Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H15070g8.774ON43843822210.0
Kwal_34.159438.774ON43242816260.0
SAKL0B05456g8.774ON43244112961e-177
KLLA0F24904g8.774ON42442911071e-148
NDAI0E006308.774ON49048710711e-142
TDEL0B033508.774ON42643110581e-141
NCAS0B007808.774ON47247010221e-135
KAFR0D014908.774ON44344210191e-135
ZYRO0F12232g8.774ON42643410171e-135
AFR532W8.774ON42243510101e-134
CAGL0A03828g8.774ON47647010001e-132
TPHA0G012108.774ON4944919891e-130
Ecym_14768.774ON4534639741e-128
Kpol_1010.138.774ON4994979501e-124
Smik_15.4828.774ON4254379171e-120
YOR301W (RAX1)8.774ON4354349171e-120
Skud_15.4688.774ON4234468861e-115
KNAG0G031008.774ON4634748611e-111
Suva_8.3528.774ON4674017409e-93
TBLA0D008408.774ON5774276331e-75
CAGL0I05654g6.307ON476107751.2
KLTH0D05302g2.467ON37871731.7
Kwal_33.138491.183ON61372732.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H15070g
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} simi...   860   0.0  
Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {...   630   0.0  
SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} simila...   503   e-177
KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]...   431   e-148
NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {O...   417   e-142
TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {O...   412   e-141
NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.7...   398   e-135
KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.7...   397   e-135
ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...   396   e-135
AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic ...   393   e-134
CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...   389   e-132
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...   385   e-130
Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar t...   379   e-128
Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {O...   370   e-124
Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301...   357   e-120
YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Prote...   357   e-120
Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301...   345   e-115
KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.7...   336   e-111
Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W ...   289   9e-93
TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.7...   248   1e-75
CAGL0I05654g Chr9 complement(534119..535549) [1431 bp, 476 aa] {...    33   1.2  
KLTH0D05302g Chr4 complement(473487..474623) [1137 bp, 378 aa] {...    33   1.7  
Kwal_33.13849 s33 complement(421362..423203) [1842 bp, 613 aa] {...    33   2.0  

>KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 438

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/438 (95%), Positives = 418/438 (95%)

Query: 1   MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC 60
           MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC
Sbjct: 1   MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC 60

Query: 61  KDYVKGVRESFVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRV 120
           KDYVKGVRESFVEWEDSQERSGA                    EALMNDGFLDYEDSKRV
Sbjct: 61  KDYVKGVRESFVEWEDSQERSGANRDSRDSHDNRDSLSSSLLLEALMNDGFLDYEDSKRV 120

Query: 121 SRFLQGQTDSPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKE 180
           SRFLQGQTDSPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKE
Sbjct: 121 SRFLQGQTDSPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKE 180

Query: 181 LLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFL 240
           LLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFL
Sbjct: 181 LLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFL 240

Query: 241 EMDCFPKFLSCVALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIF 300
           EMDCFPKFLSCVALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIF
Sbjct: 241 EMDCFPKFLSCVALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIF 300

Query: 301 LWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNEL 360
           LWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNEL
Sbjct: 301 LWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNEL 360

Query: 361 VSSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVL 420
           VSSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVL
Sbjct: 361 VSSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVL 420

Query: 421 AGTAIFTVIFSCVPGHRL 438
           AGTAIFTVIFSCVPGHRL
Sbjct: 421 AGTAIFTVIFSCVPGHRL 438

>Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {ON}
           YOR301W (RAX1) - Similar to B-chains of the
           insulin-related hormone superfamily. [contig 272] FULL
          Length = 432

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/428 (72%), Positives = 352/428 (82%), Gaps = 7/428 (1%)

Query: 12  RLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRESF 71
           RLPTL+EVLNRQ+ APVDLWSFY FLSQYPYAINFLDFWID MAHLRLCKDYVKG+RES 
Sbjct: 11  RLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWIDVMAHLRLCKDYVKGIRESV 70

Query: 72  VEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQTDSP 131
           +EWEDS ERSGA                    EALMNDG+LDYEDSKRVSRFLQG TDSP
Sbjct: 71  IEWEDSLERSGANRDSRDSLSSSLLL------EALMNDGYLDYEDSKRVSRFLQGHTDSP 124

Query: 132 RLTKLLDNWQKQTEHDS-DAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARNIVH 190
           RLT+LLDNWQK  + DS  APFKSPLTGLVD+FLKTQA DF KARITSKELLNNA+NIV+
Sbjct: 125 RLTRLLDNWQKHADQDSAGAPFKSPLTGLVDDFLKTQAHDFHKARITSKELLNNAQNIVN 184

Query: 191 TYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLS 250
           TYLL+PE S RYLINLPDHMR+N + MV +EKRHDP++FEQLK+++FQFLEMDCFPKFL+
Sbjct: 185 TYLLSPETSVRYLINLPDHMRENTLRMVRDEKRHDPELFEQLKSLAFQFLEMDCFPKFLT 244

Query: 251 CVALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMGLWLGYT 310
            VALHNLHDDIT+  L+ P       +  RR S FA +TTLSRV LGM+FLWMGLWLGYT
Sbjct: 245 SVALHNLHDDITTPPLTAPQTPAHEPSFTRRHSPFAHHTTLSRVALGMLFLWMGLWLGYT 304

Query: 311 LVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGL 370
           L+FL+YSRGIRVTTIVPFFLGFYFI CGIY+IDILYAL GVTQTLVSNE VS KDLEIGL
Sbjct: 305 LIFLDYSRGIRVTTIVPFFLGFYFICCGIYRIDILYALAGVTQTLVSNEQVSLKDLEIGL 364

Query: 371 NRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIF 430
           NRN+V+++   +   VFR+ GG+ RLV I+ PF+N +L++R  WCL+LVL  T +FTVIF
Sbjct: 365 NRNSVNHRMSHNAPFVFRILGGTGRLVRIKHPFINKLLKKRGYWCLLLVLTLTGVFTVIF 424

Query: 431 SCVPGHRL 438
           SCVPG RL
Sbjct: 425 SCVPGRRL 432

>SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 432

 Score =  503 bits (1296), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 246/441 (55%), Positives = 326/441 (73%), Gaps = 12/441 (2%)

Query: 1   MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC 60
           M   S  L + RLPTLYEVLN+QT  PVDLWSFYT+LSQ+P+AIN+LDFWID MAHLRLC
Sbjct: 1   METESTKLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWIDIMAHLRLC 60

Query: 61  KDYVKGVRESFVEWEDSQERSG-AXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKR 119
           KDYVKG+RES + WE++                           EALMNDG LD++DSKR
Sbjct: 61  KDYVKGIRESVLVWEEANRPPRIPKHDSGVSDNYRSSVSTSLLLEALMNDGVLDFQDSKR 120

Query: 120 VSRFLQGQTDSPRLTKLLDNWQKQTE-HDSDAPFKSPLTGLVDEFLKTQAQDFQKARITS 178
           VS+FLQGQTDSPRL++L++NW++Q+   D+D      LT ++D+FLK + ++ Q+ RIT+
Sbjct: 121 VSQFLQGQTDSPRLSQLMENWKRQSALEDNDR-----LTEVLDDFLKQEMKESQQPRITT 175

Query: 179 KELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQ 238
           K+LLNNA  IV+ YL +P++S ++L+N+P+ +R +A+H V  ++RHDPDVFE LK+++FQ
Sbjct: 176 KQLLNNALQIVNMYLSSPQQSPKFLVNVPEKIRLDAIHTVQVQQRHDPDVFESLKSVAFQ 235

Query: 239 FLEMDCFPKFLSCVALHNLHDDITSSSLSDPL-AILGSSAPGRRRSLFARYTTLSRVVLG 297
           FLEMDCFPKFL CVALHNLHDD+T    S PL     ++   R+ SLF+ YT LSRV LG
Sbjct: 236 FLEMDCFPKFLGCVALHNLHDDMTDH--SSPLGGKTATTQRHRKSSLFSTYTILSRVFLG 293

Query: 298 MIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVS 357
           ++ L +G W+GY L+FL+YSRGIRV TIVPFFLGFY++ CGIY++D++YAL GVTQ LV+
Sbjct: 294 LLLLGIGFWIGYVLIFLDYSRGIRVVTIVPFFLGFYYVVCGIYQLDVVYALFGVTQNLVT 353

Query: 358 NELVSSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLV 417
           N+    +DLE+G  RN+  +   +    +FRV GG  RLV ++ PFV+ +L+RR++WC  
Sbjct: 354 NK--DKRDLELGYQRNSSKSSNVRRLPVIFRVLGGRGRLVKVRHPFVDRILKRRSVWCWF 411

Query: 418 LVLAGTAIFTVIFSCVPGHRL 438
           L+L GTAIFTVIFSCVPGHRL
Sbjct: 412 LILLGTAIFTVIFSCVPGHRL 432

>KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]
           {ON} similar to uniprot|Q08760 Saccharomyces cerevisiae
           YOR301W RAX1 Protein involved in bud site selection
           during bipolar budding localization requires Rax2p
          Length = 424

 Score =  431 bits (1107), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/429 (50%), Positives = 295/429 (68%), Gaps = 17/429 (3%)

Query: 12  RLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRESF 71
           RLPTLYEVLN+QT AP+DLWSFYT+LSQYP+AI +LDFW D MA+LRLCKDYVKG+RES 
Sbjct: 11  RLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWTDVMAYLRLCKDYVKGIRESV 70

Query: 72  VEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQTDSP 131
           ++   ++  +                      EALMNDG+LDY DS+RVS+FL+G+TDSP
Sbjct: 71  LD--VNKLETPTVLQEGNGDDKRESVSSAMLLEALMNDGYLDYNDSQRVSQFLKGETDSP 128

Query: 132 RLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARNIVHT 191
           RL++LL +W KQ  +D     +   +  VD  +K+      K ++T+K+L+++A++IV T
Sbjct: 129 RLSQLLQDW-KQVNND-----QIDFSDFVDGLVKSNVTKDHKPKLTTKQLISSAQDIVST 182

Query: 192 YLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSC 251
           YLL+ E+S R+L  +P ++R + + +++EEKRHDP+VFE +K I +QFLE+DCFP+FL C
Sbjct: 183 YLLSQEQSDRFLFEIPAYLRNDTIRLIMEEKRHDPEVFEPIKEIVYQFLEVDCFPRFLGC 242

Query: 252 VALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMGLWLGYTL 311
           VALHNLHD+I    L  P      S   R  S F++++T SR+ +G+ +  +GLW+GYTL
Sbjct: 243 VALHNLHDEIV---LQRPKK--NKSYNSRSNSPFSQWSTASRLTIGLAWWLVGLWIGYTL 297

Query: 312 VFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLN 371
           +F+NYS+GIRV  IVPFFLG Y+I CGIY +DI+YA  GVTQTLVS   +   DLE+   
Sbjct: 298 IFMNYSKGIRVVCIVPFFLGSYYIICGIYLVDIIYAFSGVTQTLVSKRKLD--DLELRSM 355

Query: 372 RNAVHNKTRQSTSPVF--RVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVI 429
            N   N    S    +   +FGG SRL  ++ PFVNS++ RRALWCL+LVL  TAI T I
Sbjct: 356 NNHRSNSLHSSNEVPWWLTIFGGRSRLCKVKHPFVNSIMIRRALWCLLLVLIMTAILTAI 415

Query: 430 FSCVPGHRL 438
           F+ VPG R+
Sbjct: 416 FAAVPGRRI 424

>NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {ON}
           Anc_8.774 YOR301W
          Length = 490

 Score =  417 bits (1071), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 218/487 (44%), Positives = 304/487 (62%), Gaps = 60/487 (12%)

Query: 8   LYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGV 67
           +  +RLPTLYEVL ++T  PVDLWSFYTFLSQ+PYAIN+LDFWID MAHLRLCKDY+ G+
Sbjct: 8   IQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWIDLMAHLRLCKDYISGI 67

Query: 68  RESFVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXE----------------------- 104
           RES + +  ++ R+                      +                       
Sbjct: 68  RES-ITYNQNEARNSRIRHHLQYTSEESIQHETQSIQHHDDPEGGDEDDDDDDNISVTTS 126

Query: 105 ----ALMNDGFLDYEDSKRVSRFLQGQTD-SPRLTKLLDNWQKQTEHDSDAPFKSPLT-- 157
               AL+++G LD+E+ +RVS+FLQG T+ SP+L++LL++W++ +  ++D+  K  L   
Sbjct: 127 VLLNALLDEGHLDFENPERVSQFLQGNTEYSPKLSQLLEDWKRHSIANNDSNRKGSLNRN 186

Query: 158 ---------------GLVDEFLKTQAQDFQKARITSKELLNNARNIVHTYLLAPEESSRY 202
                           +VD+ L+ Q+Q  ++A+IT+K+LLNNA  I   YL +PE S RY
Sbjct: 187 NSNVRSRETNGAALPDVVDDILRKQSQQEERAKITTKQLLNNALKICSIYLQSPERSERY 246

Query: 203 LINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDIT 262
           L NLPD +R  A+++V  E+RHDP VFE+LK+I+FQFLEMDCFPKFLS VALHN+HD+I+
Sbjct: 247 LTNLPDDIRLKALNLVQNERRHDPQVFEELKSIAFQFLEMDCFPKFLSTVALHNIHDEIS 306

Query: 263 -----SSSLSDPLAILGSSAPGRR----RSLFARYTTLSRVVLGMIFLWMGLWLGYTLVF 313
                S++ S  L  +  S         +S F+ YT LSR + G+++L +G W+GYTL+F
Sbjct: 307 DWRFHSNARSHNLTRVDKSLIKNHDHISKSPFSTYTLLSRTIFGLLWLGIGFWIGYTLIF 366

Query: 314 LNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLV--SNELVSSKDLEIGLN 371
           L Y RGIRV TIVPF +G YFI CG+Y++DI+Y+  GVTQ L+   NE     D E+ ++
Sbjct: 367 LKYDRGIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLLYKHNEKNRDADREVQMD 426

Query: 372 RNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFS 431
                N      S +  + GG SRL+ I+ PF+ ++L +R LWCL LVL  T IFTVIFS
Sbjct: 427 EK---NGKNHHVSGILALLGGRSRLIRIEHPFIKNILMKRGLWCLFLVLLSTGIFTVIFS 483

Query: 432 CVPGHRL 438
           CVPG+R+
Sbjct: 484 CVPGYRI 490

>TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {ON}
           Anc_8.774 YOR301W
          Length = 426

 Score =  412 bits (1058), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 211/431 (48%), Positives = 287/431 (66%), Gaps = 22/431 (5%)

Query: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70
           +RLPTLYEVL + T APVD W FYT+LSQ+PYAI++LDFWID MAH+RLCKDYVKGVRES
Sbjct: 15  ERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWIDLMAHIRLCKDYVKGVRES 74

Query: 71  --FVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQT 128
             F E   S+ R                       +AL+N+G+LD++++KRVS+FLQG T
Sbjct: 75  VEFNETIASRNRDEVNIEDDNESVSSSVLL-----DALLNEGYLDFQNTKRVSQFLQGDT 129

Query: 129 -DSPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARN 187
            DSPR+++L+D W++Q+          PL  +VDE L+ + +  ++ +IT K+L+NNA  
Sbjct: 130 NDSPRVSRLVDGWKRQSGIADGQ--NHPLALMVDEMLRKETRKLKQPKITRKQLVNNALQ 187

Query: 188 IVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPK 247
           I + YLL   E ++YLIN+P+ ++   ++ V +E+RHDP VFE LK +++QFLE+DCFPK
Sbjct: 188 ICNIYLLKSAEDNKYLINVPERVKNQVLYDVQQEQRHDPAVFEPLKTVAYQFLEIDCFPK 247

Query: 248 FLSCVALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMGLWL 307
           FLS VALHN+HD I++     P          R +S F+ YT LSRV++G+I+L +G W+
Sbjct: 248 FLSTVALHNIHDQISNWRYQSP-----GLRRHRSKSPFSNYTVLSRVLIGLIWLGIGFWI 302

Query: 308 GYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLE 367
           GYTL+FL+YSR IRV TIVPF LG Y I CG+Y++DILYA  G+TQ L+  E    KD  
Sbjct: 303 GYTLIFLHYSRAIRVVTIVPFALGSYSIVCGLYQVDILYAFFGLTQALMYQE----KD-- 356

Query: 368 IGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFT 427
            G   +  H+        +F++ GG SRL+ IQ  F+  +L +RALWC  L    TAI T
Sbjct: 357 -GSQTDRKHSHDYSEIPTIFKLLGGRSRLIKIQHDFIKKLLWKRALWCGFLTTLATAILT 415

Query: 428 VIFSCVPGHRL 438
           VIFSCVPG+RL
Sbjct: 416 VIFSCVPGYRL 426

>NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.774
           YOR301W
          Length = 472

 Score =  398 bits (1022), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 207/470 (44%), Positives = 293/470 (62%), Gaps = 35/470 (7%)

Query: 1   MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC 60
           M P    +  +RLPTLYEVL ++T APVDLWSFYTFLSQ+PYAIN+LDFW+D M HLRLC
Sbjct: 6   MEPDFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLC 65

Query: 61  KDYVKGVRESFVEWEDSQERSGAXXXXXXXXXXX-----XXXXXXXXXEALMNDGFLDYE 115
           KDYV G+RES V   + Q  S                            AL+ +G  D  
Sbjct: 66  KDYVDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLT 125

Query: 116 DSKRVSRFLQGQTD-SPRLTKLLDNWQKQTEHDSDAPFKSPLTG-----------LVDEF 163
           +   VS+ LQGQ + SP+L +L+D+W + +++  D+                   ++D+ 
Sbjct: 126 NPAGVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDSNRNRSSNNNSNSNNNNLSSILDDI 185

Query: 164 LKTQAQDFQKARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKR 223
           LK Q+Q  +K ++T+K+LLN+A  I   YLL+PE+S RYL N+PD +R  AV+++    R
Sbjct: 186 LKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQRNSR 245

Query: 224 HDPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDI---------TSSSLSDPLAILG 274
           HDP+VF++LK++S+QFLE+DCFPKFLS VALHN+HD+I         T  + +   A L 
Sbjct: 246 HDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQASLT 305

Query: 275 ----SSAPGRRRSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFFL 330
                S     +S F+ YTTLSR++ G+++L +G W+GYTL+FL Y RGIRV TIVPF +
Sbjct: 306 EKDLESMRHISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRVVTIVPFCI 365

Query: 331 GFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNA-VHNKTRQSTSP-VFR 388
           G YF+ CG+Y++DILY+  G+TQ L+  +   ++D   G + N  V  K  +   P +F 
Sbjct: 366 GSYFVVCGLYQVDILYSWFGITQRLLYKDRKVTED---GYDGNVPVDVKESKDKIPFIFG 422

Query: 389 VFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFSCVPGHRL 438
           + GG +RL+ ++ PF+   L +R LWC +LVL  T +FTV+FSCVPGHR+
Sbjct: 423 ILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472

>KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.774
           YOR301W
          Length = 443

 Score =  397 bits (1019), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 201/442 (45%), Positives = 290/442 (65%), Gaps = 13/442 (2%)

Query: 6   ADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVK 65
           A +  +RLPTLYEVL ++T  PVDLWSFYT+LSQ+PYAIN+LDFWID MAHLRL KDY+ 
Sbjct: 6   AKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWIDLMAHLRLSKDYIN 65

Query: 66  GVRESFVEWED--SQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRF 123
           G+R S +E  +    E   +                     ALM +G LD+E+  RVS+F
Sbjct: 66  GIRGSLLEESNFNELENQQSSQEDQNSNSENVSVTTSVLLNALMEEGHLDFENPDRVSKF 125

Query: 124 LQGQTD-SPRLTKLLDNWQKQTE-HDSDAPFKSP---LTGLVDEFLKTQAQDFQKARITS 178
           LQG+ D SP+L++LLD W++ +  +D++         L  L+DE LK +++  + ++IT+
Sbjct: 126 LQGKADYSPKLSQLLDGWKRHSGIYDANNNLNIDNGNLPTLLDEMLKNKSKRNETSQITT 185

Query: 179 KELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQ 238
           K+LLNNA  I +TYL + E+S++YL N+ +  R   +  V+ + R+DP+VFE+LKA ++Q
Sbjct: 186 KQLLNNALQICNTYLYSTEKSAKYLSNISEETRMKVLDSVVNQNRYDPEVFEELKATTYQ 245

Query: 239 FLEMDCFPKFLSCVALHNLHDDITSSSL-SDPLAILGSSAPGR-RRSLFARYTTLSRVVL 296
            LE DCFPKFLS VALHN+HD+++     S+  AI  ++   R  RS F+ +TTLSR++ 
Sbjct: 246 LLETDCFPKFLSTVALHNIHDELSDWRFHSEKGAIDNTTLRYRGSRSPFSNHTTLSRLIF 305

Query: 297 GMIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLV 356
           G+++L +G W+GY L+FL YSR IRV T+VPF +G Y I CG+Y++DI+Y+  GVTQ L 
Sbjct: 306 GLVWLGIGFWIGYVLIFLKYSRAIRVVTVVPFAIGCYLIICGMYQVDIIYSWFGVTQVLT 365

Query: 357 SNELVSSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCL 416
             +     D +I  + +  H  T++    +  + GG  R V I+  F+  +L+RR LWCL
Sbjct: 366 YKD----SDSKILRSNDEEHTTTKEKVPFLIALLGGGKRTVKIEHTFIKKLLQRRGLWCL 421

Query: 417 VLVLAGTAIFTVIFSCVPGHRL 438
           +LV+  TAIFTVIFSCVPG R+
Sbjct: 422 LLVVISTAIFTVIFSCVPGFRI 443

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score =  396 bits (1017), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 202/434 (46%), Positives = 283/434 (65%), Gaps = 24/434 (5%)

Query: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70
           QRLPTLYEVL RQT  PVDLWSFYTFLSQ+PYAI+FLDFWID MAH+RLC+DYV+GV+ES
Sbjct: 11  QRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDYVRGVKES 70

Query: 71  FVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQTD- 129
            +E  +S+                         +AL+ +G+LD+++++RVS+FL+G  + 
Sbjct: 71  -IEARNSE----------LIADDAHSDESNVLLDALLTEGYLDFKNARRVSQFLRGNVEE 119

Query: 130 SPRLTKLLDNWQK--QTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARN 187
           S R+++LLD +++  +    SD      L  +VD+ LK +    ++ ++T K+L+NNA  
Sbjct: 120 SMRISRLLDTFKQDHRLSTQSDREADEFLAAMVDDMLKQKIHKDKQPKMTRKQLINNASQ 179

Query: 188 IVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPK 247
           I   YLL+P+ES RYLIN+PD +R  A+H V  E+R DP++FE L+ +S+ FLEMDCFPK
Sbjct: 180 ICRQYLLSPQESPRYLINVPDEIRMKALHAVQSERRFDPELFEDLRNLSYDFLEMDCFPK 239

Query: 248 FLSCVALHNLHDDITSSSLSDPLAILGSSAP---GRRRSLFARYTTLSRVVLGMIFLWMG 304
           FL+ VALHNLHD ++        AI  S       R  S  + Y+ L R+ LG+ +L +G
Sbjct: 240 FLNRVALHNLHDQLSDWRFQTTAAIGKSKGDIRGQRSASPLSTYSGLGRIALGLCWLGIG 299

Query: 305 LWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSK 364
            W+GY L+FL+YSR IRVTTIVPF +G YF  CGIY++DILY+  GVTQ L+  + + S 
Sbjct: 300 FWIGYVLIFLHYSRAIRVTTIVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKKLPS- 358

Query: 365 DLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTA 424
                 +R     K+R     +F + GG SRL+ +  PF+  +L RR +WC +LV+  TA
Sbjct: 359 ------DREEDVPKSRTRVPTIFALLGGRSRLMPVHHPFIKKLLLRRGMWCFLLVVVSTA 412

Query: 425 IFTVIFSCVPGHRL 438
           + TV+FSCVPG R+
Sbjct: 413 VLTVLFSCVPGKRI 426

>AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR301W (RAX1)
          Length = 422

 Score =  393 bits (1010), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 199/435 (45%), Positives = 284/435 (65%), Gaps = 24/435 (5%)

Query: 8   LYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGV 67
           L ++RLPTL+EVLN QT APVD WSFYTFL QYP A+N++DFW+D MAHLRLCKDYVKG+
Sbjct: 8   LQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVKGI 67

Query: 68  RESFVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQ 127
           RES +  E  +++  +                    +AL+NDG+LDY D++R+S+FL+G 
Sbjct: 68  RESMMLLEVEEQQGRSRGRPAGSTEKRQSLSSSVLLDALLNDGYLDYHDNRRISQFLKGD 127

Query: 128 TDSPRLTKLLDNWQKQTEHDSDAPFKSP-LTGLVDEFLKTQAQDFQKARITSKELLNNAR 186
            +S RL++L +     +  +  AP + P L+ ++DEFL  Q ++ Q+ ++T+K+L+ +A 
Sbjct: 128 GESARLSQLFEGRGGDSSGEK-APTEEPHLSLMLDEFLVRQMKESQRPKLTTKQLVASAN 186

Query: 187 NIVHTYLLAPE--ESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDC 244
            IV  YL++ +   S R L  +P+HMR   +++V  E+R+DPDVFE LK ISFQFLE+ C
Sbjct: 187 TIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVKGEQRYDPDVFEPLKIISFQFLEIYC 246

Query: 245 FPKFLSCVALHNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMG 304
           FPKFLS VALHNLH DI+ S  +              RS +++ TTL+RV  G  F  +G
Sbjct: 247 FPKFLSSVALHNLHYDISLSQKAS-------------RSPYSQCTTLARVATGFFFWAVG 293

Query: 305 LWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSK 364
            W+GY+L+FL+Y R +R  T+VPF +G Y+I CG+Y +DI+YA+CGVTQTL+S       
Sbjct: 294 FWVGYSLIFLDYPRRVRTVTLVPFLIGSYYIVCGVYHLDIIYAVCGVTQTLISPRRYEEP 353

Query: 365 DLEIGLNRNAVHNKTRQSTSPVFRVF-GGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGT 423
           +L +   +N+       +  P F  F GG  RL  ++ PFV +++R+RALWCL LV+  T
Sbjct: 354 ELGLDQKQNSA------TKVPFFFTFLGGRKRLTKVRHPFVLNIMRKRALWCLFLVIVTT 407

Query: 424 AIFTVIFSCVPGHRL 438
           A+ TVIF+ VP  RL
Sbjct: 408 AVLTVIFTAVPSVRL 422

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score =  389 bits (1000), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 208/470 (44%), Positives = 288/470 (61%), Gaps = 49/470 (10%)

Query: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70
           QRLPTLYEV   +T  PVDLWSFYT+LSQ+PYAIN+LDFWID MAH+RLCKDYV  VR+S
Sbjct: 14  QRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVSTVRQS 73

Query: 71  FV------EWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFL 124
            V      E+ +  ERS                        L+++G+LD+E+ ++VS+FL
Sbjct: 74  VVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILM--NTLLSEGYLDFENPEKVSQFL 131

Query: 125 QGQTD-SPRLTKLLDNWQKQTEHDSDAPFK-----------------SPLTGLVDEFLKT 166
           QG T  SP +T+++ +W+   E +S A                      ++ +VDEFLK 
Sbjct: 132 QGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKR 191

Query: 167 QAQDFQKARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDP 226
           Q+Q  +K  IT+K+L NNA+ I +TYL++ + S RYL N+PD ++   +H     +RHDP
Sbjct: 192 QSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDP 251

Query: 227 DVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDITSSSL--SDPLAILGSSAPGRRRSL 284
           +VF +LK +++QFLE DCFPKFL  VALHN+HD+++      S+      SS  G + +L
Sbjct: 252 EVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSGSKENL 311

Query: 285 ---------------FARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFF 329
                          F+ YT+LSRV+ G +++ +G W+GY L+FL+YSR IRVTT+VPF 
Sbjct: 312 NGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFG 371

Query: 330 LGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNAVHNKTRQSTSP-VFR 388
           LG Y+I CGIY++DI+Y+  G+TQ L    + S K   I   R  V+  T     P +F 
Sbjct: 372 LGCYYIVCGIYQVDIIYSWFGLTQRL----MYSHKKGNIEEGRQ-VYGATYNDDVPLIFT 426

Query: 389 VFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFSCVPGHRL 438
           + GG SRL+ I+ PF+  +L +R LWCL LV+  TAIFTVIF CVPG RL
Sbjct: 427 LLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score =  385 bits (989), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 210/491 (42%), Positives = 291/491 (59%), Gaps = 64/491 (13%)

Query: 8   LYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGV 67
           L  +RLPTLYEVL  +T  PVDLWSFYTFLSQ+P+AIN+L+FWID MAH+RLCKDY++ +
Sbjct: 8   LQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWIDLMAHIRLCKDYLENI 67

Query: 68  RESFVE------------------------WEDSQERSGAXXXXXXXXXXXXXXXXXXXX 103
           R S +E                         E S +R G                     
Sbjct: 68  RSSVIEVVDESRVSDEYGNLTTAGDHRKHKEESSSDRYGPGGNDGDADDSASVTSSLLI- 126

Query: 104 EALMNDGFLDYEDSKRVSRFLQGQTD-SPRLTKLLDNWQKQT------------------ 144
            ALMN+G+LD++D  +V+RFLQG  + SP+L++LL  W++ +                  
Sbjct: 127 NALMNEGYLDFQDPDQVNRFLQGDIEYSPQLSQLLAEWRRHSGIPGKRNDDVNESEIDEN 186

Query: 145 --EHDSDAPFKSPLTGLVDEFLKTQ------AQDFQKARITSKELLNNARNIVHTYLLAP 196
             E  +   +++ +   +D+ LK        A +  K +IT+K+L +NA  I   YLL+P
Sbjct: 187 TGEKKNQVGYENKILSAIDDLLKNHVSGQNNAGETIKPQITTKQLHHNAAQICTLYLLSP 246

Query: 197 EESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVALHN 256
           E S +YLIN+P+H+R++ +  +  +KR+DPDVFE+LK IS+QFLE+DCF KFL  VALHN
Sbjct: 247 ERSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKNISYQFLEIDCFTKFLGRVALHN 306

Query: 257 LHDDIT------SSSLSDPLAILGSSAPGRR---RSLFARYTTLSRVVLGMIFLWMGLWL 307
           LHD I+      SS+   P           R   RSLF+ YTTLSRV+LG+ F+ +G W+
Sbjct: 307 LHDQISDWRFHNSSTRFLPNEETHEKKKQLRHHSRSLFSSYTTLSRVMLGLFFMGIGFWI 366

Query: 308 GYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLE 367
           GY L+FLNY+RGIRV TIVPF +G YFI CGIY+IDI YA  G+TQ L+      S D E
Sbjct: 367 GYALIFLNYARGIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGITQELMYKH-KRSPDEE 425

Query: 368 IGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFT 427
              + N          S +F++ GG +RL+ I+ PF+ +++ +R LWCL+ VL  T +FT
Sbjct: 426 TNHSDNL--EAKDGEISGLFKILGGQTRLIKIKHPFIRNLIYKRGLWCLLWVLISTGVFT 483

Query: 428 VIFSCVPGHRL 438
           VIF+CVP  R+
Sbjct: 484 VIFACVPSRRV 494

>Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar to
           Ashbya gossypii AFR532W
          Length = 453

 Score =  379 bits (974), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/463 (44%), Positives = 290/463 (62%), Gaps = 53/463 (11%)

Query: 10  AQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRE 69
           ++RLPTLYEVL  QT APVD WSFYTFL QYP A+N++DFW+D MAHLRLCKDYV+G+RE
Sbjct: 10  SERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVRGIRE 69

Query: 70  SFVEWE---------------DSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDY 114
           S +  E                    +G+                    +AL+NDG+LDY
Sbjct: 70  SMLLLEVEEQQQQQKHRQKRHSQVSAAGSDAAADNNNNNRMSVSSSLLLDALLNDGYLDY 129

Query: 115 EDSKRVSRFLQGQTDSPRLTKLLDNWQKQTE--------HDSDAPFK--------SPLTG 158
            D+KR+S+FL+G+ DS R ++LL+N     E        +D + P          + L+ 
Sbjct: 130 HDNKRISQFLKGEADSDRFSQLLENLPHGAEGGEGNNKGYDGEEPGHGDYATAEDAHLSV 189

Query: 159 LVDEFLKTQAQDFQKARITSKELLNNARNIVHTYLLAPEE--SSRYLINLPDHMRQNAVH 216
           ++DE+L  Q ++ Q+ ++T+K+L+ +A  IV  YL+A +   S R L ++P+HMR   ++
Sbjct: 190 MLDEYLVRQMKESQRPKLTTKQLIASANAIVDRYLVAKDNMRSERLLTSVPEHMRLEVIN 249

Query: 217 MVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDITSSSLSDPLAILGSS 276
           MV  E+R+DPDVFE LK ISFQFLE+ CFPKFLS VALHNLH D++ +  +         
Sbjct: 250 MVKGEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDVSLTQKT--------- 300

Query: 277 APGRRRSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIW 336
               R S +++ TTLSRV  G  F  +G W+GYTL+FL+Y+R +R  T++PFF+G Y+I 
Sbjct: 301 ----RTSPYSQCTTLSRVATGFFFWGIGFWVGYTLIFLDYNRKVRTVTLLPFFVGCYYIV 356

Query: 337 CGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNAVHNKTRQSTSP-VFRVFGGSSR 395
           CGIY +DI+YA+CGVTQTLVS    +    E+GL +    +KT  +  P +F + GG +R
Sbjct: 357 CGIYHLDIIYAICGVTQTLVSPRRFAEP--ELGLKK----SKTNSAKVPLLFSLLGGRNR 410

Query: 396 LVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFSCVPGHRL 438
           L  ++ PFV +++R+RALWCL LVL  TA+ T IF+ VP  RL
Sbjct: 411 LTKVRHPFVLNIMRKRALWCLFLVLVTTAVLTTIFTAVPSTRL 453

>Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {ON}
           complement(27385..28884) [1500 nt, 500 aa]
          Length = 499

 Score =  370 bits (950), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 197/497 (39%), Positives = 296/497 (59%), Gaps = 73/497 (14%)

Query: 8   LYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGV 67
           +  +RLPTLYEVL ++T +PVDLWSFYTFLSQ+P+A+N+L+FWID M+H+RLCKDY++G+
Sbjct: 10  IQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRLCKDYIRGI 69

Query: 68  RESF-----------------------VEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXE 104
           RES                        +E E+  E+                       +
Sbjct: 70  RESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTSSILI---D 126

Query: 105 ALMNDGFLDYEDSKRVSRFLQGQTD-SPRLTKLLDNWQKQT---EHDSDAPFKS-----P 155
           ALM++G+LD+++ ++V+RFLQG  + SP+L++LLD+W++ +   +H +D  + S      
Sbjct: 127 ALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRHSGYIDHSNDDSYASSGKDNK 186

Query: 156 LTGLVDEFLKTQAQDFQ-KARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNA 214
           +   VD  L+   +  Q + ++T+K LL NA+ I   YL++PE+S +YLIN+P+H+R   
Sbjct: 187 IVSAVDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSEKYLINVPEHIRNET 246

Query: 215 VHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDIT------------ 262
           + +V    RHDP+VFE ++++++QFLE+DCF KFL+ VALHN+HD I+            
Sbjct: 247 LQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQISDWKYHPVKPHSH 306

Query: 263 ---SSSLSDP---LAILGSSAPG---------------RRRSLFARYTTLSRVVLGMIFL 301
              ++    P   L I G +                  + RS F+ YTT+SR+  G  ++
Sbjct: 307 NDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSNYTTISRICFGTFWM 366

Query: 302 WMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELV 361
            +G W+GY L+FLNY+RGIRV TIVPF +G YFI CGIY++D++Y+  GVTQ L+     
Sbjct: 367 GIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYSWFGVTQELMFRH-- 424

Query: 362 SSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLA 421
            S D E G   N   +K  +    + +V GG SRL+ I   F+ ++L +R LWC  ++  
Sbjct: 425 KSSDEENGHPMNL--DKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKRGLWCCAIITI 482

Query: 422 GTAIFTVIFSCVPGHRL 438
            TAIFTVIFSCVPG R+
Sbjct: 483 STAIFTVIFSCVPGRRV 499

>Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301W
           (REAL)
          Length = 425

 Score =  357 bits (917), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/437 (42%), Positives = 275/437 (62%), Gaps = 33/437 (7%)

Query: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70
           +RLPTLYEVL ++T  PVDLW+FYTFLSQ+PYAIN+LDFW+D MAH RLCK YV+ V +S
Sbjct: 13  ERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCKSYVELVTKS 72

Query: 71  FVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRF-LQGQTD 129
            + +   +E  GA                     AL+ +G LD E   R+ +   Q    
Sbjct: 73  LINF--PKENGGASTTTLDLL------------NALIEEGHLDLEAPGRLLKSDGQDMPF 118

Query: 130 SPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARNIV 189
           SP+L +LL +W++Q+    D+  +  +  +VDE LK ++Q     +IT+K+L ++A  + 
Sbjct: 119 SPKLNQLLGDWKRQSGMSQDSLRRDDIALIVDEILKRRSQQDGIPQITTKQLFHSAVGLC 178

Query: 190 HTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFL 249
           +TYL++PE+S RYL N+P   R   +  +  ++++D +VF+ +K +++QFLEMDCFPKFL
Sbjct: 179 NTYLVSPEQSERYLSNIPTETRNRIIEDIQVQQKYDIEVFDDIKNLTYQFLEMDCFPKFL 238

Query: 250 SCVALHNLHDDITSSSLSDPLAILGSSAPGRR--------RSLFARYTTLSRVVLGMIFL 301
           S VALHN+HD+I+        ++  ++  G+R        RS F+ +T++SR+  G+++L
Sbjct: 239 SRVALHNIHDEISDWRFH---SVNATNEKGKRFRGQAHISRSPFSNHTSISRIGFGLLWL 295

Query: 302 WMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELV 361
            +G W+GY L+FL Y R IRV T+VPF LG Y I CG+Y++DI+Y+  GVTQ L+     
Sbjct: 296 GIGFWIGYVLIFLAYGRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKN 355

Query: 362 SSKDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLA 421
           SS D + G++  + H         +  VFGG  RL  ++ PF   +LR+R LWCL+LV+ 
Sbjct: 356 SSSDQD-GVSAGSDH------VPVLLAVFGGKRRLTRVKHPFTRQLLRKRGLWCLLLVVG 408

Query: 422 GTAIFTVIFSCVPGHRL 438
            TA FTVIFSCVPG R+
Sbjct: 409 ATAAFTVIFSCVPGRRV 425

>YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Protein
           involved in bud site selection during bipolar budding;
           localization requires Rax2p; has similarity to members
           of the insulin-related peptide superfamily
          Length = 435

 Score =  357 bits (917), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 184/434 (42%), Positives = 272/434 (62%), Gaps = 24/434 (5%)

Query: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70
           +RLPTLYEVL ++T  PVDLW+FYTFLSQ+PYAIN+LDFW+D M H RLCK+Y++ VR+S
Sbjct: 20  ERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRLCKNYIELVRKS 79

Query: 71  FVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQTD- 129
            + +   Q+++G+                     AL+ +G LD E   ++          
Sbjct: 80  LINFPQEQQQNGSTSTATFDLL-----------NALIEEGHLDPEAPDKLLENSGPDVPF 128

Query: 130 SPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNARNIV 189
           SP+L +LL +W+ Q+    +A     +  +VDE +K ++Q   K +IT+K+LL++A  + 
Sbjct: 129 SPKLNELLGDWKHQSGIGQEALRNEDVALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLC 188

Query: 190 HTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFL 249
           +TYL++PE+S RYL N+P   R   +  V  E+++D ++F+ LK +++QFLEMDCFPKFL
Sbjct: 189 NTYLVSPEQSERYLSNIPMETRNRIIESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFL 248

Query: 250 SCVALHNLHDDIT-----SSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMG 304
           S VALHN+HD+I+     S  +++  +          RS F+ +T++SR+  G+++L +G
Sbjct: 249 SRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSPFSNHTSISRIGFGLLWLGIG 308

Query: 305 LWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSK 364
            W+GY L+FL YSR IRV T+VPF LG Y I CG+Y++DI+Y+  GVTQ L+     +  
Sbjct: 309 FWIGYVLIFLAYSRAIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGN 368

Query: 365 DLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTA 424
           D E   + +  H         +  VFGG  RL  I+ PF   +LR+R LWCL+LV+  TA
Sbjct: 369 D-EGDASSDTDH------VPMILAVFGGRRRLTRIEHPFTRQLLRKRGLWCLLLVVGATA 421

Query: 425 IFTVIFSCVPGHRL 438
            FTVIFSCVPG R+
Sbjct: 422 AFTVIFSCVPGRRV 435

>Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301W
           (REAL)
          Length = 423

 Score =  345 bits (886), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/446 (42%), Positives = 270/446 (60%), Gaps = 45/446 (10%)

Query: 7   DLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKG 66
           +L   RLPTLYEVL ++T  PVDLW+FYTFLSQ+PYAIN+LDFWID MAH RLC+ YV+ 
Sbjct: 9   ELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWIDLMAHTRLCQSYVEL 68

Query: 67  VRESFVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQG 126
           VR+S V +   Q+ +G                      AL+ +G LD E  +++   LQ 
Sbjct: 69  VRKSLVNYPQEQQENGGASVKTHDLL-----------SALVEEGHLDPETPEKL---LQN 114

Query: 127 QTD----SPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELL 182
                  SP+L +LL+ W++Q+    D+     +T +VDE LK ++Q     +IT+K+LL
Sbjct: 115 SGPDLPFSPKLNQLLEGWKRQSGISEDSLRNEDMTLIVDEILKRRSQQDGVPQITTKQLL 174

Query: 183 NNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEM 242
           ++A  +  TYL + E+  RYL N+P   R   V  V  ++R+D +VF+ +K +++QFLEM
Sbjct: 175 HSAMGLCTTYLASSEQRERYLSNIPTETRNRIVKDVQVKRRYDIEVFDDVKNLAYQFLEM 234

Query: 243 DCFPKFLSCVALHNLHDDITSSSLSDPLAILGSSAPGRR--------RSLFARYTTLSRV 294
           DCFPKFLS VALHN+HD+I+        ++  ++   +R        RS F+ +T++SR+
Sbjct: 235 DCFPKFLSRVALHNIHDEISDWRFH---SVGATNEKNKRVRGQTHISRSPFSNHTSISRI 291

Query: 295 VLGMIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQT 354
             G+++L +G W+GY L+FL YSR IRV T+VPF LG Y I CG+Y++DI+Y+  GVTQ 
Sbjct: 292 GFGLLWLGIGFWIGYVLIFLAYSRAIRVVTVVPFALGCYCIVCGMYQVDIVYSWFGVTQR 351

Query: 355 LVSNELVSSKDLEIGLNRNAVHNKTRQSTSPVFRVFGG--SSRLVSIQQPFVNSMLRRRA 412
           L              L+R+   +     +S  F        SRL  +Q PF+  +LR+R 
Sbjct: 352 L--------------LHRHKDGSDNEDDSSEDFDHVPAILKSRLTCVQHPFIRQLLRKRG 397

Query: 413 LWCLVLVLAGTAIFTVIFSCVPGHRL 438
           LWCL+LV+  TA FTVIFSCVPG R+
Sbjct: 398 LWCLLLVVGATAAFTVIFSCVPGRRV 423

>KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.774
           YOR301W
          Length = 463

 Score =  336 bits (861), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/474 (41%), Positives = 279/474 (58%), Gaps = 57/474 (12%)

Query: 6   ADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVK 65
           A +  +RLPTLYEVL +++ AP+DLWSFYT+LSQ+P+AIN+LDFWID MAH+RLCKD++K
Sbjct: 6   AQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWIDLMAHIRLCKDFIK 65

Query: 66  GVRESFVEW-EDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFL 124
           GVR S  E  E ++E+ G                     + +M +  LD      V  F 
Sbjct: 66  GVRRSIGEAAERNEEQQGGGGADDTASVTTSVLM-----QTIMEEAQLDLNRPDDVYSFF 120

Query: 125 QG--QTD------------SPRLTKLLDNWQKQTEH----DSDAPFKSPLTGLVDEFLK- 165
           +   Q D            S R++++LD W  +T H     S       LT L+DEFL  
Sbjct: 121 RNSHQQDGLGDNLRASSRYSARVSQMLDEWNGRTSHRYTGHSVDISNGNLTTLMDEFLNE 180

Query: 166 -TQAQDFQKARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRH 224
            ++ +    A IT+K+LL+NA ++  TYL++ EES RYL N+P  +R+  +  VL+ K++
Sbjct: 181 HSKTRGDGGAYITTKQLLHNATHMCRTYLISREESERYLTNIPTEIREYILVGVLDAKKY 240

Query: 225 DPDVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDI--------------------TSS 264
           DP +F+ LK +++QFLE+DCFPKFLS VALHNLHD+I                    T  
Sbjct: 241 DPGIFDDLKTLTYQFLEIDCFPKFLSQVALHNLHDEISNWRFNKLDSTKYSGGGGALTGD 300

Query: 265 SLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSRGIRVTT 324
              D +   G+  P      F+ YTTLSR++ G+++L +G W+GYTL+FL YSR IRV T
Sbjct: 301 PEKDAVGYRGAHTP------FSNYTTLSRILFGLLWLGIGFWIGYTLIFLKYSRAIRVVT 354

Query: 325 IVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNAVHNKTRQSTS 384
           +VPF LG Y+  CG+Y++DI+Y++ GVTQ L+  E  ++     G +     + T     
Sbjct: 355 VVPFALGCYYCICGLYQVDIIYSIFGVTQRLLQRETAAA-----GEDPPTHTDATTAKVP 409

Query: 385 PVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFSCVPGHRL 438
            +  +FGG  RL+ I+  F   +L RR LWCL+LV   TA FTVIFSCVPG+R+
Sbjct: 410 SLLVLFGGRGRLLKIEHEFTRRLLLRRGLWCLLLVTFSTAAFTVIFSCVPGYRV 463

>Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W
           (REAL)
          Length = 467

 Score =  289 bits (740), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 163/401 (40%), Positives = 241/401 (60%), Gaps = 33/401 (8%)

Query: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70
           +RLPTLYEVL ++T  PVDLW+FYTFLSQ+PYAIN+LDFW+D MAH RLC+ YVK VR+S
Sbjct: 13  ERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCQSYVKMVRKS 72

Query: 71  FVEWEDSQERSGAXXXXXXXXXXXXXXXXXXXXEALMNDGFLDYEDSKRVSRFLQGQTD- 129
              +    ++ G                     +AL+ +G L+ +  + +   LQ +   
Sbjct: 73  LANFPQEHQQKG-----------DGSATTFNLLDALIEEGHLNLQSPENL---LQNEPSD 118

Query: 130 ---SPRLTKLLDNWQKQTEHDSDAPFKSPLTGLVDEFLKTQAQDFQKARITSKELLNNAR 186
              SP+L ++L NW+  +    DA     +  ++DE LK ++Q     +IT+K+LL++A 
Sbjct: 119 VPFSPKLNEMLGNWKHHSGISQDALQNEDMALILDEILKRRSQQDGVPQITTKQLLHSAM 178

Query: 187 NIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFP 246
            +  TYL++PE+S RYL N+P   R   +  +  ++++D  +F+ +KA+++QFLEMDCFP
Sbjct: 179 GLCTTYLVSPEQSERYLSNIPAETRTRILEDIQVDRKYDVAIFDDVKALTYQFLEMDCFP 238

Query: 247 KFLSCVALHNLHDDITSSSLSDPLAILGSSAPGR---RRSLFARYTTLSRVVLGMIFLWM 303
           KFLS VALHN+HD+I+            S + G+    RS F+ +T++SR+ LG+++L +
Sbjct: 239 KFLSRVALHNIHDEISDWRFHSK----NSRSRGQTHISRSPFSNHTSISRIGLGLLWLGI 294

Query: 304 GLWLGYTLVFLNYSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLVSNELVSS 363
           G W+GY L+FL Y R IRV T+VPF LG Y + CG+Y++DI+Y+  GVTQ L+     S 
Sbjct: 295 GFWIGYVLIFLAYGRAIRVVTVVPFALGCYCVVCGMYQVDIVYSWFGVTQRLLHRHKNS- 353

Query: 364 KDLEIGLNRNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFV 404
                  N +A           V  VFGG SRL S+Q PF 
Sbjct: 354 -------NDDAGAATDADHVPGVLAVFGGKSRLTSVQHPFT 387

>TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.774
           YOR301W
          Length = 577

 Score =  248 bits (633), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 142/427 (33%), Positives = 223/427 (52%), Gaps = 94/427 (22%)

Query: 104 EALMNDGFLDYEDSKRVSRFLQGQ---TDSPRLTKLLDNWQKQTEHDSDAPFKSPLTG-- 158
             LMN+G+L+ +D  R+S+F QG    ++  R+++L+ NWQ+  ++ +    +   TG  
Sbjct: 153 NVLMNEGYLNPDDHYRMSKFFQGNIGGSNDYRMSQLMQNWQRHNDNSNSNNTRQTNTGET 212

Query: 159 ----------------------LVDEFLKT-----------------QAQDFQKAR---- 175
                                 +VDE L+                  Q Q+ Q       
Sbjct: 213 NNAGNNSNSNSYTNNTTERFAAMVDELLQNNRIPMPSPILPNTQENIQEQEDQANASSSS 272

Query: 176 ----ITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQ 231
               +T+++L+ NARNI + YL++PE+S +YLIN+P+ ++ + +  +  E R DP +F+ 
Sbjct: 273 FLNGLTTRDLIKNARNICNLYLISPEKSKKYLINIPETIKFDIIKKIKFENRFDPLIFDD 332

Query: 232 LKAISFQFLEMDCFPKFLSCVALHNLHDDITSSSLSDPLAILGSSAPGRR---------- 281
           L+ +++ FLE+DCFPKFLS +ALHN+HD I+         +   +    R          
Sbjct: 333 LQNLTYNFLEVDCFPKFLSKIALHNIHDQISDWRFHSSFKLTSQNRKSNRGLSENDNSSS 392

Query: 282 --------------------------RSLFARYTTLSRVVLGMIFLWMGLWLGYTLVFLN 315
                                     RS F+ YT +SR+ +G I+L +G W+GYTL+FLN
Sbjct: 393 TDNEKNYQSDNDDNDSMIYNIDNHISRSPFSNYTIISRLFVGFIWLGIGFWIGYTLIFLN 452

Query: 316 YSRGIRVTTIVPFFLGFYFIWCGIYKIDILYALCGVTQTLV----SNELVSSKDLEIGLN 371
           YSRGIRVTT+ PF  G Y+I CG+Y++DI Y+L GVTQ L+     N L ++K ++    
Sbjct: 453 YSRGIRVTTLPPFLFGCYYIICGLYQLDIFYSLFGVTQDLMFQPKRNLLHANKKIDKTTK 512

Query: 372 RNAVHNKTRQSTSPVFRVFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFS 431
           +N  H   ++     F +FGG  RL+ I  P++ ++L +R +WC +LV   TA  TVIFS
Sbjct: 513 KNLKH--LKRGIPFFFNLFGGKKRLIKIDHPYIRNLLFKRGIWCAILVALSTAGLTVIFS 570

Query: 432 CVPGHRL 438
            VPG R+
Sbjct: 571 VVPGWRV 577

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 54/73 (73%)

Query: 1  MSPASADLYAQRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLC 60
          MS     +  +RLPTLYEVL +++ AP DLWSFYT+LSQ+PYAIN+L+FWID M H RLC
Sbjct: 1  MSIDYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWIDLMNHNRLC 60

Query: 61 KDYVKGVRESFVE 73
          +  +  ++ S ++
Sbjct: 61 RHLINEIKNSLIQ 73

>CAGL0I05654g Chr9 complement(534119..535549) [1431 bp, 476 aa] {ON}
           similar to uniprot|P27515 Saccharomyces cerevisiae
           YNR012w URK1 uridine kinase
          Length = 476

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 44/107 (41%), Gaps = 13/107 (12%)

Query: 195 APEESSRYLINLPDHMRQNAVHMVLEEKRHDPDVFEQLKAISFQFLEMDCFPKFLSCVAL 254
            P    + L  LP   +  A+H +L ++  D D F      SFQF         ++ + L
Sbjct: 254 GPLSDYKNLEVLPQTNQIKAIHTILLDRNVDRDEF------SFQF-------DRIATLLL 300

Query: 255 HNLHDDITSSSLSDPLAILGSSAPGRRRSLFARYTTLSRVVLGMIFL 301
            N  +DI        +   G S PG+RR  F   T +S +  G  F+
Sbjct: 301 ANTLNDIPVQKPETIITPDGFSVPGQRRCCFDEVTAISTIRSGDCFM 347

>KLTH0D05302g Chr4 complement(473487..474623) [1137 bp, 378 aa]
          {ON} weakly similar to uniprot|P35203 Saccharomyces
          cerevisiae YMR094W CTF13 Subunit of the CBF3 complex
          which binds to the CDE III element of centromeres
          bending the DNA upon binding and may be involved in
          sister chromatid cohesion during mitosis
          Length = 378

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 6/71 (8%)

Query: 3  PASADLYAQRLPTLYEVLNRQTCAPVDLWS-FYTFLSQYPYAINFLDFWIDAMAHLR--- 58
          P + +L+A+  P +Y+V N++     +LW+  + F+  + Y   F+D W++ M  LR   
Sbjct: 11 PTNYELFAEAYP-VYKV-NKKRKRNRELWTKLHKFVELFEYLPGFVDLWLEYMECLRYDS 68

Query: 59 LCKDYVKGVRE 69
          +  DY++  RE
Sbjct: 69 ITLDYMRMNRE 79

>Kwal_33.13849 s33 complement(421362..423203) [1842 bp, 613 aa] {ON}
           YJL163C - Hypothetical ORF [contig 108] FULL
          Length = 613

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 30/72 (41%), Gaps = 19/72 (26%)

Query: 278 PGRRRSLFARYTTLSRVVLGMIFL-------------------WMGLWLGYTLVFLNYSR 318
           P    SL ARYT L+ V L ++F+                   W  + LGY + F+   R
Sbjct: 363 PTAHNSLVARYTVLTLVALDVLFMVSTAAMIVPLVLYSTYQFHWGSVKLGYFISFVGIGR 422

Query: 319 GIRVTTIVPFFL 330
            I +  + P FL
Sbjct: 423 AIVLLALSPLFL 434

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,890,790
Number of extensions: 1735853
Number of successful extensions: 6537
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6630
Number of HSP's successfully gapped: 37
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 67 (30.4 bits)