Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H14894g5.353ON59593113e-39
Kwal_34.159765.353ON59593001e-37
SAKL0G08800g5.353ON59592889e-36
TDEL0E027405.353ON58582844e-35
YHR072W-A (NOP10)5.353ON58582836e-35
Smik_8.1495.353ON58582811e-34
Ecym_81795.353ON58582811e-34
Suva_15.2635.353ON58582811e-34
TPHA0D020805.353ON59592767e-34
TBLA0H019605.353ON58582768e-34
Skud_8.1325.353ON58582758e-34
NCAS0H016305.353ON58582741e-33
Kpol_1051.65.353ON58582732e-33
KAFR0C018405.353ON58582699e-33
ZYRO0D10208g5.353ON64572691e-32
KLLA0C16753g5.353ON57572611e-31
CAGL0J10802g5.353ON57562602e-31
AGR354W5.353ON69562603e-31
KNAG0C054905.353ON56562532e-30
Suva_16.4453.443ON249629650.26
KAFR0C030408.135ON46844591.7
Kpol_1004.135.241ON76840592.2
TDEL0F009908.134ON78957573.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H14894g
         (59 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly...   124   3e-39
Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON...   120   1e-37
SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON...   115   9e-36
TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}...   114   4e-35
YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}  NOP10Const...   113   6e-35
Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A ...   112   1e-34
Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON} s...   112   1e-34
Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-...   112   1e-34
TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353...   110   7e-34
TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}...   110   8e-34
Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A ...   110   8e-34
NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}...   110   1e-33
Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON} (11927..12...   109   2e-33
KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}...   108   9e-33
ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly s...   108   1e-32
KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly...   105   1e-31
CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa] ...   104   2e-31
AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic ho...   104   3e-31
KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa] {O...   102   2e-30
Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR11...    30   0.26 
KAFR0C03040 Chr3 complement(608258..609664) [1407 bp, 468 aa] {O...    27   1.7  
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....    27   2.2  
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    27   3.7  

>KLTH0H14894g Chr8 (1291716..1291895) [180 bp, 59 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA
          Length = 59

 Score =  124 bits (311), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 59/59 (100%), Positives = 59/59 (100%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQE 59
          MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQE
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQE 59

>Kwal_34.15976 s34 complement(140610..140789) [180 bp, 59 aa] {ON}
          YHR072W-A (NOP10) - Component of H/ACA-box snoRNPs
          [contig 272] FULL
          Length = 59

 Score =  120 bits (300), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 57/59 (96%), Positives = 57/59 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQE 59
          MHLMYTLGPDGKRIYTLKKTTE GEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKTTESGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQN 59

>SAKL0G08800g Chr7 complement(754882..755061) [180 bp, 59 aa] {ON}
          highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072W-A NOP10 Constituent of small
          nucleolar ribonucleoprotein particles containing
          H/ACA-type snoRNAs, which are required for
          pseudouridylation and processing of pre-18S rRNA
          Length = 59

 Score =  115 bits (288), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 53/59 (89%), Positives = 57/59 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQE 59
          MHLMYTLGPDGKRIYTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKR+NM+PG+ 
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTEEGEITKSAHPARFSPDDKYSRQRVTLKKRFNMLPGKN 59

>TDEL0E02740 Chr5 complement(529542..529718) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  114 bits (284), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 57/58 (98%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLGPDGKR+YTLKKTTE+GEITKSAHPARFSPDDKYSRQRVTLKKRYN++P +
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPTE 58

>YHR072W-A Chr8 (241664..241840) [177 bp, 58 aa] {ON}
          NOP10Constituent of small nucleolar ribonucleoprotein
          particles containing H/ACA-type snoRNAs, which are
          required for pseudouridylation and processing of
          pre-18S rRNA
          Length = 58

 Score =  113 bits (283), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Smik_8.149 Chr8 (217995..218168) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  112 bits (281), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>Ecym_8179 Chr8 complement(375457..375633) [177 bp, 58 aa] {ON}
          similar to Ashbya gossypii AGR354W
          Length = 58

 Score =  112 bits (281), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLM+TLGPDGKRIYTLKK TEDGEITK AHPARFSPDDKYSRQRVTLKKR+NM+P Q
Sbjct: 1  MHLMFTLGPDGKRIYTLKKATEDGEITKPAHPARFSPDDKYSRQRVTLKKRFNMLPTQ 58

>Suva_15.263 Chr15 (443512..443685) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  112 bits (281), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 55/58 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLKKNTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>TPHA0D02080 Chr4 (428268..428447) [180 bp, 59 aa] {ON} Anc_5.353
          YHR072W-A
          Length = 59

 Score =  110 bits (276), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 50/59 (84%), Positives = 56/59 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQE 59
          MHLM+TLGPDGKRIYTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKR++++P Q+
Sbjct: 1  MHLMFTLGPDGKRIYTLKKETEQGEITKSAHPARFSPDDKYSRQRVTLKKRFSLLPNQQ 59

>TBLA0H01960 Chr8 complement(463652..463828) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (276), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTL  DGKR+YTLKK TE GEITKSAHPARFSPDDKYSRQRVTLKKRYN++PGQ
Sbjct: 1  MHLMYTLSQDGKRVYTLKKETESGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPGQ 58

>Skud_8.132 Chr8 (215139..215312) [174 bp, 58 aa] {ON} YHR072W-A
          (REAL)
          Length = 58

 Score =  110 bits (275), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLGPDGKRIYTL K TE GEITKSAHPARFSPDDKYSRQRVTLKKR+ ++PGQ
Sbjct: 1  MHLMYTLGPDGKRIYTLDKVTETGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ 58

>NCAS0H01630 Chr8 complement(313472..313648) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  110 bits (274), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 52/58 (89%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLG DGKRIYTLKK TEDGEITKSAHPARFSPDDKYSRQRVTLKKRY ++P Q
Sbjct: 1  MHLMYTLGQDGKRIYTLKKVTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPTQ 58

>Kpol_1051.6 s1051 (11927..12103) [177 bp, 58 aa] {ON}
          (11927..12103) [177 nt, 59 aa]
          Length = 58

 Score =  109 bits (273), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 56/58 (96%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTLGPDGKR+YTLKKTTE+GEITKSAHPARFSPDDK+SRQRVTLKKR+ ++P Q
Sbjct: 1  MHLMYTLGPDGKRVYTLKKTTEEGEITKSAHPARFSPDDKHSRQRVTLKKRFGLLPTQ 58

>KAFR0C01840 Chr3 complement(368954..369130) [177 bp, 58 aa] {ON}
          Anc_5.353 YHR072W-A
          Length = 58

 Score =  108 bits (269), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 50/58 (86%), Positives = 54/58 (93%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPGQ 58
          MHLMYTL  DGKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKRY ++PGQ
Sbjct: 1  MHLMYTLDKDGKRVYTLKKVTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYGLLPGQ 58

>ZYRO0D10208g Chr4 (858591..858785) [195 bp, 64 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10
          Length = 64

 Score =  108 bits (269), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 54/57 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPG 57
          MHLMYTLGPDGKR YTL+K TE+GEITKSAHPARFSPDDKYSRQRVTLK+RY ++PG
Sbjct: 1  MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQRVTLKRRYGLLPG 57

>KLLA0C16753g Chr3 (1465814..1465987) [174 bp, 57 aa] {ON} highly
          similar to uniprot|Q6Q547 Saccharomyces cerevisiae
          YHR072W-A NOP10 Constituent of small nucleolar
          ribonucleoprotein particles containing H/ACA-type
          snoRNAs which are required for pseudouridylation and
          processing of pre-18S rRNA,
          Length = 57

 Score =  105 bits (261), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 49/57 (85%), Positives = 51/57 (89%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIPG 57
          MHLMYTL   GKRIYTLKK TED EITKSAHPARFSPDDKYSRQRVTLKKRYN++P 
Sbjct: 1  MHLMYTLDAQGKRIYTLKKMTEDNEITKSAHPARFSPDDKYSRQRVTLKKRYNLLPN 57

>CAGL0J10802g Chr10 complement(1055802..1055975) [174 bp, 57 aa]
          {ON} highly similar to uniprot|Q6Q547 Saccharomyces
          cerevisiae YHR072wa NOP10
          Length = 57

 Score =  104 bits (260), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 53/56 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIP 56
          MHLMYTL  +GKR+YTLKK TE+GEITKSAHPARFSPDDKYSRQRVTLKKRYN++P
Sbjct: 1  MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQRVTLKKRYNLLP 56

>AGR354W Chr7 (1386987..1387196) [210 bp, 69 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YHR072W-A (NOP10)
          Length = 69

 Score =  104 bits (260), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 47/56 (83%), Positives = 53/56 (94%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIP 56
          MHLMYTLGPDGKR+YTL+K T  GEITKSAHPARFSPDDKYSRQRVTLK+R++M+P
Sbjct: 13 MHLMYTLGPDGKRVYTLEKVTPSGEITKSAHPARFSPDDKYSRQRVTLKRRFDMLP 68

>KNAG0C05490 Chr3 complement(1069102..1069272) [171 bp, 56 aa]
          {ON} Anc_5.353 YHR072W-A
          Length = 56

 Score =  102 bits (253), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 48/56 (85%), Positives = 51/56 (91%)

Query: 1  MHLMYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVTLKKRYNMIP 56
          MHLMYTL  +GKRIYTLKK T DGEITKSAHPARFSPDDKYSRQRVTLKKR+ M+P
Sbjct: 1  MHLMYTLDNEGKRIYTLKKATADGEITKSAHPARFSPDDKYSRQRVTLKKRFGMLP 56

>Suva_16.445 Chr16 (767762..775252) [7491 bp, 2496 aa] {ON} YPR117W
            (REAL)
          Length = 2496

 Score = 29.6 bits (65), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 10   DGKRIYTLKKTTEDGEITKSAHPARFSPD 38
            DG  I+TL    E G+I+K+    RF PD
Sbjct: 1291 DGNVIWTLGLLFEQGDISKAGDEERFLPD 1319

>KAFR0C03040 Chr3 complement(608258..609664) [1407 bp, 468 aa] {ON}
           Anc_8.135 YGL176C
          Length = 468

 Score = 27.3 bits (59), Expect = 1.7,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 4   MYTLGPDGKRIYTLKKTTEDGEITKSAHPARFSPDDKYSRQRVT 47
           +++  PDGK I   KK T D EI      + F+ DDK S+  +T
Sbjct: 347 LFSTSPDGKYICYGKKYTRDFEIF-----SIFNVDDKSSQDMIT 385

>Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON}
           (25289..27595) [2307 nt, 769 aa]
          Length = 768

 Score = 27.3 bits (59), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 2/40 (5%)

Query: 11  GKRIYTLKKTTEDGEIT--KSAHPARFSPDDKYSRQRVTL 48
            +++ +L KT EDGE+   KS  P R   D  + R+  T+
Sbjct: 509 SRQLLSLAKTNEDGELVEEKSKQPVRTKYDKMFERKNQTV 548

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 5/57 (8%)

Query: 8   GPDGKRIYTLKKTTEDGEITKS---AHPARFSPDDKYS--RQRVTLKKRYNMIPGQE 59
           G DG R +T++K  E G++ KS    +     P D Y   +Q++TL     +  GQE
Sbjct: 733 GSDGPRRFTIEKAGEQGQLPKSHTCFNRVDLPPYDDYDSLKQKLTLAVEETIGFGQE 789

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,474,719
Number of extensions: 198421
Number of successful extensions: 522
Number of sequences better than 10.0: 24
Number of HSP's gapped: 522
Number of HSP's successfully gapped: 24
Length of query: 59
Length of database: 53,481,399
Length adjustment: 32
Effective length of query: 27
Effective length of database: 49,812,087
Effective search space: 1344926349
Effective search space used: 1344926349
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)