Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0A053902.293ON49749724050.0
KAFR0J013302.293ON49148815530.0
NCAS0B062202.293ON48649215410.0
YIL090W (ICE2)2.293ON49149314990.0
Smik_9.892.293ON49149314950.0
NDAI0B035202.293ON50149714950.0
Skud_9.832.293ON49149314880.0
Suva_9.1092.293ON49149214800.0
TDEL0G022302.293ON48848714520.0
CAGL0D04202g2.293ON49950314330.0
SAKL0E07524g2.293ON47948914120.0
ZYRO0A02024g2.293ON48648313660.0
KLTH0G10516g2.293ON47448712691e-171
Kwal_27.115002.293ON47548312641e-171
Kpol_1003.422.293ON49048512281e-165
Ecym_33322.293ON51351711861e-158
ADL208W2.293ON50250711431e-152
TBLA0B069902.293ON53652710801e-142
KLLA0E08207g2.293ON48648110621e-140
TPHA0C034402.293ON57953410261e-133
TBLA0B059802.293ON49349010091e-132
SAKL0D05610g1.275ON47847760.88
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0A05390
         (497 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   931   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   602   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   598   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   582   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   580   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   580   0.0  
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   577   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   574   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   563   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   556   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   548   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   530   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   493   e-171
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   491   e-171
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   477   e-165
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   461   e-158
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   444   e-152
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            420   e-142
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   413   e-140
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   399   e-133
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   393   e-132
SAKL0D05610g Chr4 complement(452447..453883) [1437 bp, 478 aa] {...    34   0.88 

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/497 (93%), Positives = 464/497 (93%)

Query: 1   MTATLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSI 60
           MTATLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSI
Sbjct: 1   MTATLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSI 60

Query: 61  IARKNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILN 120
           IARKNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILN
Sbjct: 61  IARKNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILN 120

Query: 121 VSMSSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYE 180
           VSMSSSEANWIF       VVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYE
Sbjct: 121 VSMSSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYE 180

Query: 181 KNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIV 240
           KNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTA              IYGIV
Sbjct: 181 KNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIV 240

Query: 241 SDSGSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYY 300
           SDSGSVIESSLFFAYIVRCIYEISPK            FKDVWQKRQGNLPIRNNLIFYY
Sbjct: 241 SDSGSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYY 300

Query: 301 NNVILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIRE 360
           NNVILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIRE
Sbjct: 301 NNVILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIRE 360

Query: 361 ILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYS 420
           ILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYS
Sbjct: 361 ILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYS 420

Query: 421 PCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTI 480
           PCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTI
Sbjct: 421 PCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTI 480

Query: 481 LVYANELIGDTTHTEIS 497
           LVYANELIGDTTHTEIS
Sbjct: 481 LVYANELIGDTTHTEIS 497

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/488 (60%), Positives = 362/488 (74%), Gaps = 2/488 (0%)

Query: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64
           L+   IRG RI SG  YLL TLISIP+SFK+GG++CGL+FT TLFI YF+STTLSI+AR+
Sbjct: 4   LSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILARQ 63

Query: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124
           +G+R YIVL+S++YYCQH IIASLL+ FLSGFSN ELH+++++    IE L +  N  + 
Sbjct: 64  SGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIEVLVA--NQDLM 121

Query: 125 SSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSN 184
            SE+NW+        VV PWKFVLS+STPFF L+EGFFTILAIQAIGETN+WL  EKNSN
Sbjct: 122 VSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEKNSN 181

Query: 185 AWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSG 244
           +WIISSLL SS V++A+LYYLYRIYVTPIWEL+ QTA              I+GI+S+ G
Sbjct: 182 SWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIISERG 241

Query: 245 SVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVI 304
           SV+ESSLFFAYIVRCIYEISPK            FK+VWQ+ QG LPI +N++ YY +VI
Sbjct: 242 SVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYRSVI 301

Query: 305 LKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLM 364
           LKN EM W+ F+ +T        N      N W    P+WKFFKNFT+SVPFSI E+  M
Sbjct: 302 LKNTEMIWEAFLSKTKQHSNHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSISELSGM 361

Query: 365 TWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCIL 424
             +M+ ES+SPAVV+NLCFR+LIFYSATRI+PSLQRK+ R+ R+SR++M+++YWYSPCIL
Sbjct: 362 MLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCIL 421

Query: 425 IAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYA 484
           IAMY HLILQYS ELK EL LWG ++ L      +   +VVD+W FWNWCN+F TIL+Y 
Sbjct: 422 IAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFWTILIYG 481

Query: 485 NELIGDTT 492
            EL G  T
Sbjct: 482 GELFGTPT 489

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/492 (60%), Positives = 373/492 (75%), Gaps = 9/492 (1%)

Query: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64
           ++S FIRG RICS   YLL TLISIPISFK+GGL+CGLAFT +LFILYF+STTLSI ARK
Sbjct: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61

Query: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124
            G+RI+I+L++ILYY QHFIIASLL+LFLSGFSN +L  ++ +   PI+S+  I   +++
Sbjct: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121

Query: 125 SS-EANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
           SS +ANW+         V PW+F+LS+STPFFTLSEGFFTILAIQAIGETNKWL YE NS
Sbjct: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N W+ISSLL S  VI+A+LYYLYRIYVTPIW+L+VQTA              IYGIV+D 
Sbjct: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESS+FFAYIVRCIYEISPK            FK+VWQ+ Q NL   NNL+ YY+NV
Sbjct: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301

Query: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILL 363
           +LKNIE  W++F +   +     +  S           PIWK  K FT++VP SI E+  
Sbjct: 302 VLKNIETIWESFKINDNS-----FITSFSTERVITIFMPIWKLLKTFTITVPSSINELCF 356

Query: 364 MTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCI 423
           +T+KM+ ES+SPAV++NLCFR+LIFYSATRI+P+LQR+D  E R+SR++M+++YWYSPCI
Sbjct: 357 VTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYSPCI 416

Query: 424 LIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVY 483
           LIAMYAHLILQYS ELK+ELCLWGCN+ +  + +DQ + ++VD+W FWNWCN+F TILVY
Sbjct: 417 LIAMYAHLILQYSGELKDELCLWGCNSKI--FPSDQPK-IIVDSWGFWNWCNIFFTILVY 473

Query: 484 ANELIGDTTHTE 495
           A+ELIG T  ++
Sbjct: 474 ASELIGTTPGSK 485

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/493 (59%), Positives = 361/493 (73%), Gaps = 8/493 (1%)

Query: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63
           +L+  F++  RIC+   YLL TL+SIPISFKVGGL CGL+FT TLF LYF++TTL+++AR
Sbjct: 3   SLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAR 62

Query: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123
           ++G R+YI  ++ LYY QHFIIASLL+LFLSGFSN EL  +++N     ES    L  S+
Sbjct: 63  RHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKNSL 122

Query: 124 SSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
           +S++ N++        VV PW+FVL+ STPFFTLSEGFFTILAIQA+GETN+WL  + NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N WIISSLLTS  VI+A+LYYLYRIYVTPIW L++QTA              +YGIVS  
Sbjct: 183 NTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQK 242

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESSLFFAYIVRCIYEISPK            FKDVWQK Q NLP  +NL+ Y++NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLL----LNNTWKFCKPIWKFFKNFTLSVPFSIR 359
           ILKN E+ W +FI R G   T +++  L+            KP WKFFKNFT SVP SI 
Sbjct: 303 ILKNAEVLWGSFIPR-GRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSIN 361

Query: 360 EILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWY 419
           E   +T KM+ ESVSPA+VINLCFR+L+FYSATRI+P+LQRK+ ++ R+SR++M+ +YWY
Sbjct: 362 EFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWY 421

Query: 420 SPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCT 479
           SPCILIAMY HLILQYS ELK +LC+WGC+    G   DQ E ++VD+W FWNWCN+FCT
Sbjct: 422 SPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--VDQPE-IIVDSWGFWNWCNIFCT 478

Query: 480 ILVYANELIGDTT 492
           ILVYA ELIG  +
Sbjct: 479 ILVYATELIGSGS 491

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/493 (58%), Positives = 360/493 (73%), Gaps = 8/493 (1%)

Query: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63
           +L+  F++  RIC+   YLL TL+SIPISFKVGGL CGL+FT TLF LYF++TTL+++AR
Sbjct: 3   SLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAR 62

Query: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123
           + G ++YI L+S LYY QHFIIASLL+LFLSGFSN EL  +++      ES    L  S+
Sbjct: 63  RYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKNSL 122

Query: 124 SSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
           +S++ N++        VV PW+F+L+ STPFFTLSEGFFTILAIQA+GETN+WL  + NS
Sbjct: 123 NSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N WIISSLL S  VI+A+LYYLYRIYVTPIW L++QTA              +YGIVS  
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESSLFFAYIVRCIYEISPK            FKDVWQK Q NLP  +NL+ Y++NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLL----LNNTWKFCKPIWKFFKNFTLSVPFSIR 359
           ILKN EM W +FI R G   T +++  L+            KP WKFFKNFT SVP SI 
Sbjct: 303 ILKNAEMLWGSFIPR-GRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSIN 361

Query: 360 EILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWY 419
           E   +T KM+ ESVSPA+V+NLCFR+L+FYSATRI+P+LQRK+ ++ R+SR++M+ +YWY
Sbjct: 362 EFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWY 421

Query: 420 SPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCT 479
           SPCILIAMY HLILQYS ELK +LC+WGC+    G  +DQ E ++VD+W FWNWCN+FCT
Sbjct: 422 SPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--SDQPE-IIVDSWGFWNWCNIFCT 478

Query: 480 ILVYANELIGDTT 492
           ILVYA ELIG  +
Sbjct: 479 ILVYATELIGSGS 491

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/497 (57%), Positives = 365/497 (73%), Gaps = 13/497 (2%)

Query: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64
           ++S F+RG R  S A YLL TLISIPISFK+GGL CGLAFTATLF +YF+STTLS++ARK
Sbjct: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61

Query: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124
            G+   I L+  LYY QH IIASLL+LFLSGFS+ +L   + +D   ++ ++ ++  ++S
Sbjct: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121

Query: 125 SSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSN 184
           S+ +NW          V PWK++LS+STPFFTLSEGFFTILAIQA+GETNKWL  E NSN
Sbjct: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181

Query: 185 AWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSG 244
            WIISSLLTS  VI+A+LYYLYRIYVTPIW+L++QTA              +YGIV++ G
Sbjct: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241

Query: 245 SVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVI 304
           SVIESSLFFAYIVRCIYEISPK            FK+VWQ+ QGNLP  +NL+FYYNN +
Sbjct: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301

Query: 305 LKNIEMAWDNFILRTGTSGTFNYNPS----------LLLNNTWKFCKPIWKFFKNFTLSV 354
           L++I+M W+  + +   +   N  PS          L  +   + CKPIWK FKNFT+SV
Sbjct: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361

Query: 355 PFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVME 414
           P SI E++L+T++M+ ESVSPAVVINLCFR+LIFYSATRI+P+LQR++  E ++SR++M+
Sbjct: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421

Query: 415 LVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWC 474
           ++YWYSPC+LIAMY HLILQYS ELK +LCLWGCN   L +       ++VD+W FWNWC
Sbjct: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCN---LKWLIPNQPELIVDSWGFWNWC 478

Query: 475 NVFCTILVYANELIGDT 491
           N+F TI++YA+EL G T
Sbjct: 479 NIFFTIIIYASELFGTT 495

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/493 (57%), Positives = 361/493 (73%), Gaps = 8/493 (1%)

Query: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63
           +L+  F++  R+C+   YLL TL+SIPISFKVGGL CGL+FT TLF LYF++TTL+++A+
Sbjct: 3   SLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAK 62

Query: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123
           ++G ++YI L++ LYY QHF+IASLL+LFLSGFSN EL  +++N +   ES    L  S+
Sbjct: 63  RHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSL 122

Query: 124 SSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
           +S++ N++        VV PW+FVL+ STPFFTLSEGFFTILAIQA+GETN+WL  + NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N WIISSLL S  VI+A+LYYLYRIYVTPIW L++QTA              +YGIVS  
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESSLFFAYIVRCIYEISPK            FKDVWQK Q NLP  +NL+ Y++NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLL----LNNTWKFCKPIWKFFKNFTLSVPFSIR 359
           +LKN EM W +FI R G   T +++  ++            +P WKFFKNFT SVP SI 
Sbjct: 303 VLKNAEMLWGSFIPR-GRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSIN 361

Query: 360 EILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWY 419
           E   +T KM+ ESVSPA+VINLCFR+L+FYSATRI+P+LQRK+ ++ R+SR++M  +YWY
Sbjct: 362 EFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWY 421

Query: 420 SPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCT 479
           SPCILIAMY HLILQYS ELK +LC+WGC+    G   +Q E ++VD+W FWNWCN+FCT
Sbjct: 422 SPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--AEQPE-IIVDSWGFWNWCNIFCT 478

Query: 480 ILVYANELIGDTT 492
           ILVYA ELIG  +
Sbjct: 479 ILVYATELIGSGS 491

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/492 (58%), Positives = 358/492 (72%), Gaps = 6/492 (1%)

Query: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63
           +L+  F++  RIC+   YLL TL+SIPISFKVGGL CGL+FT TLF LYF++TTL+++AR
Sbjct: 3   SLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAR 62

Query: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123
           +NG R+YI L+S LYY QHF+IASLL LFLSGFSN EL  +++N +   ES    L  S+
Sbjct: 63  RNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKNSL 122

Query: 124 SSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
           +S++ N++        VV PW+F+L+ STPFFTLSEGFFTILAIQA+GETN+WL  + NS
Sbjct: 123 NSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N WIISSLL S  VI+A+LYYLYRIYVTPIW L++QTA              +YGIVS  
Sbjct: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQR 242

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESSLFFAYIVRCIYEISPK            FKDVWQK Q NLP  +NL+ Y++NV
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302

Query: 304 ILKNIEMAWDNFI--LRTGTSGTFNYNPSLL-LNNTWKFCKPIWKFFKNFTLSVPFSIRE 360
           ILKN E+ W +FI   R  TS       S+L         KP W+F KNFT SVP SI E
Sbjct: 303 ILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSINE 362

Query: 361 ILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYS 420
              +T KM+ ESVSPA+VINLCFR+L+FYSATRI+P+LQRK+ ++ R+SR++M+ +YWYS
Sbjct: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYWYS 422

Query: 421 PCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTI 480
           PCILIAMY HLILQYS ELK +LC+WGC+    G   DQ E ++VD+W FWNWCN+FCTI
Sbjct: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--PDQPE-IIVDSWGFWNWCNIFCTI 479

Query: 481 LVYANELIGDTT 492
           LVYA EL+G  +
Sbjct: 480 LVYATELVGSGS 491

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/487 (56%), Positives = 350/487 (71%), Gaps = 3/487 (0%)

Query: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63
           T++  F++G R+     YLL TL++IPISFKVGGLYCGL+FT TLF LY ++TTLS++A+
Sbjct: 3   TISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQ 62

Query: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123
             GN+ YIV ++ +YY QHF+IASLL+LFLSGFSN EL K++E+ + P +SL ++L  ++
Sbjct: 63  SYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRNNV 122

Query: 124 SSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
            S+ ++W+        VV PW+ VL+HST FF LSEGFFT+L IQAIGETN+WL  E NS
Sbjct: 123 FSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEMNS 182

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N WII+SLLTS  VI+A+LYYLYRIYVTPIW L+VQTA              ++GIVS +
Sbjct: 183 NTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVSKN 242

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESSLFFAYIVRCIYEISPK             K  WQK Q NL   NNL+ YY +V
Sbjct: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQDV 302

Query: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILL 363
           +LKN EM W++ +LRT  S    +     LN  W    PIWKFFK F LSVP SI  +  
Sbjct: 303 VLKNAEMVWESIVLRTKNSDATTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSIGGVFQ 362

Query: 364 MTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCI 423
           +T K++ ESVSPA+V+NLCFR+L+FYSATRI+P+LQRK+ RE R+SR++M ++YWYSPCI
Sbjct: 363 VTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCI 422

Query: 424 LIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVY 483
           LIAMY HLILQYS EL ++LCLWGC+    G    + E   ++ W FWNWCN+F T+L+Y
Sbjct: 423 LIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIE---INTWVFWNWCNIFWTVLIY 479

Query: 484 ANELIGD 490
            +ELIG 
Sbjct: 480 GSELIGG 486

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/503 (56%), Positives = 357/503 (70%), Gaps = 17/503 (3%)

Query: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64
           +T G  R  RI S ALYL+LTL+SIPISFK+GGL CGL+FT TLF LY +STTLS++AR+
Sbjct: 4   ITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLARR 63

Query: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKII---------ENDAIPIESL 115
           + NR Y+  +SILYY QH +IA LL LFLSGFSN E ++ +         + D   ++ L
Sbjct: 64  SCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFLDLL 123

Query: 116 T-SILNVSMSSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETN 174
              IL  + + +  NW         +V PW+++LS+STPFFTL EGFFTILAIQAIGETN
Sbjct: 124 KHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIGETN 183

Query: 175 KWLCYEKNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXX 234
           KWL YE NSN WII+SLL S  VI+ +LYYLYRIYVTPIW+LT+Q+A             
Sbjct: 184 KWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIVFCL 243

Query: 235 XIYGIVSDSGSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRN 294
            +YGI+S  GSVIESSLFFAYIVRCIYEISPK             KDVWQ  Q NL  R+
Sbjct: 244 GLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLLNRD 303

Query: 295 NLIFYYNNVILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSV 354
           NL+ YY+NV+LKN EM W++FIL    S + N    +     W    P+WKFFKNFT+SV
Sbjct: 304 NLLAYYHNVVLKNAEMVWESFIL--PRSRSLNAMEKIRF---WLDVTPVWKFFKNFTVSV 358

Query: 355 PFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVME 414
           P SI E++ +T+KM+ ES+SPAV++NLCFRILIFYSATRI+P+LQR   +EQR+SR++++
Sbjct: 359 PSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKEQRQSRRILK 418

Query: 415 LVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWC 474
           L+YWYSPC+LIAMY HLILQYS ELK ELCLWGC +   G + DQ   +V D+W FWNWC
Sbjct: 419 LLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFG-SKDQPR-IVTDSWSFWNWC 476

Query: 475 NVFCTILVYANELIGDTTHTEIS 497
           N+F T+LVYANELIG     E++
Sbjct: 477 NIFWTVLVYANELIGTQAPNELT 499

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/489 (57%), Positives = 343/489 (70%), Gaps = 13/489 (2%)

Query: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64
           L    I+  R C    YLLL LI+IPISF+VGGLYCGL+FT TLF LYF++TTL I+++K
Sbjct: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKK 61

Query: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDA-IPIESLTSILNVSM 123
             NR+Y  ++S +YY QHFII SLL LFLSGF+N EL + I+ D  +P ESL + L    
Sbjct: 62  Y-NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLR--N 118

Query: 124 SSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183
            S + +WIF        V PW+FVL HSTP+FTL EGFFT+L IQAIGETNKWL Y KNS
Sbjct: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDS 243
           N WII SLL S  VI+ +LYYLYRIYVTP+WEL++QTA              +YGIVS  
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 244 GSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNV 303
           GSVIESSLFFAYIVRCIYEISP+             KD WQK QGNLP  +NL+ YY NV
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297

Query: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILL 363
           +LKN EM WD  + +TGT+     +PS      W   +P+WKF KNFT+SVP SIREI  
Sbjct: 298 VLKNGEMIWDAIVQKTGTT-----SPS-TTQMVWLRLQPLWKFTKNFTISVPSSIREIFR 351

Query: 364 MTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCI 423
           +T KM+ ESV+P VVINL FRIL+FYSATRI+P+LQ+ D+  ++ SR++M L+YWYSPCI
Sbjct: 352 VTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYSPCI 411

Query: 424 LIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVY 483
           +IAMY HLILQYS EL N+LCLWGC      +  D +  VVVDAW FWNWCNVFCT+ +Y
Sbjct: 412 VIAMYTHLILQYSGELNNDLCLWGC--FPWSHTNDPSSKVVVDAWGFWNWCNVFCTLAIY 469

Query: 484 ANELIGDTT 492
             ELIG  +
Sbjct: 470 GLELIGGKS 478

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/483 (55%), Positives = 343/483 (71%), Gaps = 5/483 (1%)

Query: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69
           ++  R+     YLL  LI+IPISFKVGGLYCGL+FT TLF LYF+STTLS+  R   +R 
Sbjct: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64

Query: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129
           Y+  ++ +YY QH IIASLL+LFLSGFSN EL KI+E+ + P +SL  +L  +  S+ +N
Sbjct: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124

Query: 130 WIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189
           WI        +V PW+++LSHST FF+LSEGFFTILAIQA+GE+++WL YE NSN W I+
Sbjct: 125 WILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184

Query: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIES 249
           SLL S  VI+AALYYLYRIYVTP+WEL++QTA              +YGIVS +GSVIES
Sbjct: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244

Query: 250 SLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309
           SLFFAYIVRCIYEISPK            FK+ WQK Q N    NNL+ YY++V+L + E
Sbjct: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304

Query: 310 MAWDNFILRTGTSGTFNYNPSLL--LNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWK 367
           M W++ + +T T+    Y+ S+   L       KP+  FFKNFT+SVP SI  +  +T K
Sbjct: 305 MMWESIVSKTVTTSDPFYHTSMFPPLRKFTDIFKPVGIFFKNFTISVPSSIEGLFQVTLK 364

Query: 368 MSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAM 427
           M+ +SVSPA+V+NL FR+LIFYSAT+I+P+LQ K  R+  +SR++M ++YWYSPCILIAM
Sbjct: 365 MASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILIAM 424

Query: 428 YAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANEL 487
           Y HLILQYS EL  +LCLWGCN++    N  +   +VVD+W FWNWCN+F TILVY +EL
Sbjct: 425 YTHLILQYSGELNRDLCLWGCNSMWFSLNQTK---IVVDSWGFWNWCNIFWTILVYGSEL 481

Query: 488 IGD 490
           IG 
Sbjct: 482 IGG 484

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 260/487 (53%), Positives = 327/487 (67%), Gaps = 23/487 (4%)

Query: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69
           I+  R+C  + YLLL LI+IPISF+VGGLYCGL+FT TLF LY ++TTL I AR  G   
Sbjct: 7   IQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG--- 63

Query: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129
              L+S  YY QHF I SLL LFLSGFSN EL + I+ +  P ESL  +L  +  S    
Sbjct: 64  LAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTTQSQ--T 121

Query: 130 WIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189
           W+F       VV PW+F+L  STP+FTL EGFFT+L IQA+GETN+WL     SN W+IS
Sbjct: 122 WVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMWVIS 181

Query: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIES 249
            L+ S  VI+AALYYLYRIYVTPIWEL+VQTA              IYGIVS  GS IES
Sbjct: 182 GLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGSTIES 241

Query: 250 SLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309
           SLFFAYIVRC+YEISP+             K+ W  +  +L   + L+ YY ++ILKN E
Sbjct: 242 SLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILKNGE 301

Query: 310 MAWDNFILRT----GTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMT 365
           M WD  + RT    G SGT  +        +W   +P+WKF K+FT SVP SI+EI  +T
Sbjct: 302 MVWDAILARTNVNVGASGTPVW-------ASWNRVQPLWKFVKHFTSSVPSSIQEIFYLT 354

Query: 366 WKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILI 425
            +M+ E+++PAVVINLCFRILIFYSATRI+P+LQ+K    +RRSR+ M ++YWYSPCI+I
Sbjct: 355 LEMAREAIAPAVVINLCFRILIFYSATRIIPALQKK---HKRRSRRFMRMLYWYSPCIVI 411

Query: 426 AMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYAN 485
           AMY HLILQYS ++ N+LCLWGC      ++      VVVD+W FWNWCN+FCT+ +YA+
Sbjct: 412 AMYTHLILQYSGQISNDLCLWGC----FPWSVPDTPKVVVDSWGFWNWCNIFCTMAIYAS 467

Query: 486 ELIGDTT 492
           EL+G  +
Sbjct: 468 ELLGSKS 474

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  491 bits (1264), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 258/483 (53%), Positives = 326/483 (67%), Gaps = 15/483 (3%)

Query: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69
           ++  R+C  + YLLL LI+IPI+F+VGGLYCGL+FT TLF LY ++TTL I AR  G   
Sbjct: 7   LQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG--- 63

Query: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129
           +  L+S  YY QHF I SLL LFLSGFSN EL   I+ +  P ESL  +L  S  S    
Sbjct: 64  FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTHSQP-- 121

Query: 130 WIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189
           WIF       VV PW+F+L  STP+FTL EGFFT+L IQA+GETN+WL     SN W+IS
Sbjct: 122 WIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSNVWVIS 181

Query: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIES 249
            L+TS  VI+AALYYLYRIYVTPIWEL+VQTA              I+GIVS  GS IES
Sbjct: 182 GLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRGSTIES 241

Query: 250 SLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309
           SLFFAYIVRC+YEISP+             KD W  +  +L   +  + YY ++ILKN E
Sbjct: 242 SLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDIILKNGE 301

Query: 310 MAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWKMS 369
           M WD  + RT  + +    P   +  +W   +P+WKF K+FT SVP SI+EI L+T  M+
Sbjct: 302 MIWDAVLARTNVNVS-GAGPVAWI--SWHRVQPLWKFVKHFTSSVPSSIQEIFLLTLSMA 358

Query: 370 LESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYA 429
            E+++PAVVINLCFRILIFYSATRI+P+LQRK    +RRSR+ M ++YWYSPCI+IAMY 
Sbjct: 359 REAIAPAVVINLCFRILIFYSATRIIPALQRK---HKRRSRRFMRMLYWYSPCIVIAMYT 415

Query: 430 HLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489
           HLI+QYS ++ N+LCLWGC      ++  +   VVVD+W FWNWCN+FCT+ +YA+EL G
Sbjct: 416 HLIMQYSGQISNDLCLWGC----FPWSPPEGSKVVVDSWGFWNWCNIFCTMAIYASELFG 471

Query: 490 DTT 492
             +
Sbjct: 472 SKS 474

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  477 bits (1228), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 247/485 (50%), Positives = 319/485 (65%), Gaps = 9/485 (1%)

Query: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69
           IR  ++     YLL  + +IPISFK+GGLYCGL FT TLF LYF STTL+IIAR+ G++ 
Sbjct: 9   IRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARRWGSKP 68

Query: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129
            I+++S  +Y Q+FII SLLHLFL+GF+N +L K I +   P E+   +L   +  S  N
Sbjct: 69  AIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRGDIPVSVKN 128

Query: 130 WIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189
           W+         V PW+ +LS+STP FTL EGFFTIL IQ IGE N WL +E+NSN WIIS
Sbjct: 129 WLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHERNSNIWIIS 188

Query: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIES 249
           SLLTS  +I+ +LYYLYRIY TPIW L+V  A              IYGIVS +GSVIES
Sbjct: 189 SLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVSHNGSVIES 248

Query: 250 SLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309
           SLFFAYIVRCIYEI+P+             K+VWQ    NL + +  I Y+ +       
Sbjct: 249 SLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFYDSFHMQAH 308

Query: 310 MAWDNFILRTGTSGTF-NY---NPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMT 365
             W  F  RT   G   NY    PSL++  +  +  PIW+  K  T SVP SI E+  +T
Sbjct: 309 KFWTLFTSRTPYYGYLHNYCMDYPSLVMIRSNFY--PIWETLKTLTFSVPTSISELFHLT 366

Query: 366 WKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILI 425
            +M+++SVSPA++INLCFR++IFYSATRI+P++Q++   E R+ R +M+ +YWYSPCILI
Sbjct: 367 VRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCILI 426

Query: 426 AMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYAN 485
           AMY HLILQYS ELK +LCLWGC++   G   +  E + VDAW FWNWCN+F TI++Y +
Sbjct: 427 AMYTHLILQYSGELKKDLCLWGCDSTWFG---EDQERINVDAWSFWNWCNIFWTIIIYGS 483

Query: 486 ELIGD 490
           ELIG 
Sbjct: 484 ELIGG 488

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  461 bits (1186), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 248/517 (47%), Positives = 335/517 (64%), Gaps = 37/517 (7%)

Query: 5   LTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK 64
           L+ G +R  R      YL L LI+IPISF+VGGLYCGL+FT TLFILYF +TTL I    
Sbjct: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITT-T 60

Query: 65  NGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMS 124
           NG+  + +L+S++YY QHF+I S+L LFLS F++ +L +++++DA+   S   I   +++
Sbjct: 61  NGSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 125 -----------SSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGET 173
                       +E +          +V PW+++L H+TP+FTL+EGFFT+LAIQAIGET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 174 NKWLCYEKNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXX 233
            +WL Y+KNSN W+I SLL S  VI+ +++YLYRIYVTPIW L+VQTA            
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 234 XXIYGIVSDSGSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIR 293
             +YGI+S  GS IESSLFFAY+VRCIYEISP+              D WQ +QG L  +
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-K 299

Query: 294 NNLIFYYNNVILKNIEMAWDNFILRT--GTSGT-------FNYN---------PSLLLNN 335
           NNL+ YYN  +  N E  WD+ + +T  GT+         F Y+          +L++  
Sbjct: 300 NNLLTYYNTFV-SNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 336 T--WKFCKPIWKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATR 393
           T  W  C+ IW F KNF++ +P SI EIL++T KM+ ES++PAV+ NL FR+L+FYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 394 IVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNILL 453
           I+P+LQ+     Q  SRK+M ++YWYSPCI+IAMY HLIL+YS EL N+LC+WGC    L
Sbjct: 419 IIPALQKATGATQ--SRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-WL 475

Query: 454 GYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIGD 490
            ++       VVDAW FWNWCN+F T+L+YA ELIG 
Sbjct: 476 NFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  444 bits (1143), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 240/507 (47%), Positives = 315/507 (62%), Gaps = 32/507 (6%)

Query: 7   SGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNG 66
            G +R  R    + YL L LI++PISF++GGLYCGL+FT TLFILYFV+TTL I A   G
Sbjct: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63

Query: 67  NRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIEN------------DAIPIES 114
           +  +  ++S LYY QHF++ S+L LFLSGF+N +L K +              D    ES
Sbjct: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122

Query: 115 LTSILNVSMSSSEANWIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETN 174
           L  +L  S        +        VV PW+++L H+TP FTL+EGFFT+LAIQ IGET 
Sbjct: 123 LLQLLGRSRDDRAT--MAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 175 KWLCYEKNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXX 234
           +WL Y++NS AW+ISSL+ S  VI+ ++YYLYRIYVTPIW L+V TA             
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 235 XIYGIVSDSGSVIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRN 294
            +YGI+S  GS IESSLFFAY+V CIYEISP+              + WQ +QG LP +N
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299

Query: 295 NLIFYYNNVILKNIEMAWDNFILRTG--TSGTFNYNPS---------LLLNNTWKFCKPI 343
           +L+ YY N IL N E  WD  + +     S   +  PS         L+    W   + +
Sbjct: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358

Query: 344 WKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDA 403
           W F KNF+  +P SI EI ++T  ++ ES++ AVV NL FR+++FYSATRI+P+LQR   
Sbjct: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418

Query: 404 REQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETV 463
             Q  SRK+M ++YWYSPCI+IAMY H+IL+YS EL NELC+WGC   L   +    +  
Sbjct: 419 GTQ--SRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWL--QSEANRDRW 474

Query: 464 VVDAWRFWNWCNVFCTILVYANELIGD 490
           VVDAW FWNWCN+F T+L+YA ELIG 
Sbjct: 475 VVDAWGFWNWCNLFFTLLIYAVELIGS 501

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  420 bits (1080), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 230/527 (43%), Positives = 327/527 (62%), Gaps = 49/527 (9%)

Query: 11  RGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRIY 70
           +  R+  G  YL+  LI+IP +FK+GGLYCGL+FT TLF LYF+STT+ +IA++  N  Y
Sbjct: 10  QSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTLNNFY 69

Query: 71  IVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIEN---DAIPIESLTSILNVSMSSSE 127
           I+LS+++YY QH +IASLL++F++ FS+  L++I+ N   D +P   L  I N +  S  
Sbjct: 70  ILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLP-SLLYYIKNDTSKSVS 128

Query: 128 ANW--IFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNA 185
            N+  +         V PW ++LSHSTPFFTL EGFFTIL IQAIGET  WL  +K    
Sbjct: 129 QNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQKKI 188

Query: 186 WIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGS 245
           + + + L S  VI  A+++LY+IY   +WEL++QTA              I+GI S +GS
Sbjct: 189 FKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFSTNGS 248

Query: 246 VIESSLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVIL 305
           +IESSLF  YI+RC YEISP+             K+ WQ  QG++ +  +++FYYNNV+L
Sbjct: 249 LIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNNVLL 308

Query: 306 KNIEMAW---DNFILRTGTSG-----------TFNY------NPSLLLN---------NT 336
           KNI  ++    NF     TS            T NY       PS L++         N 
Sbjct: 309 KNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIYQNW 368

Query: 337 WKFCKPIWKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVP 396
             +  PI++  K+F L++P S+  +  +T+K++ +SVSP++VINLCFR+LIFYSATRI+P
Sbjct: 369 LIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATRIIP 428

Query: 397 SLQRKDAREQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKNELCLWGCN------- 449
           ++QRK+  E +RSR  ++  Y +SPCI+IAMY +LILQYS ELKN+LC+WGC+       
Sbjct: 429 AVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISKSIS 488

Query: 450 ------NILLGY-NTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489
                 N+ +G  +T  N   +V++W FWNWCN+FCTI +Y  EL+G
Sbjct: 489 QRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  413 bits (1062), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/481 (46%), Positives = 300/481 (62%), Gaps = 44/481 (9%)

Query: 10  IRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRI 69
           ++  RI    +YL L LI+IPISF+VGGL CGL+FT TLF LYFVSTT  ++    G+  
Sbjct: 48  LQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLLDRGS-- 105

Query: 70  YIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEAN 129
              LS+++YY QH +I S+L +FLS F N      I++D +  E      NV        
Sbjct: 106 --ALSTLIYYLQHLLIPSILFMFLSYFEN------IDSDTVDSEYFKVFWNV-------- 149

Query: 130 WIFXXXXXXXVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189
                     +V PW+  L HSTP FTL EG FTILAIQAIGET +WL   + SN W+I 
Sbjct: 150 ----------MVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSRRSNQWVIL 199

Query: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIES 249
           SLL S  +I+ +L+Y YRIYVTP+WEL+  +A              +YGI + SGSV+ES
Sbjct: 200 SLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-NGSGSVMES 258

Query: 250 SLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309
           SLFFAY+VR +YEISPK             K+ W+  Q NLP ++NL+     ++ KN  
Sbjct: 259 SLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL----ELMTKNYR 314

Query: 310 MAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFFKNFTLSVPFSIREILLMTWKMS 369
             W   +  T      N+    +++       P+W   KNFT SVP SI+EI ++T+KM+
Sbjct: 315 AIWSQIVEHTPR----NHKYIKMMDQCKWILNPLWNSVKNFTKSVPISIQEIFVVTFKMA 370

Query: 370 LESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYA 429
            ES+ PAVVINL FR+LIFYSATRI+P+LQR + +E+R  R++M  VYWYSPCI+IAMY 
Sbjct: 371 KESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYT 429

Query: 430 HLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489
           HLIL+YS +LKN+LC+WGC      Y T+    +VVD+W FWNWCN++ T+L+YA EL+G
Sbjct: 430 HLILRYSGQLKNDLCIWGC----FPYETEPK--IVVDSWSFWNWCNIYSTMLIYALELMG 483

Query: 490 D 490
            
Sbjct: 484 S 484

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  399 bits (1026), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/534 (42%), Positives = 318/534 (59%), Gaps = 63/534 (11%)

Query: 8   GFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARK-NG 66
           G I        A YLL  +++IPISFK+GG+YCGL+FT TLF LYF+ST+++II ++   
Sbjct: 54  GVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTH 113

Query: 67  NRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHK----------------------- 103
           N    +L+S L+Y Q+FII+SLL ++L GF+N +L                         
Sbjct: 114 NTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQIL 173

Query: 104 -IIENDAIPI---------ESLTSILNVSMSSSEAN----------WIFXXXXXXXVVTP 143
            II++  + I           L  +L +++ S E N          WI         + P
Sbjct: 174 FIIKDYFVNIMNLILFREDNGLNKMLQLALKS-EGNSVPDPQKLNSWILFFYYYYIFIKP 232

Query: 144 WKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIISSLLTSSAVISAALY 203
           WKF+L +STPFFTL EGFFTIL IQ IGETN WL  +K+S+ W+I SLL+S  VI+A LY
Sbjct: 233 WKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLY 292

Query: 204 YLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIESSLFFAYIVRCIYEI 263
           YL RIYVTP W+LTV TA              ++GIVS +GS IESSLFFAYIVRCIYE+
Sbjct: 293 YLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEM 352

Query: 264 SPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIEMAWDNFILRTGTSG 323
           SP+            F +VWQ  Q  + + +N++ Y    I+     A+ +F     +S 
Sbjct: 353 SPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMD----AFSSF-----SSI 403

Query: 324 TFNYNPSLLLNNTWK--FCKPIWKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINL 381
             +  P  +     K    K  W F KNFT++VP SI +++ +T +M+++S+SPA++INL
Sbjct: 404 EHHLFPKTIELGISKNLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAIIINL 463

Query: 382 CFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKN 441
            FR++IFYSATRI+P++QR+   +       M  VYW+SPC+LIAMY HLILQ+S ELK 
Sbjct: 464 SFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSGELKK 523

Query: 442 ELCLWGCNNILLGYNTD------QNETVVVDAWRFWNWCNVFCTILVYANELIG 489
            +CLW C N  L  ++D       + +++VD+W FWNWCN+F TI++YA+ELIG
Sbjct: 524 NICLWNCEN-WLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIG 576

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  393 bits (1009), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 226/490 (46%), Positives = 306/490 (62%), Gaps = 20/490 (4%)

Query: 11  RGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRIY 70
              R     +YLL  L+++PI+F++GGL CGLAFT TLF  YF++TTL+ IARK   + +
Sbjct: 10  ESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAIARKLRWQRF 69

Query: 71  IVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSMSSSEANW 130
           I  ++ LYY Q+F I  +LH+FLS FS+ EL   + ++   +E++TSIL  + +      
Sbjct: 70  IAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNNDTYPSKTI 129

Query: 131 IFXXXXXXXVVTP-WKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNAWIIS 189
            F          P WKF LS+STP F L EGFFTILAIQ IGETN WL   KNS+ WII 
Sbjct: 130 SFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTTVKNSSIWIIL 189

Query: 190 SLLTSSAVISAALYYLYRIYVTPIWELTVQTAXXXXXXXXXXXXXXIYGIVSDSGSVIES 249
           SL+ SS++++ ++YY+Y+IYVTP+W L+ Q A              IYGIVS  GSV+ES
Sbjct: 190 SLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGIVSHRGSVVES 249

Query: 250 SLFFAYIVRCIYEISPKXXXXXXXXXXXXFKDVWQKRQGNLPIRNNLIFYYNNVILKNIE 309
           SLFFAYIV CIYEISP              K+ WQ  Q N  I +NL+ YY N ++KN++
Sbjct: 250 SLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIYYYNSLIKNVD 309

Query: 310 MAWDNFILRTGTSGTFNYNPSLLLNNTWKFCKPIWKFF----KNFTLSVPFSIREILLMT 365
                 I++  T   F+   + LL    K  K  +KF     K FTL +P SI E+  +T
Sbjct: 310 EFIKLKIIKLTTKDNFSNKFNSLLFQCVKISKKSFKFILKLSKRFTLGIPSSIYELYSIT 369

Query: 366 WKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRK------DAREQRRSRKVMELVYWY 419
            KM+ ES+SP +++NLC+R+LIFY+ATRI+P+L+ +      +  + + + K M+++YWY
Sbjct: 370 LKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTKSNSKFMKVLYWY 429

Query: 420 SPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCT 479
           SPCILIAMY +LILQYS ELK+E  LW         N   N  VVVD+WRFWNWCN+F T
Sbjct: 430 SPCILIAMYTNLILQYSGELKSEFKLW---------NNSNNNEVVVDSWRFWNWCNIFWT 480

Query: 480 ILVYANELIG 489
           I +Y +ELIG
Sbjct: 481 ITLYGSELIG 490

>SAKL0D05610g Chr4 complement(452447..453883) [1437 bp, 478 aa] {ON}
           similar to uniprot|P47026 Saccharomyces cerevisiae
           YJL091C GWT1 Protein involved in the inositol acylation
           of glucosaminyl phosphatidylinositol (GlcN-PI) to form
           glucosaminyl(acyl)phosphatidylinositol (GlcN(acyl)PI) an
           intermediate in the biosynthesis of
           glycosylphosphatidylinositol (GPI) anchors
          Length = 478

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 443 LCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489
           LC + C N+L     D N  ++VD   F NWC +  +I  YA+  IG
Sbjct: 31  LCGYFCWNLLKNTAEDGNVNLIVDF--FLNWCGLLLSITTYADNPIG 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,099,539
Number of extensions: 1951157
Number of successful extensions: 6044
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6108
Number of HSP's successfully gapped: 31
Length of query: 497
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 383
Effective length of database: 40,409,475
Effective search space: 15476828925
Effective search space used: 15476828925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)