEALAPLQKNLVDPMFQYQDLLYEYRSY-EQEEEYRDLYALHVLNHVYKTRDRILRN 297

Query: 301 NQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYE 360
           +Q+LQ+NSD E LDQGFTRPKVLI+ PTRD AY IVT II KSG+DQVDKRGKF+DQF++
Sbjct: 298 SQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFD 357

Query: 361 DSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVEN 420
            SLPPSSKPKSF+ IFKGNTNDFFVLG KFTRK +KLYSNFYQSD+I CSPLG+Q+I+EN
Sbjct: 358 ASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILEN 417

Query: 421 TDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYI 480
           TDKKKRQDDFLSSIE+ +IDQLHSIEYQN+SH+ TIF+H+N IP +QHDADFSRIRMWYI
Sbjct: 418 TDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYI 477

Query: 481 NDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIF 540
           N+QA  FRQTMVFTKY SP ANS+INGKCRN +GRWKNH IV  E S I +L L+VRQIF
Sbjct: 478 NEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIF 537

Query: 541 QRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKT 600
           QRF++ GGS +DEPDYRFKFFTSVII  I+KSTGYEDGIL+YIP+YTDYVRVRN+L+EKT
Sbjct: 538 QRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKT 597

Query: 601 RILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDP 660
            +LFGDINEYS QKQLT+NR+LFQQG++KVLLYTERLHH+RRYEIKGVKSVIFYKPP++P
Sbjct: 598 TLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNP 657

Query: 661 EFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEF 720
           EFY EVVR IG++AFLG+ DLNISTVRC+Y KLD L+LE VVGT+RA VL HGQNEIYEF
Sbjct: 658 EFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEF 717

Query: 721 K 721
           K
Sbjct: 718 K 718

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/720 (62%), Positives = 545/720 (75%), Gaps = 19/720 (2%)

Query: 6   GKRGRKELRHLKRTT--KRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXX 63
           GKRGR + R +K+++  KR   +D       +ED+    +D+  +V              
Sbjct: 15  GKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDE---SSDE--DVSNTSIDKEAEVTED 69

Query: 64  XXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDN 123
             +K +VY AL+TILKSEH E K R     +   E    L  +D            +I+N
Sbjct: 70  LEKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEH---LTDEDLDEDEKFETEEQEIEN 126

Query: 124 AILDNRT-QSDSEDEQDVAAEEFD-SEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYR 181
            +L  +  + + E+  D A E  D S+++ DPF+SHFNQ  E   N    AFK+KQ++YR
Sbjct: 127 NLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYR 186

Query: 182 SVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLE 241
           S+K +  +      E  IYSEP +   +Q   K+     K SI SY LKKRLKI NDLL+
Sbjct: 187 SIKYKINEY-----ESSIYSEPRILEDEQT--KVKSPVLKSSIHSYALKKRLKINNDLLD 239

Query: 242 NKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNN 301
              +NL +IQKELVDPMFQYKDILYEY NYGK E+EYR LY LH LNH+YKTRDRILKNN
Sbjct: 240 PAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNN 299

Query: 302 QRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYED 361
            ++Q+N D E LDQGFTRPKVLI+APTRD  YSIV  II KSGIDQ+DK+ KF+DQFYE+
Sbjct: 300 SKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEE 359

Query: 362 SLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENT 421
           SL P+SKPKSFQ++FKGN+ND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLGL MI+ENT
Sbjct: 360 SLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENT 419

Query: 422 DKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYIN 481
           DKKKRQDDFLSSIE+ IIDQLHS+E+QNISH+ +IFEH+N IP EQHD DFSRI+MWYIN
Sbjct: 420 DKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYIN 479

Query: 482 DQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQ 541
           DQA+ FRQTM+FTKYISP+AN  +NGKC+NWSGRWKNH++++   S IG+L LRV+Q+F 
Sbjct: 480 DQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFH 539

Query: 542 RFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTR 601
           RF++ GGSIVDEPDYRFK+FTSVI+  I KST YEDG+LIYI +YTDYVRVRNYLKEKT 
Sbjct: 540 RFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTT 599

Query: 602 ILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPE 661
           ILFGDINEYS QKQ+ +NR+LFQQ R+KVLLYTERLHH+RRYEIKGVK+++FYK P++PE
Sbjct: 600 ILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPE 659

Query: 662 FYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           FY EVVR IG+NAF GNTD+NIS VR IYSKLD LALE ++GT+RA VL HGQNE YEFK
Sbjct: 660 FYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/724 (63%), Positives = 544/724 (75%), Gaps = 35/724 (4%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXXR 66
           KRGRKELR ++R  KR  I+  P   A VE      +  ++                   
Sbjct: 3   KRGRKELRSIRRA-KRTKIE--PEADAGVE-----SSGSVLEAGPAVEEKVQDDGEKEDD 54

Query: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDN--- 123
           K +VY ALLTILKSEH E               DK+  H D+           Q ++   
Sbjct: 55  KEQVYNALLTILKSEHKE---------------DKVKTHRDHDEEESEAEEEEQAEDQYN 99

Query: 124 ---AILDNRTQSDSEDEQDVAAEEFDSEDEQ-DPFESHFN-QFPETEINTLDAAFKSKQL 178
              A  ++  + D EDEQ    EE +S+DE+ DPF++HFN +        L  A K  +L
Sbjct: 100 DAFADGESDDEDDDEDEQAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKL 159

Query: 179 QYRSVKLQPAKVTKVK-DEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQN 237
           +Y+S+KL+     + +  E  I+S P + G    + K+ +   KCS+ SYFLKKRL+IQN
Sbjct: 160 RYKSIKLKVGSADEDQVQEDAIFSVPYIEGE---TPKIEDPKLKCSLSSYFLKKRLRIQN 216

Query: 238 DLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRI 297
           +LL+ + + L  +Q+++VDPM QYKDILYEY+ YGK EDEYR LY LH LNHVYKTRD+I
Sbjct: 217 NLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKI 276

Query: 298 LKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQ 357
           +KNNQ+LQ+N D+E LDQGFTRPKVLIIAPTRD+AY IVT +I KSG+DQVDK+GKF+DQ
Sbjct: 277 IKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQ 336

Query: 358 FYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMI 417
           FY+ S PPSSKPKSFQ IFKGNTND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLGLQMI
Sbjct: 337 FYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMI 396

Query: 418 VENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRM 477
           VENTDKKKRQDDFLSS+E+TIIDQ HSIEYQN +HL+TIF+HLN IP EQHDADFSRIRM
Sbjct: 397 VENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRM 456

Query: 478 WYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVR 537
           WYINDQA+FFRQTM+FTKYISP ANS++N KCRN  GRWKNH+IVS+E S +G + L+VR
Sbjct: 457 WYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVR 516

Query: 538 QIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLK 597
           QIFQRF V G S+ DEPDYRFKFFTSV+I  I KSTGY+DG LIYIPEY+DYVRVRNY+K
Sbjct: 517 QIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMK 576

Query: 598 EKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPP 657
           EKT ILFGDINEYS Q+ LT+NR+LF QGRLKVLLYTERLHH+RRYE+KGVK+V+FYKPP
Sbjct: 577 EKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPP 636

Query: 658 SDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEI 717
           SDPEFY EVVR IG+  FLG+ DLNISTVRC YSKLD LALE +VGT+R GVL HGQNE 
Sbjct: 637 SDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNET 696

Query: 718 YEFK 721
           YEFK
Sbjct: 697 YEFK 700

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/729 (61%), Positives = 551/729 (75%), Gaps = 40/729 (5%)

Query: 4   RSG-KRGRKELRHLKRT-TKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXX 61
           R+G K GRK+LR + R   KR   DD     A V D  + P D   +             
Sbjct: 5   RAGPKSGRKQLREITRAGQKRVRYDD----EATVAD--LTP-DNESDSDNAEPSVAAERE 57

Query: 62  XXXXRKGKVYGALLTILKSEHPEAKKRKT--------KKSSDGGEVDKILVHDDNHXXXX 113
                +G+ Y ALLT+LKSEHPE K +          +   D  E D I   D+      
Sbjct: 58  DVEQHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQ---- 113

Query: 114 XXXXXXQIDNAILD-NRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAA 172
                  I+NA+ D +    D ED +D  ++  +SEDE DPFESHF+++ E+ +   D  
Sbjct: 114 ------NIENALDDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKG 167

Query: 173 FKSKQLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKR 232
           FK K ++Y+S     +K    ++E LIYS+P +   + L  K      K ++ SYF+K++
Sbjct: 168 FKDKTVKYKS-----SKTDVSEEESLIYSKPCLDDEEVLPVK-----GKQTLSSYFIKQK 217

Query: 233 LKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYK 292
           LK+ ND  +N    L  IQKELVDPMFQYKD+LYEY++Y   ED+YR LY+LHALNHVYK
Sbjct: 218 LKLANDF-QNNGLPLTEIQKELVDPMFQYKDMLYEYDDYA-DEDQYRDLYSLHALNHVYK 275

Query: 293 TRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRG 352
           TRDRILKNNQ+LQEN+D E LDQGFTRPKVLI+ PTRD A+ IV  I+ KSG+DQ DK+ 
Sbjct: 276 TRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKS 335

Query: 353 KFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPL 412
           KF+DQF+EDSLPP+SKPKSFQ IF+GNTNDFFVLG+KFTRK++K+YSNFYQSDII+CSPL
Sbjct: 336 KFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPL 395

Query: 413 GLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADF 472
           G+Q+I+ENTDKKKRQDDFLSSIE+ IIDQLHSIEYQN  H+ TIF+H+N IP++Q +ADF
Sbjct: 396 GIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADF 455

Query: 473 SRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKL 532
           SRIRMWYIN+QA+FFRQT+VFTKYISP ANSI+NGKCRN +GRWKNHR +  E S IG+L
Sbjct: 456 SRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQL 515

Query: 533 SLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRV 592
            L+VRQIFQRF++ GG+ +DEPDYRFKFFTSVI+P I+KSTGYEDGIL+YIP+YTD++RV
Sbjct: 516 GLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRV 575

Query: 593 RNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVI 652
           RNYLKEKT I+FG+INEYS+QKQLT+NR+ FQ G++KVLLYTERLHH+RRYEIK VKSVI
Sbjct: 576 RNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVI 635

Query: 653 FYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCH 712
           FYKPP +PEFY+EVVRNIG+N FLGN D+NISTVRCIYSK+D L+LE VVG++RA VL H
Sbjct: 636 FYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAH 695

Query: 713 GQNEIYEFK 721
           GQNE+YEFK
Sbjct: 696 GQNEVYEFK 704

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/721 (60%), Positives = 542/721 (75%), Gaps = 26/721 (3%)

Query: 3   NRSGKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXX 62
           N + KRGRKELR ++R  +  A ++P   +   E    G      N              
Sbjct: 14  NGTLKRGRKELRSIRRPQRNKAHEEPEHLNESSE----GEVKNHHNGMQHNEEIANVEED 69

Query: 63  XXXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQID 122
              ++ KVYGALLTIL SEHP+ K ++        EV      +D+              
Sbjct: 70  EENKRRKVYGALLTILNSEHPKPKPKQ--------EVTVQSRKEDSESDVEEDERDEV-- 119

Query: 123 NAILDNRTQSDSEDEQD--VAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQY 180
             + DN  + D    +D      + +S+DEQD F+SHFNQ PE  ++ LDAAFK +QL+Y
Sbjct: 120 EQLEDNLARVDENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKY 179

Query: 181 RSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLL 240
           +S     AKV   ++E ++YS+P +   +  SKKL   +   S+ SY  K+RLKIQNDL 
Sbjct: 180 KS-----AKVPIGENESMVYSKPLLLEDQ--SKKLEIPSRHESLKSYVFKQRLKIQNDL- 231

Query: 241 ENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKN 300
             + +NL S Q+ LVDPM QY D+LYEY +Y K EDEYR LYALH LNHVYKTRD+ILKN
Sbjct: 232 --EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKN 289

Query: 301 NQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYE 360
           NQR+ +N D + LDQGFTRPKVLI+ PTRDTAY ++  II+KSGIDQ+DK+GKF+DQF+E
Sbjct: 290 NQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFE 349

Query: 361 DSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVEN 420
           +SLPPSSKPKSFQ +FKGNTNDFFVLG+KFTRKAIKLYSNFYQSDII+CSPLG+Q+I+EN
Sbjct: 350 ESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILEN 409

Query: 421 TDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYI 480
           TDKKKRQDDFLSSIEI+I DQLHSIEYQN+SH+ TIF+HLN IP EQHD DF R+R+WYI
Sbjct: 410 TDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYI 469

Query: 481 NDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIF 540
           N+QA+ FRQTM+FTKY+SPTAN++IN KC+N +GRWKNH  +    S IGKL L+VRQIF
Sbjct: 470 NEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIF 529

Query: 541 QRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKT 600
           QR ++   SI++E D+RFKFFTSVIIP I+KSTGYEDGIL+YIP+Y D++RVRNY+KEKT
Sbjct: 530 QRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKT 589

Query: 601 RILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDP 660
            I+FGDINEYS+QKQL +NR+LFQQGR KVLLYTERLHH+RRYEIKGVKSV+FY+PP++P
Sbjct: 590 TIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNP 649

Query: 661 EFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEF 720
           EFY+EVVR I ++A LG TDLNISTVR IYSKLD ++LE +VGT+RA +L HGQNE+YEF
Sbjct: 650 EFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEF 709

Query: 721 K 721
           K
Sbjct: 710 K 710

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/722 (62%), Positives = 558/722 (77%), Gaps = 21/722 (2%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPR--ESAPVEDDFVGPADQMVNVXXXXXXX--XXXXXX 62
           KRGR +LR ++R+ K     +  R  ++    +D   PAD +V+                
Sbjct: 9   KRGRSQLRTIQRS-KYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAKDEED 67

Query: 63  XXXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQID 122
              ++ +VYGALLTILKSEHPE KK+K K + +    D     DD +          +I+
Sbjct: 68  VGKKRNQVYGALLTILKSEHPEKKKQKKKFNQEKE--DAYNASDDEYNVSDKQ----EIE 121

Query: 123 NAILDNRTQSDSEDEQDVAAEEFDSEDEQDP--FESHFNQFPETEINTLDAAFKSKQLQY 180
           N + D +  ++ E+E D+   E D E + D   F+ HFNQ PE  ++ +   F +K+++Y
Sbjct: 122 NGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFNQVPENVVDKISNGFDNKKIKY 181

Query: 181 RSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTK-CSIGSYFLKKRLKIQNDL 239
            S K+Q     K   ++ IYS+P V  G   +K  +ES  K  S+ SYF+KKRL+I N+L
Sbjct: 182 VSKKIQLPHHEK---DFFIYSKPIVDDG---NKHKVESPIKKSSLDSYFIKKRLEITNNL 235

Query: 240 LENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILK 299
           L+ K DNL  +QK LVDPMFQY DIL+EYENYG  E EYR+LY LH LNH+YKTRD++LK
Sbjct: 236 LDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTLHILNHLYKTRDKVLK 294

Query: 300 NNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFY 359
           +NQRLQEN+++E LDQGFTRPKVLI+ PTRDTAY++V TII KSG+DQV+K+GKFK QF+
Sbjct: 295 DNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSGLDQVEKKGKFKSQFF 354

Query: 360 EDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVE 419
           EDSLPPSSKPKSFQSIFKGNTNDFFVLG+KFTRKA+KLYSNFYQSD+I+CSPLGL MI E
Sbjct: 355 EDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQSDVIICSPLGLHMITE 414

Query: 420 NTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWY 479
           NTDKKK+QDDFLSSIEITI+DQLHS+EYQNISH+  IFEHLN IP EQHDADFSRIRMWY
Sbjct: 415 NTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIPREQHDADFSRIRMWY 474

Query: 480 INDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQI 539
           INDQAR FRQTM+FTKY+SPTAN++INGKCRN +GRW+N   +++E S +GKL L++RQI
Sbjct: 475 INDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTSEESSLGKLGLKIRQI 534

Query: 540 FQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEK 599
           FQRF++ GG++ DEPD+RFKFF SV++  ILKSTGYEDGIL+YIP Y+DY+RVRNY+KEK
Sbjct: 535 FQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIPNYSDYMRVRNYMKEK 594

Query: 600 TRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSD 659
           T +LFGDINEYS Q++L +NRSLFQQGR+KVLLYTERLHHYRRYEIKGVKSVIFY PP++
Sbjct: 595 TTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKSVIFYGPPTN 654

Query: 660 PEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYE 719
           PEFY EVVR IG+NAFLGN D+NI+TVR +YSKLD+L+LE +VGTQRA VL   +NE+YE
Sbjct: 655 PEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGTQRAAVLSRAENEVYE 714

Query: 720 FK 721
           FK
Sbjct: 715 FK 716

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/753 (57%), Positives = 541/753 (71%), Gaps = 58/753 (7%)

Query: 4   RSGKRGRKELRHLKRTT--KRPAIDDPPRES-----APVEDDFVGPADQMVNVXXXXXXX 56
           RS K GRK+LR +++ +  +R   ++   E         ED    P              
Sbjct: 18  RSSKSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAP-------------E 64

Query: 57  XXXXXXXXXRKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKIL-VHD-------DN 108
                      G+ Y ALLT+LK+EH    +RKTK        D    V D       DN
Sbjct: 65  LNEPAQDQRAGGEAYAALLTLLKAEHGGPARRKTKTDDKKTSADPTSNVKDEEESESRDN 124

Query: 109 HXXXXXXXXXXQIDNAILDNRTQS--------------------DSEDEQDVAAEEFDSE 148
                       I+NA++D  T                      +  D  ++AA  F+ E
Sbjct: 125 EDEEEDEDEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGDATELAAG-FEEE 183

Query: 149 DEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKLQPAKVTKVKDEYLIYSEPTVPGG 208
           D+ D  E HFN   E + N LDAAFK+K+++YRS KL   K     ++  IYS PT+   
Sbjct: 184 DKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDK-----NQEFIYSRPTLVN- 237

Query: 209 KQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEY 268
            + +  +   +   S+ SYF+K+RLKIQNDLL+++ D L  +QK++VDPMFQY+D+LYEY
Sbjct: 238 -EPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDLLYEY 295

Query: 269 ENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPT 328
           E+Y K E EYR LYALH LNH+YKTRDRILKNNQRLQEN D E LDQGFTRPKVLI+APT
Sbjct: 296 EDYDK-ETEYRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPT 354

Query: 329 RDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGM 388
           RD AY I++ II KSG+DQVDK+ KFKDQF++++LPPS KPKSFQ +FKGNTNDFFVLG 
Sbjct: 355 RDAAYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGA 414

Query: 389 KFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQ 448
           KFTRK IKLYSNFYQSDII+CSPLG+Q+I+ENTDKKKRQDDFLSSIE+ ++DQLHSIE+Q
Sbjct: 415 KFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQ 474

Query: 449 NISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGK 508
           N+ HL +IFEH+N IP +QHDADFSRI+MWYINDQA+ FRQT++FTK+ SP ANS+INGK
Sbjct: 475 NMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGK 534

Query: 509 CRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPG 568
           CRN++GRWKNHR++  E S +G+L +R R IFQRF++ G S+ +EPD RFK F SVI+P 
Sbjct: 535 CRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPN 594

Query: 569 ILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRL 628
           I+KSTGYEDGIL+YIP+YTD+VRVRNYL+EKT ILFGDINEYS Q+QLT+NR++FQQGR+
Sbjct: 595 IVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRV 654

Query: 629 KVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRC 688
           KVLLYTERLHH+RRYEIKGVK+VIFYKPP++PEF+ EV R +G++AFLG  DLNIS VRC
Sbjct: 655 KVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRC 714

Query: 689 IYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           ++SKLD L+LE +VGT+RA VL HG NE YEFK
Sbjct: 715 LFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/656 (63%), Positives = 516/656 (78%), Gaps = 18/656 (2%)

Query: 66  RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDNAI 125
           RK KVYGALLTIL SEHPE   RK  KS     V                        + 
Sbjct: 67  RKEKVYGALLTILNSEHPE---RKKHKSHSTDFV--------KEIDEQEEIEQGMASESE 115

Query: 126 LDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKL 185
            ++    + E  +    EE +  D+ D FESHFN   +  ++ + A FK KQ++Y+S+K 
Sbjct: 116 EEDEENDEEESNEGDEEEEEEPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKY 175

Query: 186 QPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKPD 245
              K      E  I+ +P +    Q  + +       S  SYF+K+RLKIQNDLL++  +
Sbjct: 176 SLDK-----KESAIFGKPLLLT--QQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKE 228

Query: 246 NLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRLQ 305
           NL  ++K+L+DPMFQYKD+L EY NY   E EYR+LY+LH LNH+YKTRD+ILK+NQRLQ
Sbjct: 229 NLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQ 288

Query: 306 ENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLPP 365
           EN D ECLDQGFTRPKVLI+ PTRDTAY +V TII KSG+DQ+DK+GKFKDQF++DSLPP
Sbjct: 289 ENDDLECLDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPP 348

Query: 366 SSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKK 425
           +SKPKSF+ +FKGNTNDFFVLGMKFTRKAIKLYSNFYQSDII+CSPLG+QMI+ENTDKKK
Sbjct: 349 TSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKK 408

Query: 426 RQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQAR 485
           RQDDFLSSIE+ I+DQLHSIEYQNISH+YTI EH+N IP +Q +ADFSRIRMWYINDQA+
Sbjct: 409 RQDDFLSSIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAK 468

Query: 486 FFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEV 545
           F RQTM+FT+YISPTAN+IINGKC N +GRWKN++I+S+E S IG+L ++++QIFQRF++
Sbjct: 469 FLRQTMLFTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDL 528

Query: 546 TGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFG 605
            GG++VDE DYRFK+FTSV++  I+KSTGYEDGIL+YIPEYTDY+R+RNY+KEKT ILF 
Sbjct: 529 VGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFS 588

Query: 606 DINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTE 665
           +INEYS+QKQL +NRS+FQQGR KVLLYTERLHHYRRYE+KG+KSVIFYKPP++PEFY E
Sbjct: 589 EINEYSTQKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNE 648

Query: 666 VVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           V+R   +NAFLG +D+NIST+R +YSKLD LAL+ +VG++RA +LCHGQNE Y+FK
Sbjct: 649 VIRFTAKNAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/734 (58%), Positives = 538/734 (73%), Gaps = 46/734 (6%)

Query: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXXR 66
           K GRK+LR +++ ++         +S   ED+ V   ++ +N                  
Sbjct: 21  KGGRKQLRSIRKASRY--------DSKKPEDEPVETPEEEINEVEDVHEERTEVSRKQES 72

Query: 67  KGKVYGALLTILKSEHPEAKKR-KTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDNAI 125
            G+ Y ALLT+LK+EH   KK+ K     +G    +I                 + + AI
Sbjct: 73  NGEAYAALLTLLKAEHGTGKKKVKAGPQGEGSGESQISEISPEAEQDEEEEEEEEEETAI 132

Query: 126 ---LDNRTQSDSEDEQDVAAEEFDS-----EDEQDPFESHFNQFPETEINTLDAAFKSKQ 177
              L     SD ++  ++  EE D+     E+  DP E+HFN  PE + + LD AFK+KQ
Sbjct: 133 ENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENASDPLEAHFNSVPEKDTDALDQAFKTKQ 192

Query: 178 LQYRSVKLQPAKVTKVKDEYLIYSEP----------TVPGGKQLSKKLIESNTKCSIGSY 227
           ++YRS K++ +K     +E  IYS P           VP G Q            S+  Y
Sbjct: 193 VRYRSSKIKISK-----NEEFIYSRPDLNLESRTPIQVPQGTQ------------SLSPY 235

Query: 228 FLKKRLKIQNDLLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHAL 287
           F+K+RLKIQNDLL++K +NL  +QK++VDP+FQY+D+LYEYENY + E EYR LYALHAL
Sbjct: 236 FIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETEYRDLYALHAL 293

Query: 288 NHVYKTRDRILKNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQ 347
           +H+YKTRDRILKNNQRLQ+N D E LDQGFTRPKVLI+ PTRD AYS+++ II KSG+DQ
Sbjct: 294 DHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSGLDQ 353

Query: 348 VDKRGKFKDQFYEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDII 407
           VDK+ KF+DQFY+DSLPP  KPKSFQ +FKGNTNDFFVLG KFTRK IKLYSNFYQSDII
Sbjct: 354 VDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQSDII 413

Query: 408 VCSPLGLQMIVENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQ 467
           VCSPLG+Q+I+ENTDKKKRQDDFLSSIE+ +IDQLHSIE+QN+ HL +IFEH+N IP +Q
Sbjct: 414 VCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIPQQQ 473

Query: 468 HDADFSRIRMWYINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEAS 527
           HDADFSRI+MWYINDQA+ FRQT++FT++ +P ANS+INGKCRN++GRWKNH IV  E S
Sbjct: 474 HDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGAEKS 533

Query: 528 HIGKLSLRVRQIFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYT 587
            + +L +R R +FQRF+V GG+  DEPD+RFK F SVI+P I++STGYEDGIL+YIP+YT
Sbjct: 534 SLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIPDYT 593

Query: 588 DYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKG 647
           D++RVRNYL+EKT ILFGDI+EYS Q+QLTANR+LFQQGR+KVLLYTERLHH+RRYEIKG
Sbjct: 594 DFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYEIKG 653

Query: 648 VKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRA 707
           VK+VIFYKPP++PEF+ E VR + ++AFLG  DLNIS VRC+YSKLD LALE +VGT+RA
Sbjct: 654 VKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGTERA 713

Query: 708 GVLCHGQNEIYEFK 721
            +L HG NE YEFK
Sbjct: 714 AILTHGPNETYEFK 727

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/717 (59%), Positives = 533/717 (74%), Gaps = 12/717 (1%)

Query: 6   GKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXX 65
            KRGRK+LR + R  +  + D      + +E       D+   +                
Sbjct: 3   SKRGRKQLRKITRIGRNRSEDKA--NGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE- 59

Query: 66  RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDNAI 125
           R   VYGALL+IL S HPE ++++ K        D ++    N            I  ++
Sbjct: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEK---TTDAVVEERKNGSRNYETDEVATISASL 116

Query: 126 LDNRTQSDSEDEQ-DVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVK 184
            D+  + +  +E   V ++  DSEDE+DPFE HFNQ  E + N LDAAFK K +QY S K
Sbjct: 117 DDSVDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176

Query: 185 LQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKP 244
           L         +E  I+S+P + G K           K +I SYF+KK+LK+ N LL++K 
Sbjct: 177 LPYMH----DNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKK 232

Query: 245 DNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRL 304
             L  + K LVDP+FQY+D+L+EYE++ + E EYR LY LH LNH+YKTRDRILKNN +L
Sbjct: 233 KPLTPLSKTLVDPIFQYRDLLFEYEDFSQ-ETEYRDLYTLHILNHIYKTRDRILKNNHKL 291

Query: 305 QENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLP 364
           QEN D E LDQGFTRPKVL++APTR+TAY I+  II+KSG+DQVDK+ KFKDQFYEDSLP
Sbjct: 292 QENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLP 351

Query: 365 PSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKK 424
           P+SKPKSFQ +FKGNTNDFFVLGMKFTRK +KLYSNFYQSD+IVCSPLG+Q+I+ENTDKK
Sbjct: 352 PTSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKK 411

Query: 425 KRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQA 484
           KRQDDFLSSIE+ ++DQLHS+E+QN +H+ +IF+H+N IP +QHD+DFSRIRMWYINDQA
Sbjct: 412 KRQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQA 471

Query: 485 RFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFE 544
           R FRQT++FTKY+SP ANS+INGKC NWSGR+KN R +S E S I +L L+VRQ+F RF+
Sbjct: 472 RLFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFD 531

Query: 545 VTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILF 604
           +  GS VDEPDYRFKFFTSV +P I KSTGYEDGIL+YIP+YTD++RVRNY K++TRILF
Sbjct: 532 LFTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILF 591

Query: 605 GDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYT 664
           G+I EYS Q+Q+T+NR+LFQQG++KVLLYTERLHH+RRY+IKGVKSVIFYKPPS+PEFY 
Sbjct: 592 GEITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQ 651

Query: 665 EVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           E++R IG+NAFLGN DLNISTVRC Y KLD+L+LE +VG++RA VL   QNEIYEFK
Sbjct: 652 ELIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/723 (59%), Positives = 542/723 (74%), Gaps = 34/723 (4%)

Query: 5   SGKRGRKELRHLKRT-TKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXX 63
           S KRGRK+LR ++R    +  +++P    A  ED  +    +                  
Sbjct: 15  SRKRGRKDLRSIRRARNDKEPVEEPEIPVASEEDGELSEDSE--------EDATNEVQEQ 66

Query: 64  XXRKGKVYGALLTILKSEHPEAKKRKTKKS----SDGGEVDKILVHDDNHXXXXXXXXXX 119
              K K YGALLTILKSEHPE ++R+ +K      D    D  L  D+            
Sbjct: 67  EDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSEDEK----------G 116

Query: 120 QIDNAILDN-RTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQL 178
           +++  ++D    +    +E+    +E +SEDE+DPFESHFN   E+ I++LD A+K K++
Sbjct: 117 EVEANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSES-IDSLDEAWKQKKI 175

Query: 179 QYRSVKLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQND 238
             +S      K+    DE LIY++     G++        + K  + SY LK++LKIQN+
Sbjct: 176 VNKS-----GKIRVDDDESLIYTKTLAGKGQEFEL----PSHKGHLSSYPLKRKLKIQNN 226

Query: 239 LLENKPDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRIL 298
           LLE++ D L  +Q+++VDP+FQY+D+LYEYE+Y + EDEYR LY LH LNH+YKTRDRIL
Sbjct: 227 LLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRIL 286

Query: 299 KNNQRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQF 358
           K+NQRL  N D E LDQGFTRPKVLI+APTRDTAY IV+ +I KSG+DQVDK+ K +DQF
Sbjct: 287 KDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQF 346

Query: 359 YEDSLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIV 418
           +ED LPPSSKPKSF+  FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+IVCSPLGLQ+I+
Sbjct: 347 FEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLIL 406

Query: 419 ENTDKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMW 478
           ENTD+KKRQDDFLSSIE+ IIDQL+SIE+QN+SHL+TIF H+N IP EQHD DF R+RMW
Sbjct: 407 ENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMW 466

Query: 479 YINDQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQ 538
           YIN+QA+  RQT++FT+Y++PTAN ++NGKCRN  GRWKNH  ++ E S + KL  RVRQ
Sbjct: 467 YINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQ 526

Query: 539 IFQRFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKE 598
           IFQR ++ G S+VDEPDYRF+FFTSVI+P I KSTGYEDGIL+YIP+Y D++RVRNYLK+
Sbjct: 527 IFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKD 586

Query: 599 KTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPS 658
           KT ILFGDINEYS  +QLT+ RSLFQQGR+KVLLYTERLHH+RRYEIKGVKSVIFY+PPS
Sbjct: 587 KTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPS 646

Query: 659 DPEFYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIY 718
           +PEFY EVVR IG++AFLG+TDLNISTVRC+YSKLD LALE +V ++RA VL HGQNEIY
Sbjct: 647 NPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIY 706

Query: 719 EFK 721
           EFK
Sbjct: 707 EFK 709

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/720 (58%), Positives = 531/720 (73%), Gaps = 31/720 (4%)

Query: 6   GKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVXXXXXXXXXXXXXXXX 65
           GKRGRK+LR++ R  +  AI     E+   E+  V  A                      
Sbjct: 12  GKRGRKQLRNITRIGR--AIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGA 69

Query: 66  RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHXXXXXXXXXXQIDNAI 125
           R+ + YGALLT+L +EH + +K++ +K+            D                 A 
Sbjct: 70  RESQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEEAI-----------TAA 118

Query: 126 LDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKL 185
           L+N  Q D+ED +D   +  +S++EQD F+ HFN+    ++  LDAAFK+ + QYR  K 
Sbjct: 119 LENSAQ-DAEDAEDAFDDSGESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKE 177

Query: 186 QPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKC---SIGSYFLKKRLKIQNDLLEN 242
                    +E ++YS+P        S +  E   +    S+  Y +K+RL++ N L  +
Sbjct: 178 ARG------EEEILYSKPVA------SSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTAD 225

Query: 243 KPDN-LASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNN 301
            P+  L   QK L+DPMFQY+DILYEYE Y + E EYR+LY LH LNHVYKTRDRILKNN
Sbjct: 226 DPEKPLTPQQKVLLDPMFQYQDILYEYEGYDR-EREYRELYTLHILNHVYKTRDRILKNN 284

Query: 302 QRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYED 361
           Q+LQ+N D E LDQGFTRPK L++ PTR TAY +V  ++ +SGI+QVDK+ KFKDQFY+ 
Sbjct: 285 QKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDP 344

Query: 362 SLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENT 421
           SLPP+SKPKSFQ +FKGNTNDFFVLGMKFTRKAI+LYSNFYQSD+IVCSPLGLQ+I+ENT
Sbjct: 345 SLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENT 404

Query: 422 DKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYIN 481
           DKKKRQDDFLSSIE+ ++DQLHSIE+QNI+H+  IF H+N IP +Q DADFSRIRMWYI 
Sbjct: 405 DKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIE 464

Query: 482 DQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQ 541
           DQA+ FRQTMVFT+YISP AN+++N KC NW+GR K+HR+VS E S IG+L L++RQIFQ
Sbjct: 465 DQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQ 524

Query: 542 RFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTR 601
           RFEV GGS VDEPD+RFKFFTSV++PGI K+TGY+ GIL+YIPEYTD++RVRNYLK+KTR
Sbjct: 525 RFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTR 584

Query: 602 ILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPE 661
           ILFGDINEYS Q+QLT+NR+LFQ GR+KVLLYTERLHH+RR+E+KGVKSVI YKPPS+PE
Sbjct: 585 ILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPE 644

Query: 662 FYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721
           FY E++R IG++AFLG  DLNI+TVRC+YSK+D+LALE +VGT+RA VL HGQNE+YEFK
Sbjct: 645 FYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 81/195 (41%), Gaps = 36/195 (18%)

Query: 488 RQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTG 547
           RQTM+FT   SPT   + NG  +  S     +  V  E S       +++QI +      
Sbjct: 324 RQTMMFTATFSPTIEKVANGYLKKPS-----YVTVGGEES-----KPKIKQIVR------ 367

Query: 548 GSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEK---TRILF 604
              V + + + K      +P       Y+  I+I+I    +Y R  ++L +K    R   
Sbjct: 368 --YVPDEEEKLKILVKDFLP------NYKAPIIIFI----NYKRTADWLFDKLREARFRA 415

Query: 605 GDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYT 664
             ++   SQ+Q   + SL + G++ +L+ T+     R  +I  V  V+  + P     + 
Sbjct: 416 TTLHGSKSQEQREHSLSLLRNGKVDILIATDVAG--RGIDIPNVSLVVNLQFPKS---FD 470

Query: 665 EVVRNIGRNAFLGNT 679
             V  +GR    G T
Sbjct: 471 SFVHRVGRTGRAGKT 485

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 82/200 (41%), Gaps = 33/200 (16%)

Query: 488 RQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTG 547
           +QT++FT  +S +   I NG  RN          +    S     + +++QI +      
Sbjct: 349 KQTLMFTATMSSSIERIANGYLRN-----PGFVTIGGSGS-----APQIQQIIE------ 392

Query: 548 GSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILFGDI 607
              V   + RFK  T  I+P       Y   ++I+I        +    +E+++     +
Sbjct: 393 --YVATDEQRFKMLTQDILP------NYRPPVIIFINYKVTADWLLRKFQEESKFRVTIL 444

Query: 608 NEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTEVV 667
           +   SQ Q   +   F++G++ +++ T+     R  +I  V  V+ ++ PS  + Y   +
Sbjct: 445 HGSKSQTQREHSLKAFREGKVDIMVATDVAG--RGIDIPNVSLVVNFQMPSKLDDYIHRI 502

Query: 668 RNIGRN-------AFLGNTD 680
              GR         FLG+ D
Sbjct: 503 GRTGRANQKGTTLTFLGDKD 522

>Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar to
           Ashbya gossypii ADL024C
          Length = 569

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 9/84 (10%)

Query: 623 FQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLN 682
           F+ G L  L+ T+ L   R  + KGV  VI Y  P   + Y   +   GR    G     
Sbjct: 413 FKSGDLWCLICTDVL--ARGVDFKGVNLVINYDIPRSAQAYVHRIGRTGRGGMKGKA--- 467

Query: 683 ISTVRCIYSKLDALALENVVGTQR 706
                 +Y+K DA+A++ +V   +
Sbjct: 468 ----VTLYTKQDAIAIKPIVNVMK 487

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 35.0 bits (79), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 81/196 (41%), Gaps = 34/196 (17%)

Query: 488 RQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTG 547
           RQT++FT  ++P    I  G  R          + +      G   L ++QI +      
Sbjct: 388 RQTLMFTATMTPVIEKIAAGYMRK--------PVYATIGVDTGSEPL-IQQIVE------ 432

Query: 548 GSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEK----TRIL 603
               D  + +FK   S++       T YE  I+I+I    +Y +  ++L E+    T + 
Sbjct: 433 --YADNEEQKFKKLKSIV-------TKYEPPIIIFI----NYKQTADWLAERFQKETNMR 479

Query: 604 FGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFY 663
              ++   SQ+Q   +  LF+ GR++V++ T      R  +I  V  V+ ++     + Y
Sbjct: 480 VTILHGSKSQEQREHSLQLFRSGRVQVMIATNV--AARGLDIPNVSLVVNFQISKKIDDY 537

Query: 664 TEVVRNIGRNAFLGNT 679
              +   GR A  G  
Sbjct: 538 IHRIGRTGRAAKKGTA 553

>CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa]
           {ON} highly similar to uniprot|P20449 Saccharomyces
           cerevisiae YOR046c DBP5 RNA helicase
          Length = 504

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 32/67 (47%), Gaps = 5/67 (7%)

Query: 623 FQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEF---YTEVVRNIGRNAFLGNT 679
           F++GR KVL+ T  L   R  +I  V  V+ Y  P+ P     Y   V  IGR    G T
Sbjct: 398 FREGRSKVLITTNVLA--RGIDIPSVSMVVNYDLPTLPNGMPDYATYVHRIGRTGRFGRT 455

Query: 680 DLNISTV 686
            + IS V
Sbjct: 456 GVAISFV 462

>KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.614
           YOR204W
          Length = 611

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 12/100 (12%)

Query: 585 EYTDYVRVRNYLKEKTRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYE 644
           + TD++ ++N+       + GD  +   ++ L A    F+ GR  +L+ T      R  +
Sbjct: 409 QLTDFLIMQNF---NATAIHGDRTQEERERALGA----FKAGRADILVATAVA--ARGLD 459

Query: 645 IKGVKSVIFYKPPSDPEFYTEVVRNIGRNAFLGNTDLNIS 684
           I  V  VI +  PSD + Y   V  IGR    GNT + IS
Sbjct: 460 IPNVTLVINFDLPSDIDDY---VHRIGRTGRAGNTGVAIS 496

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 78/193 (40%), Gaps = 42/193 (21%)

Query: 488 RQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFEVTG 547
           RQT++FT  ++P    I  G  R          + +      G   L +RQ+ +      
Sbjct: 371 RQTLMFTATMTPVIEKIAAGYMRK--------PVYATIGLDTGSEPL-IRQVVE------ 415

Query: 548 GSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKE--------K 599
               D  + +FK   SV+I        YE  I+I+I    +Y +  ++L E        K
Sbjct: 416 --YADNEEEKFKKLKSVVIK-------YESPIIIFI----NYKQTADWLAERFQTETNMK 462

Query: 600 TRILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSD 659
             IL G      SQ+Q   +  LF+ G++++++ T      R  +I  V  V+ ++    
Sbjct: 463 VTILHGS----KSQEQREHSLQLFRTGKVQIMIATNV--AARGLDIPNVSLVVNFQISKK 516

Query: 660 PEFYTEVVRNIGR 672
            + Y   +   GR
Sbjct: 517 IDDYVHRIGRTGR 529

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,103,081
Number of extensions: 3839468
Number of successful extensions: 18046
Number of sequences better than 10.0: 123
Number of HSP's gapped: 18545
Number of HSP's successfully gapped: 123
Length of query: 721
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 604
Effective length of database: 40,065,477
Effective search space: 24199548108
Effective search space used: 24199548108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)