Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H14872g5.352ON62362331770.0
Kwal_34.159775.352ON59762514740.0
ZYRO0D10186g5.352ON6356938611e-106
KLLA0B10197g5.352ON6216838381e-103
NDAI0C043205.352ON7066487966e-96
Suva_2.4895.352ON6595477762e-93
CAGL0H07095g5.352ON6616757543e-90
SAKL0G08822g5.352ON5823397387e-89
Smik_4.5795.352ON6676307324e-87
AGR352C5.352ON6485807211e-85
Kpol_339.135.352ON6863367048e-83
Ecym_81815.352ON6615546801e-79
YDR320C (SWA2)5.352ON6683146582e-76
TDEL0E027505.352ON5643106452e-75
Skud_4.5865.352ON6423096493e-75
NCAS0F028705.352ON7003126472e-74
TPHA0E011105.352ON6933546436e-74
KAFR0C018505.352ON6463236152e-70
KNAG0C055005.352ON5853255982e-68
TBLA0H019705.352ON8403095832e-64
Kpol_1028.516.328ON11770958e-04
KLTH0E02178g5.617ON5931461010.001
TPHA0D038606.328ON12071920.002
TDEL0G044806.21ON343155960.004
NDAI0D008106.21ON349119960.004
KNAG0M011706.21ON339148950.005
Kwal_55.199355.617ON593138960.005
Kpol_1037.266.21ON342167940.007
TBLA0I023106.328ON11672870.009
KAFR0J025706.328ON12170870.012
KLLA0C08910g6.328ON11578840.028
NCAS0G008105.617ON584162900.028
TDEL0A074306.328ON124119830.038
TPHA0J003406.21ON338155870.048
YCR060W (TAH1)6.328ON11167820.049
AEL224W5.617ON580135880.052
KAFR0C058905.617ON575118880.058
NCAS0H008306.21ON338104850.083
CAGL0H07425g8.506ON380197850.11
KLTH0H02068g7.313ON37075840.11
CAGL0K09240g6.328ON14252800.12
Ecym_20906.328ON17265810.15
NCAS0B070102.152ON625112840.15
TPHA0D028805.617ON585135840.16
TDEL0A048405.617ON576121840.16
CAGL0D05060g3.481ON51069820.26
NDAI0F009105.617ON583119820.27
NDAI0D026005.88ON1167107820.28
TPHA0I015102.152ON603111800.42
SAKL0E01210g6.21ON323148790.42
Smik_15.2055.617ON589119800.44
KAFR0F007202.152ON608110800.46
YOR027W (STI1)5.617ON589119800.47
KLLA0F05093g7.313ON37289790.56
TBLA0A072706.21ON37385790.58
TPHA0D032203.481ON51369790.62
Kpol_1048.212.152ON597126790.64
Skud_15.1925.617ON589121790.69
Smik_3.1596.328ON11567730.71
NCAS0D045006.328ON12167730.72
KLLA0A07062g5.617ON581121780.75
SAKL0A01672g6.328ON12879740.76
Skud_3.1356.328ON11868730.78
Kwal_27.118908.506ON33469770.83
NDAI0F028102.152ON609131780.87
CAGL0H08195g5.617ON58376771.0
Suva_8.805.617ON58676771.1
ZYRO0A05676g5.617ON57278771.1
TPHA0L014208.506ON37469751.4
Skud_2.2828.506ON38570751.4
NCAS0B024008.506ON38071751.4
TDEL0B051402.152ON599125761.5
ZYRO0G06512g2.152ON604109751.6
Kpol_1018.695.617ON590164751.8
NCAS0A00490singletonON620129742.3
TBLA0C039503.481ON51269742.4
CAGL0L04048g2.152ON587110742.5
NDAI0B043402.152ON664133742.6
KLTH0H04554g6.201ON943173742.8
KLTH0E11748g8.506ON37866733.1
Suva_3.956.328ON11168683.6
Suva_10.3117.313ON37186714.3
Ecym_55825.617ON584126724.4
KAFR0E029808.506ON380128714.6
Smik_2.2958.506ON38570714.9
YLR380W (CSR1)4.234ON40847714.9
KNAG0H035302.152ON614135714.9
YBR155W (CNS1)8.506ON38570715.3
TBLA0G010506.21ON350114705.8
Ecym_44133.481ON51066707.7
Suva_12.1141.456ON370142697.7
NDAI0I022406.21ON350103698.8
ABR131W2.152ON594155699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H14872g
         (623 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...  1228   0.0  
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   572   0.0  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   336   e-106
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   327   e-103
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   311   6e-96
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   303   2e-93
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   295   3e-90
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   288   7e-89
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   286   4e-87
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   282   1e-85
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   275   8e-83
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   266   1e-79
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   258   2e-76
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   253   2e-75
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   254   3e-75
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   253   2e-74
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   252   6e-74
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   241   2e-70
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   234   2e-68
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   229   2e-64
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    41   8e-04
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    44   0.001
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    40   0.002
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    42   0.004
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    42   0.004
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    41   0.005
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    42   0.005
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    41   0.007
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    38   0.009
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    38   0.012
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    37   0.028
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    39   0.028
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    37   0.038
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    38   0.048
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    36   0.049
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    39   0.052
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    39   0.058
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    37   0.083
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    37   0.11 
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    37   0.11 
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    35   0.12 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    36   0.15 
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    37   0.15 
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    37   0.16 
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    37   0.16 
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    36   0.26 
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     36   0.27 
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    36   0.28 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    35   0.42 
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    35   0.42 
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    35   0.44 
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    35   0.46 
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    35   0.47 
KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {...    35   0.56 
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    35   0.58 
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    35   0.62 
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    35   0.64 
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    35   0.69 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.71 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    33   0.72 
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    35   0.75 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.76 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    33   0.78 
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    34   0.83 
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    35   0.87 
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    34   1.0  
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    34   1.1  
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    34   1.1  
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    33   1.4  
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    33   1.4  
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    33   1.4  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    34   1.5  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    33   1.6  
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    33   1.8  
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       33   2.3  
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    33   2.4  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    33   2.5  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    33   2.6  
KLTH0H04554g Chr8 (405046..407877) [2832 bp, 943 aa] {ON} simila...    33   2.8  
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    33   3.1  
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    31   3.6  
Suva_10.311 Chr10 complement(544348..545463) [1116 bp, 371 aa] {...    32   4.3  
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    32   4.4  
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    32   4.6  
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    32   4.9  
YLR380W Chr12 (878282..879508) [1227 bp, 408 aa] {ON}  CSR1Phosp...    32   4.9  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    32   4.9  
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    32   5.3  
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    32   5.8  
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    32   7.7  
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    31   7.7  
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    31   8.8  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    31   9.6  

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 1228 bits (3177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/623 (96%), Positives = 601/623 (96%)

Query: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNA 60
           MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNA
Sbjct: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNA 60

Query: 61  TSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDK 120
           TSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDK
Sbjct: 61  TSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDK 120

Query: 121 AAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQLREEESDLFSVASNWLNKGRTFL 180
           AAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQLREEESDLFSVASNWLNKGRTFL
Sbjct: 121 AAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQLREEESDLFSVASNWLNKGRTFL 180

Query: 181 DSKLKQVQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLK 240
           DSKLKQVQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLK
Sbjct: 181 DSKLKQVQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLK 240

Query: 241 IEEETHFGPRANXXXXXXXXXXXXXXXXXXXXXXETPGDKSEAPPNPSPVQDNDLLIDFE 300
           IEEETHFGPRAN                      ETPGDKSEAPPNPSPVQDNDLLIDFE
Sbjct: 241 IEEETHFGPRANSPVPSTKSPAVSVASASHPVYSETPGDKSEAPPNPSPVQDNDLLIDFE 300

Query: 301 APALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP 360
           APALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP
Sbjct: 301 APALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP 360

Query: 361 LRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMN 420
           LRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMN
Sbjct: 361 LRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMN 420

Query: 421 NKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSI 480
           NKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSI
Sbjct: 421 NKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSI 480

Query: 481 PKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGH 540
           PKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGH
Sbjct: 481 PKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGH 540

Query: 541 DDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKM 600
           DDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKM
Sbjct: 541 DDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKM 600

Query: 601 IAENVFIVLSKAWETFKEKNQLS 623
           IAENVFIVLSKAWETFKEKNQLS
Sbjct: 601 IAENVFIVLSKAWETFKEKNQLS 623

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/625 (49%), Positives = 410/625 (65%), Gaps = 30/625 (4%)

Query: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNA 60
           MSSAFDDLFS FKGGN+SS N   K +S      P    +       DLD  FG +    
Sbjct: 1   MSSAFDDLFSTFKGGNQSSQNGIAKAKSPRIETSPGINYSDDSRNGTDLDEIFGFEKQAN 60

Query: 61  TSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDK 120
           ++   +DEFDLAFD  + P  ++L    +D   P+PQP+VDE+KDMEIARLMSLGL   K
Sbjct: 61  SAPAVKDEFDLAFDAFDAP--AKLPQNHMD---PEPQPLVDEIKDMEIARLMSLGLSCTK 115

Query: 121 AAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQLREEESDLFSVASNWLNKGRTFL 180
           A  YYERG+LY+ +++R++++  R E P +TS +    +  E DL SVAS+WLN+GRTFL
Sbjct: 116 ATSYYERGLLYDDLLERKRQQRTREEAPQKTSDEGRFTQGSEPDLLSVASSWLNRGRTFL 175

Query: 181 DSKLKQVQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLK 240
           DSKLKQ+Q +   +S+SDYISSR  S+A       +GS     S        +  F+DL 
Sbjct: 176 DSKLKQIQNDNGTQSYSDYISSRMESSA------HTGSRLRPTSDIPTNIDRSISFQDLS 229

Query: 241 IEEETHFGPRANXXXXXXXXXXXXXXXXXXXXXXETPGDKSEAPPNPSPVQDNDLLIDFE 300
           + ++    P  +                      + P    E           DLL+DF+
Sbjct: 230 LADQ----PNESSVPAQVSPMNSEILPPLVNIGDDVPVSGPEE-------ASADLLVDFD 278

Query: 301 APALKTS-NVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTH 359
           AP+   + + P   S  ++ LE HS++EFKEKG  SF  GDYH AFQN+EKS+NSLP +H
Sbjct: 279 APSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSH 338

Query: 360 PLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIM 419
           PLR +S SN+IICRLK+GEYR+A+ D+S ALKLI    ++  IP  +PPKT+KE W KI+
Sbjct: 339 PLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKIV 398

Query: 420 NNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETS 479
            NKA A+E +E+Y+KAL+ YQ LI+ G  S KV+E RR+CQK +  EK      ++S+T 
Sbjct: 399 GNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEK----FVQRSKTP 454

Query: 480 IPKA-AVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCE 538
           +  + +V++K     A  T + PSEKL RVQ+INKKEK+LE Q+FLLHD+V   ++EWC+
Sbjct: 455 LSTSPSVSRKDVAVAA--TSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQ 512

Query: 539 GHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKR 598
             +D+LRELL+RFH IVDWV+WK VSTADLV+PK+ K++YLKAV KTHPDKIQDSWPL+R
Sbjct: 513 NSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLER 572

Query: 599 KMIAENVFIVLSKAWETFKEKNQLS 623
           KM+AENVF++LSKAWE FKE+N+LS
Sbjct: 573 KMVAENVFVILSKAWELFKEQNKLS 597

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  336 bits (861), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 240/693 (34%), Positives = 357/693 (51%), Gaps = 128/693 (18%)

Query: 1   MSSAFDDLFSAFKGGNE--------------SSSNTKPKGESLAGARLPLTGEASRKDAD 46
           M   F DL + FKGG                S +NT+    SL+    P+T  AS    D
Sbjct: 1   MGDPFADLLTQFKGGESKPQNQGNKPLAAQYSENNTRETSSSLSLQPEPVTT-ASNYKID 59

Query: 47  ADLDAFFGSKTSNATSG---------TARDEFDLAFDMLN-GPVASRLAAPDVDLVEPKP 96
            D +  FG K++  T+          T ++EFD A D+L   P   R +A      E +P
Sbjct: 60  DDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAIDLLQITPEKQRQSA------EREP 113

Query: 97  QPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSS 156
           + +VDEV+DME+A+LMSLG   D A   YE+G+LY+ V++ +K++        R   +++
Sbjct: 114 EQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKKKKLHRRELQRLMAETN 173

Query: 157 QLRE------EES-----DLFSVASNWLNKGRTFLD-----------------SKLKQVQ 188
             RE      +ES     DLFS+AS   NKG+  +D                  +LKQ Q
Sbjct: 174 WERETPETNNDESGKNNVDLFSIASGIFNKGKKIVDHLSLFPDEENDLLPYRSERLKQRQ 233

Query: 189 TEYSDRSFSDYISSRSGSNASP-PWLKESGSYHLQVSSDRGKQKVTTQFK--DLKIEEET 245
           T      F   +  R   + +P P  +  G+  ++  S    Q+ T Q +  DL  + + 
Sbjct: 234 T------FEPELPRRPRKDPTPNP--RTQGTPQVEYESTLQYQQPTIQAQEGDLLGDFQD 285

Query: 246 HFGPRANXXXXXXXXXXXXXXXXXXXXXXETPGDKS-EAPPNPSPVQDNDLLIDFEAPAL 304
               R+                          G+KS  A  +PS    N+ L+DF+AP+ 
Sbjct: 286 KLSLRSQ-------------------------GNKSTSASQSPS----NETLLDFDAPSA 316

Query: 305 KTSNVPATYSPN--------LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLP 356
            +++   + S          +TE+E   + EFK++    F+TGDY AA Q YEKS N+LP
Sbjct: 317 NSTSASVSVSRQGSVVPTVPITEIELSGYNEFKDRAGELFKTGDYVAALQEYEKSANTLP 376

Query: 357 LTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSN--IPNLNPPKTYKEF 414
             HPLR++S+SN++  +LK G+Y+E+L  AS ALKL P+ +      I N  P KTY++ 
Sbjct: 377 HGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTYRDM 436

Query: 415 WSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVAR 474
           W KI+  +A AFE  EN+++A   YQ LIE    ++K+++ +R+CQK +  EK  V    
Sbjct: 437 WPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQKVLNPEKPKV---- 492

Query: 475 KSETSIPKAAVTKKPSGRPAKVTLENPSEK----LARVQDINKKEKDLEAQRFLLHDEVS 530
                     V KKP+   +     N S+K    L +V++ N+K+ + + QR  L+D V 
Sbjct: 493 ----------VQKKPASSKSPSPSPNHSDKKYKNLQKVKEDNRKQAEEDTQRHALYDRVY 542

Query: 531 SLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKI 590
             I+ W  G  +++R LL+   T++ WV+WK VS ADLV+PKK K+ YL+AVAKTHPDKI
Sbjct: 543 DQIKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKI 602

Query: 591 QDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
            DS PL +KMIAE+VF  LS AWE FK +N ++
Sbjct: 603 SDSLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 244/683 (35%), Positives = 342/683 (50%), Gaps = 123/683 (18%)

Query: 1   MSSAFDDLFSAFKG-----GNESSSNTKPKGESLAGARLPLTGEASRKD----------- 44
           MS  F DL S+FKG     GN SS+N       L  +   LT   SRK            
Sbjct: 1   MSDPFADLLSSFKGVNSSTGNNSSANKNASLNDLLSSHSALTSPLSRKSPSNVPSKTPES 60

Query: 45  -------ADADLDAFFGSKTSNAT------------SGTARDEFDLAFDMLNGPVASRLA 85
                  A  D      +  S  T            + T +D+FDLAF+  N       +
Sbjct: 61  ISITSMTASQDFFDDLLAAPSQVTPLRESPSQVAPSTATEKDDFDLAFESFN-------S 113

Query: 86  APDVDLVEPKP------QPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQK 139
            P VDLV+P+P      QP+VDEVKDMEIARLMSLGL +DKA  YY++GI+YE++++ QK
Sbjct: 114 TPHVDLVQPQPDPIPEPQPLVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEELIESQK 173

Query: 140 RRTARTERPLRTSPQSSQLREEESD-----LFSVASNWLNKGRTFLDSKLK-QVQTEYSD 193
           +R  ++   +       QLR++ES        SVASN  N G+ F++ KLK  +Q +Y++
Sbjct: 174 KR-KQSRSNVNNDFGQQQLRKQESRDSSPAFISVASNLFNMGKEFIEDKLKPTLQPQYAN 232

Query: 194 RS----FSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGP 249
            S    FSD I  R            S  + +Q  S+R   + + +   +          
Sbjct: 233 SSQRSQFSDDIPLRRDYTR-----PHSRPHSMQFQSERTSPQPSPELPSIH--------- 278

Query: 250 RANXXXXXXXXXXXXXXXXXXXXXXETPGDKSEAPPNPSPVQDNDL--------LIDFEA 301
                                     +  + S APP P  V++ D         L+DF A
Sbjct: 279 ------------------------QLSINNASSAPP-PVSVENQDTASVINQETLVDFGA 313

Query: 302 PALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPL 361
            A +TS  P      +++ E  SF EFK  G   F +GDYH A   +EKS N+LP  HPL
Sbjct: 314 -APQTSASPQH---RISDFELTSFNEFKNNGVKYFSSGDYHNALLEFEKSFNTLPFKHPL 369

Query: 362 RVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLN-PPKTYKEFWSKIMN 420
           R++S SNI+ C+LK+GE  +AL     AL L       S+I   + P +T+K+  +KI  
Sbjct: 370 RIISLSNIVSCQLKLGENSKALESVKLALDLSDLAPNASDIIEHSVPERTFKQMINKIQL 429

Query: 421 NKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEK-KPVSVARKSETS 479
             A   E +ENYEKAL  Y  LI  G+T  KV++ +R+C+K +  EK KP     K + S
Sbjct: 430 KHAEIQEHLENYEKALSLYANLISNGITEQKVMDGKRRCEKIVNPEKFKPA----KEKIS 485

Query: 480 IPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEG 539
            P   V  K S     V +        RV++ NKK+++ E +R  L D+V   I EW + 
Sbjct: 486 SPTIPVRSKTSISADTVAVN-------RVKEENKKQEEEEEERLRLRDKVDEKISEWTKN 538

Query: 540 HDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRK 599
           ++++LR LLA    ++ W +WKEVS  DLV+ KK K+ YLKA+AKTHPDKI     L+  
Sbjct: 539 NENDLRYLLANLEPLLWWASWKEVSPQDLVMTKKVKICYLKAIAKTHPDKIPADASLETI 598

Query: 600 MIAENVFIVLSKAWETFKEKNQL 622
           MIAENV+ +L+KAWE FK +N +
Sbjct: 599 MIAENVYTILNKAWEYFKSQNNI 621

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  311 bits (796), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 207/648 (31%), Positives = 323/648 (49%), Gaps = 103/648 (15%)

Query: 50  DAFFGSKTSNATSGTA--RDEFDLAFDMLNGPVASRLAAPDVDLV-----EPKPQPVVDE 102
           D F  ++  N TS  A  +D+ D AFD+               LV     + + + +VDE
Sbjct: 88  DLFNSNEQKNITSPPAPKKDDIDSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDE 147

Query: 103 VKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPL-RTSPQSSQLREE 161
           VKDME+ARLMSLGL  D+A +YY++GILYE ++ +Q+ +  + + P  + + Q     ++
Sbjct: 148 VKDMEVARLMSLGLSIDQANKYYDKGILYEDIIRKQREKKLKQQSPRNKNNAQDKNNTQK 207

Query: 162 ESDLF--------------------SVASNWLNKGRTFLDSKLKQVQTEYSDRSFSDYIS 201
            SDLF                    S+A++ L KG+  +D       T Y + +   Y  
Sbjct: 208 YSDLFDNTYANKRFNESQNNTGNLFSMATDILYKGKELVDQ-----LTAYPEENNRLYKY 262

Query: 202 SRSGSNASPPWLKE-------------SGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFG 248
                N   P+L+E             SGS+    S+    +    +   LK E+     
Sbjct: 263 REPIDNEENPFLQEGSRSPASARSPSLSGSHVASASAKPSSKPSYVERNSLKYEDNN--- 319

Query: 249 PRANXXXXXXXXXXXXXXXXXXXXXXETPGDKSEAPPNPSP----VQDNDLLIDFEAPAL 304
                                     + P      PP+ +P      +N+ L+DF+  + 
Sbjct: 320 -----------TTLIDDFDYKLTINSKEPSMAKNIPPSITPDTTETNNNNALLDFDGLST 368

Query: 305 KTSNVPATYSPN-------------------------LTELERHSFEEFKEKGANSFRTG 339
            T+   +  S N                         ++ +E     EFK +G+  F+ G
Sbjct: 369 VTAPGSSNISVNKKNTSSSSATSPSPSPASITIATVPISHIELSGHIEFKTRGSELFKNG 428

Query: 340 DYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSM- 398
           DY +A Q YEKSLN+LP  HPLR++S+SNII  +LK+GEY +++ D   AL L P+G + 
Sbjct: 429 DYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCKIALSLFPKGKVT 488

Query: 399 ---NSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEA 455
              N  IP+  P +++K+ WSK++  +A ++E +ENY+ AL++YQ+LIE G T+SK+++ 
Sbjct: 489 SAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLIENGFTNSKIMDG 548

Query: 456 RRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKE 515
           +R+CQK   L   P     KS T  P + +  K          +  +  + R+QD N K 
Sbjct: 549 KRRCQKI--LNPPPPPQTSKSPTPTPVSILKHKEK--------DTTTASVQRLQDENAKS 598

Query: 516 KDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAK 575
           +++E Q+  L+D+V S I  W    D ++R LL+   T++ W +W  +S ADLV+PKK K
Sbjct: 599 REIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSISQADLVMPKKVK 658

Query: 576 VIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
           + YLKA+ KTHPDKI +S  L+ KMIAENVF +LS AW+ FK  N ++
Sbjct: 659 ITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  303 bits (776), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 194/547 (35%), Positives = 301/547 (55%), Gaps = 46/547 (8%)

Query: 99  VVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVD----RQKRRTAR--TERPLRTS 152
           +VDEVKDMEIARLMSLGL  +KA ++Y   + YE+ ++    +QK+   R  + RP  +S
Sbjct: 137 LVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLKQKKHKDRIASHRPTGSS 196

Query: 153 PQSSQL----REEESDLFSVASNWLNKGRTFLDSKLKQVQTEYSDRSFSDYISSRSGSNA 208
            +++ L        ++LFS+A+++ NKG+  +D +      E +DR  S+Y++     + 
Sbjct: 197 SKNASLFNNASPNNNNLFSMATDFFNKGKELVD-QWTSFPPEANDR-LSNYVNVEDKLDH 254

Query: 209 SPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANXXXXXXXXXXXXXXXX 268
               L E+ SY   +   +  +K      DL  +  T F  + +                
Sbjct: 255 YELPL-ENDSYDGSLPQRKEDEKDLLGGNDLDDDLLTDFETKIDITKKDAKDTTPSPSPP 313

Query: 269 XXXXXXETPGDKSEAPPNPSPVQDNDLLIDFEAPALKTSNVPATYSPN--------LTEL 320
                 +    + E P      Q  D L+DF    + ++N  A    +        ++++
Sbjct: 314 PGILVED--ALRKEEP------QREDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDI 365

Query: 321 ERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYR 380
           E   + EFK KG + F+ GDY  + Q YEKSLNSLPL HPLR+++ SNII  +LK+GEY 
Sbjct: 366 ELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYS 425

Query: 381 EALSDASSALKLIP--QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALET 438
           +++ ++ +AL L P  + S N  I   +P ++Y + W KIM  +A +FE +E+++ ALET
Sbjct: 426 KSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALET 485

Query: 439 YQQLIEAGVTSSKVLEARRQCQKAI--ALEKKPVSVARKSETSIPKAAVTKKPSGRPAKV 496
           YQ+L+       K+++ +R+CQ  +  A  +KP  V + + T  P     KKP+  P+  
Sbjct: 486 YQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPAP----MKKPTSTPSPA 541

Query: 497 TLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVD 556
            ++N S    RV     KE++LE  +  L+D VS  I  W  G DD++R LLA    ++ 
Sbjct: 542 PVDNAS----RV-----KEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLLT 592

Query: 557 WVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETF 616
           W NWK+VS  +LV+PKK K+ Y+KAVAKTHPDKI  S  L+ KMIAENVF  LS AW+ F
Sbjct: 593 WCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDKF 652

Query: 617 KEKNQLS 623
           K++N ++
Sbjct: 653 KQQNDIN 659

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  295 bits (754), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 207/675 (30%), Positives = 335/675 (49%), Gaps = 66/675 (9%)

Query: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARL--------PLTGEA---------SRK 43
           MS  F  L ++ K GN  SS    K  S+    L        PL  E+         S  
Sbjct: 1   MSDPFGHLLASLKEGNVPSSKPGSKENSVTPGALTPQKKKLTPLHTESIVHGNGNVVSNT 60

Query: 44  DADADLDAFFGS-------KTSNATSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKP 96
           +   DLD  FGS          N TS    D F  +  +++         PD   + P  
Sbjct: 61  NIHDDLDDLFGSIPKKEDVVQDNHTSIDGLDLFQSSSHVVSK------TEPDNQEINPFD 114

Query: 97  QP-------------VVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTA 143
            P             V+DEV+DME+A+LMSLGL+ DKA+ YYERGI +E V+ R++++ A
Sbjct: 115 NPFETEHKSESPTEEVIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVL-RKRKQKA 173

Query: 144 RTERPLRTSPQSSQLREEESDLF--------SVASNWLNKGRTFLDSKLKQVQTEYSDR- 194
                 R++    Q   E  ++F        S+ S  LNKG+  ++ +L     E ++R 
Sbjct: 174 SNGYQQRSNIDRKQGGGEIRNIFDTRGSGSESLFSGILNKGKELVN-QLSTYTEEENERM 232

Query: 195 -SFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANX 253
             F  Y       + S  +L++  S    V S   ++K+  +      E+      + N 
Sbjct: 233 NKFKGY----EEYSMSETYLEKENSMDPGVFSRSSQEKIPQRAARPSHEKSNSSRSKINK 288

Query: 254 XXXXXXXXXXXXXXXXXXXXXETPGDKSEAPPNPSPVQDNDLLIDFEAPALKTSN---VP 310
                                     +  + P    + D D      +P + TSN   V 
Sbjct: 289 RMTTEAPHKPFNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHASSPVVNTSNQNTVS 348

Query: 311 ATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNII 370
            T  P ++ +E   + EFK +G + F+ GDY +A + YEKSLN+LP+ HPLR++++SNII
Sbjct: 349 ITQIP-ISHIEISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNII 407

Query: 371 ICRLKVGEYREALSDASSALKLIPQGSM--NSNIPNLNPPKTYKEFWSKIMNNKAVAFER 428
             R+K+G++ +++ DA  A+KL+P+      + I N +P ++Y + W KI+  +A ++E 
Sbjct: 408 ASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEA 467

Query: 429 VENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKK 488
           +E Y+ AL+ YQ L+E  + S KV+  +R+CQ A+ L+ KP S    S+++ P  A  + 
Sbjct: 468 IEKYKLALDAYQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNP-PSKSATPAPAPRRA 526

Query: 489 PSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELL 548
           P+       +   S    +++  N++   LE Q+  L+D+V  +I  W  G  D++R LL
Sbjct: 527 PTVNRQTEVVNKKSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLL 586

Query: 549 ARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIV 608
           +    ++ W  WK V +++LV+P+K K+ Y+KAVAK HPDK+  S  L+++MIAE+VF  
Sbjct: 587 SNLQAVITWTQWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFST 646

Query: 609 LSKAWETFKEKNQLS 623
           LS +WE FK+ N ++
Sbjct: 647 LSDSWENFKKSNDIN 661

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  288 bits (738), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 152/339 (44%), Positives = 218/339 (64%), Gaps = 19/339 (5%)

Query: 293 NDLLIDFEA----PALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNY 348
           ++ L+DFE     P L++S+     S  ++ +E   F EFK KG   F  G+Y +A   Y
Sbjct: 255 HETLLDFEQAVSPPQLRSSSARPPIS--ISAMELSGFGEFKSKGGELFAHGNYSSALLEY 312

Query: 349 EKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPP 408
           EKSLN+LP  HPLR++S SNII  +LK+GE   AL +  +AL+LI +  +   IP  NPP
Sbjct: 313 EKSLNTLPSGHPLRIISLSNIITTQLKLGESSSALQNIETALRLIGEDELQLTIPASNPP 372

Query: 409 KTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKK 468
           K+Y+EFW KI   KA A E VENY  ALE Y+ LI+ G  +SKV++ +R+CQK ++    
Sbjct: 373 KSYREFWGKITMRKAEALEHVENYVSALECYKALIDKGFVTSKVMDGKRRCQKVLS---- 428

Query: 469 PVSVARKSETSIPKAAVTKKPSGR---PAKVTLENPSEKLARVQDINKKEKDLEAQRFLL 525
                 K ++ IP  A  KKPS      +  TL   S+ L ++Q IN++ + LE ++FLL
Sbjct: 429 ----PPKPQSGIPPVA-RKKPSPNVLDTSSSTLPKRSDNLEKIQRINREAEQLENKKFLL 483

Query: 526 HDEVSSLIQEWCEGHDDNLRELLARFHTIVDWVN-WKEVSTADLVVPKKAKVIYLKAVAK 584
            D+V   I+ W +G +++LR+LLA    ++ W N WK V+T+DLV+PKK K+ YLKA+AK
Sbjct: 484 RDKVDEQIKSWSQGKENDLRQLLADLPKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAK 543

Query: 585 THPDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
           THPDK+ DS  ++ KM+AE++F +LSKAWE FKE+N +S
Sbjct: 544 THPDKLNDSLDVEHKMLAEDIFSILSKAWEAFKEENNIS 582

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 79/224 (35%), Positives = 109/224 (48%), Gaps = 56/224 (25%)

Query: 5   FDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNATSG- 63
           F DL S+FKG  + SS T                     +  +  D   G   S+     
Sbjct: 6   FADLLSSFKGEKQKSSTTS--------------------ETVSLFDKHDGPSISSPAPSK 45

Query: 64  ---TARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQ--PVVDEVKDMEIARLMSLGLDW 118
              T  D+ D AFD+ N    +           P  Q  PVVDEVKDMEIARLMSLG+  
Sbjct: 46  PLQTINDDLDAAFDVFNSATNT-----------PAKQGSPVVDEVKDMEIARLMSLGVSL 94

Query: 119 DKAAEYYERGILYEQVVDRQ------KRRTARTER---PLRTSPQSSQL-----REEESD 164
           ++A +YYERGILY+ V+ R+      KR+ A   R    L  +  S+ L      +++ D
Sbjct: 95  ERALQYYERGILYDDVLRRRHEKHEAKRQAAAASRDFTKLFDNGSSNILGSDGSDDKQQD 154

Query: 165 LFSVASNWLNKGRTFLDSKLKQVQTEYSD-----RSFSDYISSR 203
           LFS+A+   NKG++F++ +LKQ Q          RSF+D+ISSR
Sbjct: 155 LFSMATGLFNKGKSFMEERLKQRQQHQHQQDPAFRSFADHISSR 198

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  286 bits (732), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 210/630 (33%), Positives = 321/630 (50%), Gaps = 62/630 (9%)

Query: 18  SSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNATSGTARDEFDLAFDMLN 77
           SS+NT     + +  R PL         D D +  FG+ T+ AT    +   D   +   
Sbjct: 76  SSNNTISANSTNSSPRPPLDH------IDDDFNELFGNGTTAATDTLQKVNDDYCRNN-- 127

Query: 78  GPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVD- 136
                R +  D        + +VDEVKDMEIARLMSLGL  +KA ++Y   I YE+ +  
Sbjct: 128 ---EGRKSNGD--------EALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKV 176

Query: 137 ------RQKRRTARTERP----LRTSPQSSQLREEESDLFSVASNWLNKGRTFLDSKLKQ 186
                 + K RTAR E P       S  S+    E ++LFS+A+N+ NKG+  +D +   
Sbjct: 177 LKSNQKKSKDRTAR-ESPGDVNFERSELSNNFGSENNNLFSIATNFFNKGKELVD-QWTS 234

Query: 187 VQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETH 246
              E +DR  +++ + R+ S      L+        +  D+ ++ + ++  +L  +  T 
Sbjct: 235 FPPEENDR-LNNHPNLRNKSEDYDSPLENDPYNGFSIEDDKSEKGLLSE-NNLDEDLLTD 292

Query: 247 FGPRANXXXXXXXXXXXXXXXXXXXXXXETPGDKSEAPPNPSPVQDNDLLIDFEAPALKT 306
           F  +                        E P  K        P+ +N+LL DF    +  
Sbjct: 293 FETKIEITKRTVSDVDPSPSPSSGILIEENPLRKE-------PLVENNLL-DFSEGNVTK 344

Query: 307 SNVPATYS-------PN----LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSL 355
           SN   + S       PN    ++++E   + EFK KG+N F+ GDY  + Q YEKSLNSL
Sbjct: 345 SNSSESNSLFNGNRNPNSAIPISDIELSGYNEFKAKGSNFFKNGDYVNSLQEYEKSLNSL 404

Query: 356 PLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMN-SN-IPNLNPPKTYKE 413
           P  HPLR+++ SNII  +LKVGEY +++ ++S AL L P    N SN I + +P +++ +
Sbjct: 405 PSNHPLRIIALSNIIASQLKVGEYSKSIENSSMALALFPPTKANWSNMISDSDPQRSFND 464

Query: 414 FWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVA 473
            W KIM  +A +FE +E++  ALETYQ+LI       K+++ +R+CQ  I     PV   
Sbjct: 465 IWPKIMIRRAESFEHLESFSNALETYQELINKNFFDEKIMQGKRRCQNFI--NPPPV--- 519

Query: 474 RKSETSIPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLI 533
            K  + + KA  T+ P+ +    +  + S          KK+ +LE  +  L+D+V   I
Sbjct: 520 -KKFSPVKKATSTQSPTEKSTPTSSSSTSSNSPDTTSKIKKQ-ELENAKLALYDKVFERI 577

Query: 534 QEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDS 593
             W     D++R LLA    ++ W NWK++   DLV+PK+ K+ Y+KAVAKTHPDKI +S
Sbjct: 578 SSWKNDKGDDIRHLLANLSGLLTWCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPES 637

Query: 594 WPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
             L+ KMIAENVF  LS AW+ FK++N ++
Sbjct: 638 LSLENKMIAENVFSSLSIAWDKFKQQNDIN 667

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  282 bits (721), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 198/580 (34%), Positives = 289/580 (49%), Gaps = 79/580 (13%)

Query: 86  APDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTART 145
           A  V   E K   + DE +D E+A+LMSLGLD   A +YY RG  YEQ+  R +R  +  
Sbjct: 106 AASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQL--RMRRAESDG 163

Query: 146 ERPLRTS----------------------------------------PQSSQLREEESD- 164
            R  R S                                        PQ S LR   S+ 
Sbjct: 164 TRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNR 223

Query: 165 LFSVASNWLNKGRTFLDSKL-KQVQTEYSDRSFSDYISSRSGSNASPPWLKESGSYHLQV 223
           L S ASN  N+GR F++ +L    +T  S R      S+ S SN       +   Y +  
Sbjct: 224 LVSAASNLFNRGRDFIEDQLATHARTSASSR------STLSDSNERFSNHTQESDYSVNQ 277

Query: 224 SSDRGKQKVTTQFKDLKIEEETHFGPRANXXXXXXXXXXXXXXXXXXXXXXETPGDKSEA 283
           ++D+    + TQ    +++    F                           E P  ++  
Sbjct: 278 TNDQA-HLIHTQPTAAEVDLLEGFA---------------DTEVVQHQSTLEVPRMQAAG 321

Query: 284 PPNPSPVQDNDLLIDFEAPALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHA 343
                 V+  + LIDF +     S     Y  ++T LE   + +F +  A S++ GDYHA
Sbjct: 322 ------VKSEESLIDFSSEGPSKSAAQLNYV-SITPLELSGYYDFNKTAAESYKKGDYHA 374

Query: 344 AFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIP 403
           AFQ+Y KSLN+LPL HPLR+++ SNII  +LK+GE+ E++ + +SA++L+     ++ I 
Sbjct: 375 AFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFDAQIQ 434

Query: 404 NLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAI 463
           + +PP+TYKEFW KI+  KA   E  +NYE AL  YQQLI  G T   +L  + +CQKA 
Sbjct: 435 DTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKAC 494

Query: 464 ALEKKPVSVARKSETSIPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRF 523
             +K  VS    S  +       K P  R    T +  +E++ R++  N   +  E +RF
Sbjct: 495 NSQKGNVS----SNPTATTQGDRKNP--RKQTATAKGKTEEVKRLKAQNHAIEKQENERF 548

Query: 524 LLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVA 583
            LHD+V S I+ W  G   +LR LL     ++ W+N  ++  +DLV+PK+ K+ YLKAV+
Sbjct: 549 GLHDKVESRIRTWTAGKSTDLRHLLLGLPALLPWLNSDQMIASDLVMPKRVKLSYLKAVS 608

Query: 584 KTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
           KTHPDK+  +  L+ KM+AE+VFI L+KAW  FKE+N LS
Sbjct: 609 KTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  275 bits (704), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 215/336 (63%), Gaps = 15/336 (4%)

Query: 293 NDLLIDFEAPALKTSNVPATYSPN--LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEK 350
           N+ L+DF++P     + PA   P   ++E+E   ++EFKE+G  +F+TGDY  A + Y+K
Sbjct: 361 NNTLLDFDSPTTAVHS-PAASLPKVPISEIELLGYKEFKERGTENFKTGDYVTALEAYQK 419

Query: 351 SLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIP--QGSMNSNIPNLNPP 408
           SLN+LP+ HPLR+++ SNI+    K GEYR+++  ++SAL+  P  Q   N  I +  P 
Sbjct: 420 SLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQFPGDQKQWNEFIQDSEPQ 479

Query: 409 KTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKK 468
           +TYK+ W KI+  +A AFE +E+YE ALETYQQ+IE    + KV+  +R+CQ  I     
Sbjct: 480 RTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNFFNDKVMSGKRRCQHVI----N 535

Query: 469 PVSVARKSETSIPKAAVTKKPSGRPAKVTLENPS-EKLARVQDINKKEKDLEAQRFLLHD 527
           PV   + + +++P+   TK     P K + +N + E + +++  NK E ++E+QR  L+D
Sbjct: 536 PVKPTKSNSSALPRQTNTK-----PKKESNQNKAYENVEKLKQKNKLEAEIESQRLALYD 590

Query: 528 EVSSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHP 587
            V + I +W    DD++R LL+    I+ W NW  V  +DLV+PKK K+ Y+KAVA+THP
Sbjct: 591 SVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKKVKITYMKAVARTHP 650

Query: 588 DKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
           DKI     L++KMIAEN+F VLSKAWE FK+ N ++
Sbjct: 651 DKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 79/178 (44%), Gaps = 35/178 (19%)

Query: 1   MSSAFDDLFSAFKGGNESSSN---------TKPKGESLAGARLPLTG--------EASRK 43
           M+  F DL S+FK G+ + +          TKP  E L  A+ P+            S  
Sbjct: 1   MADPFADLLSSFKSGSTTKNEQADKKVNIATKPMAE-LLTAQKPVNNVTLIENEVSISSN 59

Query: 44  DADADLDAFFG----SKTSNATS--------GTAR-----DEFDLAFDMLNGPVASRLAA 86
               D+   FG    SK  NA+          T++     D+ D A +  N      L  
Sbjct: 60  GIHDDIADLFGLSSESKPINASKPINASKPINTSKPSEGIDDLDAAMNFFNDSPQESLRG 119

Query: 87  PDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTAR 144
             V         VVDEVKDMEIA+LMSLGLD D+A  +Y+ GILYE +V + +   +R
Sbjct: 120 STVTTSPEVQDIVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILYETLVSKIRTSNSR 177

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  266 bits (680), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 179/554 (32%), Positives = 286/554 (51%), Gaps = 47/554 (8%)

Query: 98  PVVDEVKDMEIARLMSLGLDWDKAAEYYERGILY---EQVVDRQKRRTARTERPLRTSPQ 154
           P+++ V  ME   + + G+  + A   Y++G+ Y   ++V+   K+   R          
Sbjct: 127 PLLEGVHGMESEPINARGISTEDANSCYDQGLFYIDAQEVLQNGKKFQQRNGFTAGQRSD 186

Query: 155 SSQLR-------EEESDLFSVASNWLNKGRTFLDSKLKQVQTEYSDRSF---------SD 198
           S   R        EE +L S ASN   KGR  +++K+ +      +R           S+
Sbjct: 187 SDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLFSSE 246

Query: 199 YISSRSGSNASPPWLKESGSYHLQVSSDRGKQKVTTQFKDLKIEEETHFGPRANXXXXXX 258
             +SRS +N   P L    S     +SD     ++ +F  L ++E+    P  N      
Sbjct: 247 NTNSRSHTNKYEPELSRDSS-----NSDY----ISKKFDGLSVDEDKG-NPCLNKEENYA 296

Query: 259 XXXXXXXXXXXXXXXXETPGDKSEAPPNPSPV--QDNDLLIDF---EAPALKTSNVPATY 313
                           +    +S+   +   +   ++  LIDF   EAP    S V + Y
Sbjct: 297 DLLSHAFLDTGDTEAKDRIWGQSQNVHSQESLYSAEDGKLIDFDTEEAPP-PASKVSSHY 355

Query: 314 SPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICR 373
            P ++++E   ++EF   G   FR GDYH A Q Y KSLN+LP+ HPLR+V++SNII  +
Sbjct: 356 VP-ISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQ 414

Query: 374 LKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYE 433
           LK+GE+ E+L +   A  L+   S++  I   NPPKTYKEFW+KI++ KA   E +E+Y+
Sbjct: 415 LKIGEHTESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYD 474

Query: 434 KALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVS----VARKSETSIPKAAVTKKP 489
           +AL  Y+ LI  GV   K++E + +CQK   +  +P +    +A   +  +PK+  +  P
Sbjct: 475 EALAVYRCLISKGVFDKKIIEGKTRCQKHSKITSEPATEDSALAPVQKDKVPKSNNSSIP 534

Query: 490 SGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLA 549
             R   +  +   E + + Q++    K+LE Q+F LHD+V S IQ W +G + +LR LL+
Sbjct: 535 ERR---IRSQKAEELIKKRQEM----KELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLS 587

Query: 550 RFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVL 609
           R   ++ W NW  +   DLV+PKK K+IY+KA++K HPDK+  +  L+ KM+AE++F VL
Sbjct: 588 RLSLVLTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVL 647

Query: 610 SKAWETFKEKNQLS 623
             AW  FK  N ++
Sbjct: 648 GNAWNVFKLNNDIN 661

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  258 bits (658), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 204/314 (64%), Gaps = 18/314 (5%)

Query: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376
           ++++E   + EFK KG + F+ GDY  + Q YEKSLN+LPL HPLR+++ SNII  +LK+
Sbjct: 366 ISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKI 425

Query: 377 GEYREALSDASSALKLIP--QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434
           GEY +++ ++S AL+L P  +    + I N +P +++ + W KIM  +A +FE +E+++K
Sbjct: 426 GEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKK 485

Query: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALE--KKPVSVARKSETSIP---KAAVTKKP 489
           ALETYQ+LI+      K+++ +R+CQ  I     KK + V +K+ T+ P   K  +T   
Sbjct: 486 ALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQNLTASS 545

Query: 490 SGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLA 549
           S  P  +++++ SE          K+++LE  +  L+D+V   I  W +G DD++R LLA
Sbjct: 546 SNSP--ISVDSTSEI---------KKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLA 594

Query: 550 RFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVL 609
              +++ W NWK+VS  DLV+PK+ K+ Y+KAVAKTHPDKI +S  L+ KMIAEN+F  L
Sbjct: 595 NLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTL 654

Query: 610 SKAWETFKEKNQLS 623
           S AW+ FK +N ++
Sbjct: 655 SIAWDKFKLQNDIN 668

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 76/148 (51%), Gaps = 21/148 (14%)

Query: 55  SKTSNATSGTA----RDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQ-------PVVDEV 103
           S T+N T  +A     D+F+  F M        +  PD D    K          +VDEV
Sbjct: 83  SNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKPDEDYYGSKEDHLYNGDDALVDEV 142

Query: 104 KDMEIARLMSLGLDWDKAAEYYERGILYEQVVD----RQKRRTARTER------PLRTSP 153
           KDMEIARLMSLGL  ++A E+YE  + YE+ ++    +QK R     R       +  S 
Sbjct: 143 KDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKESGIKMEKSG 202

Query: 154 QSSQLREEESDLFSVASNWLNKGRTFLD 181
            S+ +  + ++LFS+A+++ NKG+  +D
Sbjct: 203 LSNIVGTDSNNLFSMATDFFNKGKKLVD 230

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 195/310 (62%), Gaps = 13/310 (4%)

Query: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376
           ++ LE   ++E+K++G   F+ GDY +A Q YEKSLNSLP  H LR+V++SN+     KV
Sbjct: 265 ISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKV 324

Query: 377 GEYREALSDASSALKLIPQGS--MNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434
           GEY+  LSD  SAL++ P+     +  I +  P +T+KE W KI+  +A AFE +ENYE+
Sbjct: 325 GEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYER 384

Query: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAV-TKKPSGRP 493
           AL+ YQ LIE    + K++  +R+CQK +   +   +   +S T +PK +  TK+P    
Sbjct: 385 ALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSEDTKQPK--- 441

Query: 494 AKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHT 553
              T  N    + RV+  N++ +  EA++  L+D V   I+ W  G  D++R LLA   T
Sbjct: 442 ---TYAN----VERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLST 494

Query: 554 IVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAW 613
           ++ W +WK VST+DLV+PKK K+ Y+KAVAKTHPDKI  S  L+++MIAE+VF  LS AW
Sbjct: 495 VLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAW 554

Query: 614 ETFKEKNQLS 623
           E FK  N ++
Sbjct: 555 EKFKLANDIN 564

 Score = 98.6 bits (244), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 103/190 (54%), Gaps = 20/190 (10%)

Query: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFFGSKTSNA 60
           MS  F DL S+F+ G  S S +K     +   +LP   + +  D   DLD  FG K  + 
Sbjct: 1   MSDPFADLLSSFRSGG-SDSVSKEATPEVKQEKLPGRNQINVHD---DLDELFGLKKRDE 56

Query: 61  T---SGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKDMEIARLMSLGLD 117
           T   +    D FD AF+  + P     +      +E  P+ VVDEVKDME+A+LMSL LD
Sbjct: 57  TVVKNQVVGDSFDAAFEAFDRPQKVEKS------LEESPEMVVDEVKDMEVAKLMSLNLD 110

Query: 118 WDKAAEYYERGILYEQVVDRQKRR---TARTERPLRTSPQSSQLREEESD---LFSVASN 171
            D+A +YYERG+LYEQ + RQ+R      R E+ LR   Q  Q  EE+ D    FS+AS 
Sbjct: 111 IDQATDYYERGVLYEQ-LSRQRREQELIRRREQMLRQQQQQQQTPEEKFDSGSFFSLASG 169

Query: 172 WLNKGRTFLD 181
            L KGR F+D
Sbjct: 170 ILEKGRQFVD 179

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  254 bits (649), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 128/309 (41%), Positives = 193/309 (62%), Gaps = 16/309 (5%)

Query: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376
           ++++E   + EFK KGA  F+ GDY  + Q YEK+LNSLP  HPLR++  SNII  +LKV
Sbjct: 348 ISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKV 407

Query: 377 GEYREALSDASSALKLIP--QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434
           GEY +++ ++  AL L P  + S N+ I N +P +++ + W KIM  +A +FE +E+++ 
Sbjct: 408 GEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKN 467

Query: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPA 494
           ALETYQ+LI       K+++ +R+CQ  I+       + RKS          KKP+  P+
Sbjct: 468 ALETYQELISRNFFDDKIMQGKRRCQNFIS-----PPLVRKSTPVKKTTPTLKKPAPDPS 522

Query: 495 KVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTI 554
              ++ PS+          KE++LE  +  L+D+V   I  W  G +D++R LL+    +
Sbjct: 523 PAPIDIPSKV---------KEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQL 573

Query: 555 VDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWE 614
           + W NWK+VS  DLV+PKK K+ Y+KAVAKTHPDKI +S  L+ KMIAEN+F  LS AW+
Sbjct: 574 LTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWD 633

Query: 615 TFKEKNQLS 623
            FK++N ++
Sbjct: 634 KFKQQNDIN 642

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 51/90 (56%), Gaps = 10/90 (11%)

Query: 102 EVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVD----RQKRRTARTER------PLRT 151
           EVKDMEIARLMSLGL   KA E+Y   I YE+ ++    +QK+   R  R       ++ 
Sbjct: 136 EVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQKKHRDRIAREKSNDIKIKK 195

Query: 152 SPQSSQLREEESDLFSVASNWLNKGRTFLD 181
               +    + ++L S+A+++ NKG+  +D
Sbjct: 196 PGLFNNTDSDNNNLLSIATDFFNKGKELMD 225

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  253 bits (647), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 200/312 (64%), Gaps = 11/312 (3%)

Query: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376
           ++ +E   + EF+ +G   F+ GDY ++FQ YEKSLN+LP+ HPLR++++SNII   LK+
Sbjct: 395 ISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASELKI 454

Query: 377 GEYREALSDASSALKLIPQGSM--NSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434
           GEY ++L ++SSAL++ P  +    + I + +P +TYK+ W K+   +A A E +E+++ 
Sbjct: 455 GEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIESFKA 514

Query: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPA 494
           AL +YQ+LIE G  + K+++ +R+CQK   L   P  V +    S PK    + PS  P 
Sbjct: 515 ALSSYQELIEKGFANDKIMDGKRRCQKV--LNPTPPPVVKTPRISTPK----QSPSPVPR 568

Query: 495 KVTLENPS---EKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARF 551
           K T  +     E + R++  N   +++E Q+  L+D+V + ++ W    D ++R LLA  
Sbjct: 569 KATSNSKDAVYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLANL 628

Query: 552 HTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSK 611
             ++ W +WK V+ +DLV+PKK K+ Y+KAVAKTHPDK+ +S  L+ KMIAENVF VLS 
Sbjct: 629 SIVLTWCDWKPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLSV 688

Query: 612 AWETFKEKNQLS 623
           AW+ FK +N +S
Sbjct: 689 AWDKFKIENNMS 700

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 112/232 (48%), Gaps = 52/232 (22%)

Query: 1   MSSAFDDLFSAFKGGNES----------SSNTKPKGESLAGARLPLT----GEASRKDAD 46
           MS  F DL ++FK G ++          S+  KP   S   ++L +T      +      
Sbjct: 1   MSDPFADLLTSFKNGKDNAKSEPTKSNISATQKPASASPNISQLSITPLVPSPSPNVSIH 60

Query: 47  ADLDAFFG-SKTSNATSG--------TARDEFDLAFDMLNGPVASRL----AAPDVDLVE 93
            D D  FG S   N T+         T  D+ D AF++     +  +    +AP+ D+  
Sbjct: 61  DDFDDLFGVSLGQNGTNTIVPKQTVKTETDDIDAAFNVFQATPSQSIKPEASAPN-DIDR 119

Query: 94  PKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVV------DRQKRRTARTER 147
            + + VVDEVKDME+ARLMSLGL  D+A ++Y++GILYE ++       RQK R     +
Sbjct: 120 DEEEYVVDEVKDMEVARLMSLGLSIDEANDHYDKGILYENLLAKMKQNQRQKERRKVETQ 179

Query: 148 PLR--TSPQSSQLREEE----------------SDLFSVASNWLNKGRTFLD 181
           P +  ++P S+  R  +                 DLFS+A+++L KG+ F+D
Sbjct: 180 PTKRNSNPPSANNRLNDRFDNTYANIRDSRTRGGDLFSMATDFLYKGKEFVD 231

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  252 bits (643), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 210/354 (59%), Gaps = 25/354 (7%)

Query: 285 PNPSPVQDNDLLI----DFEAPA---LKTSNVPATYSPNLTELERHSFEEFKEKGANSFR 337
           PN   +QDN LL     D  +PA   + +S        ++ ++E   + EFK++G   F+
Sbjct: 350 PNDERIQDNTLLDFGNEDLSSPANVSISSSGQECIPVISINQIELSGYNEFKDRGTEYFK 409

Query: 338 TGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGS 397
            GDY +A + YEKSLNSL   HPLR+++ SN++   LK G+Y   ++ ++SAL L P+ S
Sbjct: 410 KGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKES 469

Query: 398 M--NSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEA 455
              ++ I N  P KTYKE WSK++  +A AFE +ENY++A ++YQ LIE  + + K++  
Sbjct: 470 KLWDNVIQNSEPSKTYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMAG 529

Query: 456 RRQCQKAIALE------KKPVSVARKSETSIPKAAVTKKPSGRPAKVTLENPSEKLARVQ 509
           + +CQK +  E      KK V+   +++TS  K  V  + +           S  L ++Q
Sbjct: 530 KLRCQKVLNPETHNKPLKKLVATTAETKTSQTKNIVNTQSTS----------SGNLKKIQ 579

Query: 510 DINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLV 569
           + NK+ +  E ++  L+D V   +  W  G DD++R LL+R   I+ W  W EV+++DLV
Sbjct: 580 EQNKRTEKYEEEKEALYDVVEQKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLV 639

Query: 570 VPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623
           +PKK K+ YLKAVAKTHPDK+  +   + +M+AEN+F +LSK WE FK  N +S
Sbjct: 640 MPKKVKITYLKAVAKTHPDKLPSNLDTESRMLAENIFSILSKNWEKFKVDNNIS 693

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 56/107 (52%), Gaps = 15/107 (14%)

Query: 48  DLDAFFG----SKTSNATSGT---ARDEFDLAFDMLN-GPVASRL---AAPDVDLVEP-- 94
           D D  FG    S T+N   GT    RD+ D   DM +  P  S       P     E   
Sbjct: 84  DFDDLFGPSKPSVTTNTFKGTDQGERDDLDDIMDMFDFTPSPSHCNQEVMPSKTNAEAQS 143

Query: 95  --KPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQK 139
             K + +VDEVKDMEIA+LMSLGL  D+A + +E GILY+ V  RQ+
Sbjct: 144 SSKNEVIVDEVKDMEIAKLMSLGLSIDEAIKSFEHGILYDTVASRQQ 190

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  241 bits (615), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 131/323 (40%), Positives = 201/323 (62%), Gaps = 16/323 (4%)

Query: 303 ALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLR 362
            L+ SN+P      ++ +E   + E+  +G++ F+ GDY +A + YEKSLN+LP +HPLR
Sbjct: 338 VLENSNIPKI---PISSIELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLR 394

Query: 363 VVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSN--IPNLNPPKTYKEFWSKIMN 420
           ++++SNI    LK+GEY   +  A  ALKL P+ ++  N  I +  P K+YK+ WSK++ 
Sbjct: 395 IIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVL 454

Query: 421 NKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSI 480
            KA A E +EN+E A + Y  LIE  V S K+++ +R+CQK +  E     +A+K++   
Sbjct: 455 RKAEALEHLENFELAYKQYHSLIENNVFSDKIMDGKRRCQKVLNPE-----IAKKTQ--- 506

Query: 481 PKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGH 540
            +   + KP+  P   T +   E + R+++ N++E++ EA++  L+D V + I  W    
Sbjct: 507 -QKPSSSKPAAVPTPSTQK--YESVERIKEQNRQEEENEAEKLKLYDIVEAKINAWKSNK 563

Query: 541 DDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKM 600
            +++R LLA   TI+ W  WK +S  DLV+PKK KV YLKA+AKTHPDKI  S  L+ KM
Sbjct: 564 PEDIRHLLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKM 623

Query: 601 IAENVFIVLSKAWETFKEKNQLS 623
           IAEN F  LS AW+ FKE+N ++
Sbjct: 624 IAENAFSTLSVAWDKFKEENNMN 646

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 78/149 (52%), Gaps = 28/149 (18%)

Query: 48  DLDAFFGSKTSN--ATSGTARDEFDLAFDMLNGPVASRLAAPDVDLVEPKPQPVVDEVKD 105
           D +  FGS TSN  + S    + F    D+           P+V   E K   VVDEVKD
Sbjct: 83  DFEELFGSSTSNNFSVSPEPTNNFKTVTDV-----------PNV-TYEAKQDSVVDEVKD 130

Query: 106 MEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPLRTSPQ----------- 154
           MEIA+LMSLGL  +KA  YY +GI Y+ ++ + +RR   + R  R +P            
Sbjct: 131 MEIAQLMSLGLSIEKANSYYSKGISYDTLLKKLERRRYGS-RKGRDTPTFGGNTNKDDKA 189

Query: 155 SSQLRE--EESDLFSVASNWLNKGRTFLD 181
            ++L +  E ++LFS+AS   NKG+ F+D
Sbjct: 190 YAKLFDSSENTNLFSMASGLFNKGKEFID 218

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  234 bits (598), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/325 (39%), Positives = 187/325 (57%), Gaps = 13/325 (4%)

Query: 301 APALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP 360
           +P+++   VP      ++ +E   + EF+ KG   F+ GDY AA   YEKSLN+LP  HP
Sbjct: 272 SPSIELPIVP------ISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHP 325

Query: 361 LRVVSFSNIIICRLKVGEYREALSDASSALKLIPQ--GSMNSNIPNLNPPKTYKEFWSKI 418
           LR+++ SN+++  LK+GEY + L  A  AL+LIP+   +  S I    P +TY++ WSK+
Sbjct: 326 LRIIAMSNMMLPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKL 385

Query: 419 MNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSET 478
           +   A A E  ENY  A + YQ L+  G+T+ KV++ +R+CQK +     P  V RK   
Sbjct: 386 VMRLAEAQEHAENYTGAFDNYQLLVANGITNEKVMDGKRRCQKVL---NPPSKVERKGTP 442

Query: 479 SIPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCE 538
           +     VT  P+  P   T +   E   RV+  N K +  EA +   +D V + +  W  
Sbjct: 443 TPTPQVVT--PARTPDPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKG 500

Query: 539 GHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKR 598
             + ++R LL+    IV WV W  VS ADLV+PK+ K+ YLKA+AK HPDKI    PL+ 
Sbjct: 501 DKEGDIRYLLSHLTEIVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEY 560

Query: 599 KMIAENVFIVLSKAWETFKEKNQLS 623
           +MIA+ VF VL+ AWE FK  N ++
Sbjct: 561 RMIADTVFSVLNNAWEKFKLDNNIN 585

 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 109/223 (48%), Gaps = 31/223 (13%)

Query: 1   MSSAFDDLFSAFKGGNESSSNTKPKGESLAGARLPLTGEASRKDADADLDAFF------- 53
           M+  F  L ++FK   ESS     K ES      P+T +   + A A   A F       
Sbjct: 1   MADPFASLLTSFK---ESSKKPAAKSESPE----PVTVKGGGEPATASTHAVFMEPLIPS 53

Query: 54  --GSKTSNATSGTARDEFDLAFDMLNGPVASRLAAPD---VDLVEPKPQPVVDEVKDMEI 108
             G  +       + D+FD  FD+ N   A+ +  PD    D    +   VVDEV+DME+
Sbjct: 54  GGGQGSFQQKPAGSDDKFDDVFDLFNSEPAAEVKEPDRVPSDESVHENVAVVDEVRDMEV 113

Query: 109 ARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTARTERPLRTSPQSSQL-REEESDLFS 167
           A++MSLG   DKA E+Y+ G+LY+++V+R+ RR  R      +  + +++ +   +  FS
Sbjct: 114 AKIMSLGFGIDKAVEFYDSGVLYDELVERRDRRHIRHTHTRHSVREVTEVPKHTGNSFFS 173

Query: 168 VASNWLNKGRTFLD----------SKLKQVQTEYSDRS-FSDY 199
            A   LNKG+ F+D           +L + + E++D + F D+
Sbjct: 174 AAVGLLNKGKDFVDHLTAYPDEEGDRLARYRQEHADAAHFGDF 216

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  229 bits (583), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 121/309 (39%), Positives = 193/309 (62%), Gaps = 9/309 (2%)

Query: 317 LTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKV 376
           ++ +E   + EF+  G   F+ GDY +A   Y+KSLN+LP  HPLR++S+SNI+  +LKV
Sbjct: 538 ISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKV 597

Query: 377 GEYREALSDASSALKLIPQGSM--NSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434
           GEY +++ D   AL+L P+        I + +P KTYKE W KI+  KA A E +E Y+ 
Sbjct: 598 GEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKYQI 657

Query: 435 ALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGRPA 494
           A ++YQ L+   V + K++  +R+CQK +     P +   KS  +  + +  K+ +   +
Sbjct: 658 AYDSYQLLLHKNVFNDKIMAGKRRCQKVL----NPETPKLKSSANTSRISSAKQSTASTS 713

Query: 495 KVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTI 554
            +   N ++ + R+++  KKE++ E +R  L D V++ IQ+W    +D++R LL+  H +
Sbjct: 714 SI---NVNKNVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIV 770

Query: 555 VDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWE 614
           + W NWK ++ +DLV+PKK KV Y+KAVAKTHPDKI     ++ KMIAE++F +LS AWE
Sbjct: 771 LTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWE 830

Query: 615 TFKEKNQLS 623
            FK  N+++
Sbjct: 831 KFKTANKMN 839

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 64/124 (51%), Gaps = 14/124 (11%)

Query: 72  AFDMLNGPVASRLAAP--DVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGI 129
             D  N    S +  P  D +L     Q VVDEVKDMEIA+LMSLGL  DKA  YY +G 
Sbjct: 187 TIDTHNNTQNSNIQLPLSDDNLDMEDQQSVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGY 246

Query: 130 LYEQVVDRQKRRTARTERPLRTSPQSSQLREE------------ESDLFSVASNWLNKGR 177
           L + V+ + + +  + +    T    +++R               + LFS+AS++LNKG+
Sbjct: 247 LSDDVLRKMQAQKHKRQSNYSTKYDDTKIRNSLDKLNNSASPPGNNVLFSIASDFLNKGK 306

Query: 178 TFLD 181
             +D
Sbjct: 307 GIVD 310

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SFEE+K  G   F+ G+Y  A + Y+K +       P   + +SN  +  +K+ +Y EAL
Sbjct: 2   SFEEYKTTGNTYFKDGNYLKAVEYYKKCIE----VEPENPIGYSNSAMSLIKLTKYTEAL 57

Query: 384 SDASSALKLI 393
               + LK +
Sbjct: 58  ESCGTGLKYV 67

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 22/146 (15%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S EEFK++G  +F   DY  A + + K++ +   +     V +SN   C   + ++ EAL
Sbjct: 2   SAEEFKKQGNAAFVAKDYEKASELFTKAIEA---SEAPNHVLYSNRSACFTSLKKFNEAL 58

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443
           +DA+  +K+ P                    WSK  N    A+  +   ++A + Y++ +
Sbjct: 59  NDANECVKINPA-------------------WSKGYNRVGAAYFGLGKLDEAEQGYKKAL 99

Query: 444 EAGVTSSKVLEARRQCQKAIALEKKP 469
           E   ++    +   Q QKA   +++P
Sbjct: 100 EIDTSNKAAQDGLEQVQKAQKSQQQP 125

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 40.0 bits (92), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SFE++KE+G  +F+ G Y  A + Y+K ++      P   + +SN  +  +K+G Y E +
Sbjct: 2   SFEQYKEEGNRNFKEGSYKVAAELYQKCVD----IEPENPIGYSNKAMALIKLGRYTEVV 57

Query: 384 SDASSALKLIP 394
                 L   P
Sbjct: 58  ELCRKGLTFTP 68

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 71/155 (45%), Gaps = 29/155 (18%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E  K +G  +    D+  A + Y  ++  LP       V ++N       +  Y EA+ D
Sbjct: 98  ETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTN----AVYYANRAAAHSSMKAYEEAIKD 153

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445
           A SA+K  P               TY + +S++      A   +   E ALE Y+++++ 
Sbjct: 154 AESAIKTDP---------------TYSKGYSRL----GYAKFALGQAEDALEAYKKVLDI 194

Query: 446 -GVTSSKVLE-----ARRQCQKAIALEKKPVSVAR 474
            G  +S V++     A+++ ++++ LEKKP + AR
Sbjct: 195 EGDKASDVMKRDYETAKKKVEQSLDLEKKPETQAR 229

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 23/119 (19%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK +G  +    D+H A + Y +++  LP       + ++N       + E+ EA+ D
Sbjct: 102 EAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTN----AIYYANRAAAHSSLKEFEEAIKD 157

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIE 444
           A SA+K+ P               +Y + +S++    A A   +  +E+ALE+Y+++++
Sbjct: 158 AESAIKIDP---------------SYSKGYSRL----AFAKYGLGKHEEALESYKKVLD 197

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 71/148 (47%), Gaps = 29/148 (19%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E  K +G  +  + DY  A + Y +++  LP       V F+N          Y EA+ D
Sbjct: 102 EALKLEGNKAVASKDYDLAVEKYTEAIKILPT----NAVYFANRAAAYTNSQNYDEAVKD 157

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445
           A  A+KL P                Y + +S++   K V     EN+E++LE Y++++E 
Sbjct: 158 AEEAIKLDP---------------AYSKGYSRLAYAKYVQ----ENFEESLEAYKKVLEI 198

Query: 446 -GVTSSKVLE-----ARRQCQKAIALEK 467
            G ++++V +     A+++ ++++ LEK
Sbjct: 199 EGDSATEVTKRGYETAKKRVEESLNLEK 226

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 59/138 (42%), Gaps = 22/138 (15%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S EEFK++G  +F   D+  A + + K++ S   +     V +SN   C   + +++EAL
Sbjct: 2   SAEEFKKQGNAAFVAKDFEKAAELFSKAIES---SETPNHVLYSNRSACYTSLKKFKEAL 58

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443
            DA   +K+ P                    WSK  N    A   + N + A + Y++ +
Sbjct: 59  EDAEECVKINPT-------------------WSKGYNRVGAAQYGLGNLDDAEKEYKKAL 99

Query: 444 EAGVTSSKVLEARRQCQK 461
           E   ++    E   Q QK
Sbjct: 100 EIDSSNKAAQEGLEQVQK 117

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 79/167 (47%), Gaps = 33/167 (19%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E  K +G  +    DY  A + Y +++ +LP       V F+N       + +Y EA+ D
Sbjct: 101 EALKLEGNKAMAGKDYELAIKKYTEAIATLPT----NAVYFANRAAAYSSLKKYDEAVED 156

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVEN--YEKALETYQQLI 443
           A+SA+K+ P               TY + +S++       F +      E ALE Y++++
Sbjct: 157 ANSAIKINP---------------TYSKGYSRL------GFAKFAQGKAEDALEAYKKVL 195

Query: 444 EA-GVTSSKVLE-----ARRQCQKAIALEKKPVSVARKSETSIPKAA 484
           +  G  ++++++     A+++ ++++ LEK  VS    +E+    AA
Sbjct: 196 DIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSASAA 242

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           +FEE K KG  SF+ G Y  A   Y + ++  P ++P   + +SN  +  LK   + EA+
Sbjct: 2   NFEELKAKGNISFKNGSYSEAISWYNRCISIDP-SNP---IGYSNKAMALLKADRFDEAI 57

Query: 384 SDASSALKLIPQ 395
           +     L+LI +
Sbjct: 58  TTCEKGLQLISK 69

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SF+ FK +G   F+ G+Y +A ++YEK +      +P   + +SN  +  +K  + +EA+
Sbjct: 2   SFDHFKTEGNQYFKEGNYASAIKSYEKCIE----INPENPIGYSNKAMALIKANKNQEAV 57

Query: 384 SDASSALKLI 393
                 LK +
Sbjct: 58  RTCQDGLKRV 67

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SFEEFK KG  +++  ++  A   Y+K++   P T+P   V +SN  +  +K+  Y +A 
Sbjct: 3   SFEEFKIKGNTAYKQNNFTDAVNFYKKAITYDP-TNP---VGYSNCAMALIKLNNYADAS 58

Query: 384 SDASSALKLIPQGSMNSN 401
                 L  + + + N N
Sbjct: 59  QMCQRGLFYVNEQTDNDN 76

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 79/162 (48%), Gaps = 17/162 (10%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E K+KG  +F + D+  A + + +++ +   T P  V+ +SN   C   + +++EAL+D
Sbjct: 5   DELKQKGNAAFASKDFTGAIEYFTEAIAAS--TTPNHVL-YSNRSACYTSLKQFQEALND 61

Query: 386 ASSALKLIP--------QGSMNSNIPNLNPPKT-YKEFWSKIMNNKAVAFERVENYEKAL 436
           A   +K+ P         G+ +  + +L+  ++ YK+      NNKA A E +E   +  
Sbjct: 62  AQQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELDSNNKA-ASEGLEQVHRVQ 120

Query: 437 ETYQQLIEAGVTSS----KVLEARRQCQKAIALEKKPVSVAR 474
           E+ +   + G+T       ++E  RQ  K   +   P  VA+
Sbjct: 121 ESRKSRPDFGMTEMFSDPNLIEKLRQNPKTKDMMNDPSLVAK 162

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 36.6 bits (83), Expect = 0.038,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SFE  K +G + ++  DY  A + Y++ L +   T+P   ++ SN  +C +K+   +EA 
Sbjct: 3   SFERLKAQGNSCYQQQDYAGALRWYDQCLEA-DATNP---IAHSNRAMCLIKLNRSQEAQ 58

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQL 442
               + L L+       N+  L+    Y+   ++ +   + A   VE     ++T +QL
Sbjct: 59  KACQAGLALLRTSPGIPNLERLHQKLEYRLQLAQQLLQGSEATRTVETRTIPIQTVEQL 117

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 79/155 (50%), Gaps = 29/155 (18%)

Query: 319 ELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGE 378
           E ++ + E  K +G  +  T DY +A + Y +++  LP       V ++N       + +
Sbjct: 87  EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPT----NAVYYANRAAAYSSLKK 142

Query: 379 YREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALET 438
           Y +A++DA SA+K+ P               TY + +S++   K  A  +VE+   AL+ 
Sbjct: 143 YDDAVNDAESAIKVNP---------------TYSKGYSRLGFAK-FAQGKVED---ALDA 183

Query: 439 YQQLIEA-GVTSSKVLE-----ARRQCQKAIALEK 467
           Y+++++  G  ++ +++     A+++ ++++ LEK
Sbjct: 184 YKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEK 218

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 36.2 bits (82), Expect = 0.049,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 325 FEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALS 384
           FE+ KE+G + F+ G Y  A   Y++ + +     P   V +SN  +  +K+GEY +A+ 
Sbjct: 4   FEKQKEQGNSLFKQGLYREAVHCYDQLITA----QPQNPVGYSNKAMALIKLGEYTQAIQ 59

Query: 385 DASSALK 391
                L+
Sbjct: 60  MCQQGLR 66

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 22/135 (16%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           EE+K++G ++F   D+  A + + K++    ++     V +SN   C   + ++REAL+D
Sbjct: 5   EEYKKEGNSAFAAKDFEKAIELFGKAIE---VSEQPNHVLYSNRSACYASMRKFREALAD 61

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445
           A   +++ P                    WSK  N    A   + + ++A E+Y++ +E 
Sbjct: 62  AQECVRIKPD-------------------WSKGHNRLGAAHYGLGDLDEAEESYKKALEL 102

Query: 446 GVTSSKVLEARRQCQ 460
             ++    +   Q Q
Sbjct: 103 DSSNKAAQDGLAQVQ 117

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 38.5 bits (88), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 49/118 (41%), Gaps = 22/118 (18%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G  +F   DY  A   + K++    ++     V +SN         +Y +ALSD
Sbjct: 6   DEYKQEGNTAFVAKDYQKAIDAFTKAIE---VSETPNHVLYSNRSAAYTSSKQYEQALSD 62

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443
           A   +K+ P                    W+K    K  A + +  YE+A + Y + +
Sbjct: 63  ADECIKINPS-------------------WAKGYTRKGAALQGLHKYEEAEQCYNETL 101

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 37.4 bits (85), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 322 RHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYRE 381
           + + E FK +G  +    DY  A + Y +++ +LP      V+ ++N       V EY  
Sbjct: 96  KATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAYSSVKEYDN 151

Query: 382 ALSDASSALKLIPQGSMN-SNIP----NLNPPKTYKEFWSKIMN 420
           A+ DA  A+++ P  S   S +      LN P+   E++ K+++
Sbjct: 152 AIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLD 195

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 90/197 (45%), Gaps = 40/197 (20%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK++G + ++   +  A + Y K ++     + +    ++N   C L++  YR  ++D
Sbjct: 82  ENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCIND 141

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTY----KEFWSKIMNNKA---VAF-ERVENYEKALE 437
              AL+L P+     NI      K Y    K F +    ++A   + F E+++N  K+L+
Sbjct: 142 CKQALQLNPK-----NI------KCYYRIAKAFTALERLDEALESIEFGEKIDNTNKSLK 190

Query: 438 TYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAV---------TKK 488
           T +  IE   T    +EARR     +  EKK     R++   I  +A+         T K
Sbjct: 191 TLKLHIE---TKQLEIEARRL---KLENEKK----ERENYQFILNSAIELRNITNIKTSK 240

Query: 489 PSG--RPAKVTLENPSE 503
           P+   R A + LENP E
Sbjct: 241 PAELLREASIKLENPLE 257

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 13/75 (17%)

Query: 329 KEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP-------------LRVVSFSNIIICRLK 375
           K+ G + F+   +  A   YEKS + L    P             LR+  F NI +C +K
Sbjct: 222 KDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIK 281

Query: 376 VGEYREALSDASSAL 390
            G+Y++AL+  +  +
Sbjct: 282 TGDYQKALTSTTEVV 296

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLK 375
           SF+ FK+ G   F+ G+Y  A + Y K ++      P   V +SN+ +  LK
Sbjct: 34  SFQHFKDIGNEHFKKGEYDLAIEQYRKCIS----LEPTNAVGYSNLAMAYLK 81

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 4/65 (6%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E+ K KG   F+ GDY  A   YEK+  +L  ++P   + FSN+    +K+  ++EA++ 
Sbjct: 42  EDLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNA 97

Query: 386 ASSAL 390
               L
Sbjct: 98  CDKGL 102

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 28/112 (25%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKS--LNSLPLTHPLRVVSFSNIIICRLKVGEYREALS 384
           + K+KG   F+  DY  A + Y  +  LN  P       + +SNI  C + +G+  + + 
Sbjct: 124 QLKDKGNKYFKAKDYTNAIKYYNLALDLNKDP-------IFYSNISACYVSLGQLDKVIE 176

Query: 385 DASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436
            ++ AL+L P                    +SK +  +A A E +ENY  AL
Sbjct: 177 SSTKALELNPN-------------------YSKALLRRASANESLENYSDAL 209

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 67/135 (49%), Gaps = 13/135 (9%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S +E+K++G  +F   +Y  A   + K++   P   P  V+ +SN   C   + ++ +AL
Sbjct: 4   SADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSP--EPNHVL-YSNRSACYTSLKKFTDAL 60

Query: 384 SDASSALKLIPQ--------GSMNSNIPNLN-PPKTYKEFWSKIMNNKAVAFERVENYEK 434
           +DA+   K+ P         G+ +  + +L+   K+YK+      +NK VA E +E  ++
Sbjct: 61  NDANECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASNK-VAQEGLEQVKR 119

Query: 435 ALETYQQLIEAGVTS 449
             E  +   + G+TS
Sbjct: 120 TQEARKAQPDMGLTS 134

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 53/121 (43%), Gaps = 22/121 (18%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S +E+K++G  +F   DY  A + + K+++   ++     V +SN   C   + ++ E L
Sbjct: 3   SADEYKQQGNAAFVAKDYEKAAELFGKAID---VSEQPNHVLYSNRSACYTSLKKFAEGL 59

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443
            DA   +K+ P                    WSK  N    A   + N E A ++YQ+ +
Sbjct: 60  KDAEECVKINPG-------------------WSKGYNRVGAAQFGLNNLEDAEKSYQKAL 100

Query: 444 E 444
           E
Sbjct: 101 E 101

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386
           E+K +G    +  DY  A + Y+K++         + V FSN  +C LK+  ++ A  D 
Sbjct: 11  EYKNEGNACVKVQDYAKAIEKYDKAIE----LDDTQSVYFSNRALCHLKLDNFQCASQDC 66

Query: 387 SSALKLIPQ 395
             AL L P+
Sbjct: 67  DKALALDPK 75

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 47/118 (39%), Gaps = 17/118 (14%)

Query: 421 NKAVAFERVENYEKALETYQQLIEAGVTSSKVLEAR--------------RQCQKAIALE 466
           N+  A  +V++Y KA+E Y + IE   T S     R              + C KA+AL+
Sbjct: 14  NEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALD 73

Query: 467 KKPVSVARKSETSIPKAAVTKKPSGRPAKVTLENPSEKLA-RVQDINKKEKDLEAQRF 523
            K V    +   +       KK       V    PS+  A R  DI   EK +  +RF
Sbjct: 74  PKNVKAYHRRGLACVGLLEFKKARADLTVVLKAKPSDAAAKRALDIC--EKVIREERF 129

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 12/119 (10%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G  +F + D++ A + + K++   P   P  V+ +SN         +++EAL+D
Sbjct: 6   DEYKQQGNAAFTSKDFNKAIELFTKAIEVSPT--PNHVL-YSNRSAAYTSAKQFQEALND 62

Query: 386 ASSALKLIPQ--------GSMNSNIPNL-NPPKTYKEFWSKIMNNKAVAFERVENYEKA 435
           A+  +K+ P         G+    + NL    K YKE      NN   A + ++  E+A
Sbjct: 63  ATECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLDNNNNKAAQDGLDQIERA 121

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
            Anc_5.88 YGR238C
          Length = 1167

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 433  EKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKKPSGR 492
            EK  + Y+  ++A  T+SK L+  +Q  +   L  K + +  + E  +  ++     +G 
Sbjct: 1047 EKTEKNYKDSLDAVATASKALKISQQEVEKYKLLNKKLQLELEREQIMSSSSPDDSVTGM 1106

Query: 493  PAKVTL-ENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCE 538
                 + E PS   AR   +N K  +LEA+ F++  E  S+  E  E
Sbjct: 1107 SGTTNVSEQPSHSTARETHLNMKISNLEAELFIIKQERDSMKDEMLE 1153

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 28/111 (25%)

Query: 328 FKEKGANSFRTGDYHAA--FQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
            K+KG + F+  D+  A  + NY  +L   P       V +SNI  C + +G+  + +  
Sbjct: 108 LKDKGNDYFKKQDFENALKYYNYALTLKQDP-------VFYSNISACYVSLGQLEKVVES 160

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436
           ++ ALKL                   K  +SK +  +A A+E + NY  A+
Sbjct: 161 STEALKL-------------------KHDYSKALLRRASAYESLANYVDAM 192

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 71/148 (47%), Gaps = 29/148 (19%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E+ K +G  +  + D+  A + Y +++  LP       V ++N       + +Y E++ D
Sbjct: 98  EDLKLQGNKAMASKDFETAIKKYTEAIEVLPS----NAVYYANRAAAYSSLKKYEESVQD 153

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445
           A SA+K+ P               +Y + +S++      A   +   E+ALE Y+ +++ 
Sbjct: 154 AESAIKVNP---------------SYSKGYSRL----GFAKYALGKPEEALEAYKTVLDI 194

Query: 446 -GVTSSKVLE-----ARRQCQKAIALEK 467
            G  ++ V++     A+R+ ++++ LEK
Sbjct: 195 EGDKATDVMKRDYETAKRKVEQSLNLEK 222

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 29/119 (24%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G ++F   DY  A + + K++    ++     V +SN   C   + ++ +AL+D
Sbjct: 6   DEYKQQGNSAFTAKDYDKAIELFTKAIE---VSKTPNHVLYSNRSACYASLKKFSDALND 62

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAF-------ERVENYEKALE 437
           A   +             N+NP       WSK  N    A        E   NY+KALE
Sbjct: 63  AKECI-------------NINPS------WSKGYNRLGAAHLGLGDLDEAENNYKKALE 102

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 24/110 (21%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386
           E K+KG   F+  DY  A + Y+ +L  +    P   V +SN+  C + + E  + +  +
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 387 SSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436
           + AL+L P                    +SK +  +A A E++ENY  A+
Sbjct: 165 TKALELKPD-------------------YSKALLRRATANEQLENYSDAM 195

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (42%), Gaps = 29/119 (24%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G  +F   DY  A + + K++    ++     V +SN   C   + ++ +AL+D
Sbjct: 6   DEYKQQGNAAFTAKDYDKAIELFTKAIE---VSETPNHVLYSNRSACYTSLKKFSDALND 62

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAF-------ERVENYEKALE 437
           A+  +K+ P                    WSK  N    A        E   NY+KALE
Sbjct: 63  ANECVKINPS-------------------WSKGYNRLGAAHLGLGDLDEAESNYKKALE 102

>KLLA0F05093g Chr6 complement(502635..503753) [1119 bp, 372 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 372

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 35/89 (39%), Gaps = 13/89 (14%)

Query: 315 PNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP-------------L 361
           PN      ++ E  KE G   F+  ++  A   YEKS   L    P             L
Sbjct: 210 PNDVNSVLNAVEAVKEIGTKQFKEKNFEVALVKYEKSSQMLKQYFPQDLPEEDVKKIDAL 269

Query: 362 RVVSFSNIIICRLKVGEYREALSDASSAL 390
           RV  F NI +  LK   Y   LS A+ AL
Sbjct: 270 RVSLFLNIALVSLKSKNYSRTLSAATEAL 298

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 308 NVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFS 367
           N+  T   N ++ ++   + FK++G     + DY  A + Y  +++     +P   + +S
Sbjct: 120 NLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISK----YPCDPIYYS 175

Query: 368 NIIICRLKVGEYREALSDASSALKL 392
           N  +  LKV +Y  A++DA+  + +
Sbjct: 176 NRSVAYLKVNDYESAINDANFCISI 200

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386
           +FK KG    +  DY +A + Y K++ +L  T     + FSN  +  LK   +  A+ D 
Sbjct: 14  DFKNKGNEYIKKSDYDSAIEFYSKAI-ALDSTQS---IYFSNRALAHLKQDNFYSAVVDC 69

Query: 387 SSALKLIPQ 395
            +ALKL P+
Sbjct: 70  DNALKLDPK 78

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 54/126 (42%), Gaps = 29/126 (23%)

Query: 314 SPNLTELERHSFE-EFKEKGANSFRTGDYHAA--FQNYEKSLNSLPLTHPLRVVSFSNII 370
           S N TE ++ ++    K+KG   F+   Y  A  + NY   L   P       V +SNI 
Sbjct: 87  SANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDP-------VFYSNIS 139

Query: 371 ICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVE 430
            C + +G   + +  ++ AL+L P                    +SK +  +A A E +E
Sbjct: 140 ACYVSLGNLEKVVESSTKALELKPD-------------------YSKALLRRASANENLE 180

Query: 431 NYEKAL 436
           N+ +A+
Sbjct: 181 NFAEAM 186

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 14/121 (11%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G  +F   +Y  A + + K++    ++     V FSN   C   + ++ +AL+D
Sbjct: 6   DEYKQQGNAAFTAKNYDGAIELFTKAIE---VSETPSHVLFSNRSACYTSLKKFSDALND 62

Query: 386 ASSALKLIPQ--------GSMNSNIPNLNPPKT-YKEFWSKIMNNKAV--AFERVENYEK 434
           A+  +K+ P         G+ +  + +L+  ++ YK+      NNKA     E+V   ++
Sbjct: 63  ANECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQ 122

Query: 435 A 435
           A
Sbjct: 123 A 123

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 32.7 bits (73), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 325 FEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALS 384
           FE+ KE G   F+ G Y  A  +Y++ + +     P   V +SN  +  +K+ EY  A+ 
Sbjct: 8   FEKEKELGNALFKQGLYREAVDSYDQLITA----QPQNPVGYSNKAMALIKLAEYTHAIQ 63

Query: 385 DASSALK 391
                L+
Sbjct: 64  TCQEGLR 70

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SFEE K +G   F+ GDY AA + Y+  +    +  P   + +SN  +  +K   + +A+
Sbjct: 2   SFEENKTEGNRLFKLGDYTAANKFYDLCI----MEEPTNPIGYSNKAMSLIKQEHFDQAI 57

Query: 384 SDASSAL 390
              ++ L
Sbjct: 58  RTCNTGL 64

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 55/121 (45%), Gaps = 22/121 (18%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S ++FK++G  +F + DY  A + + K++    ++     V FSN   C     ++ +AL
Sbjct: 2   SADQFKQEGNQAFASKDYAKAIELFTKAIE---VSEQPNHVLFSNRSACYASNKDFVKAL 58

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443
            DA+  +K+ P                    W+K  N    A   + + ++A ++Y++ +
Sbjct: 59  DDANECVKINPS-------------------WAKGYNRLGAAHYGLGDLDEAEQSYKKAL 99

Query: 444 E 444
           E
Sbjct: 100 E 100

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 33.1 bits (74), Expect = 0.76,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 325 FEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALS 384
           F+  K KG   F+  DY  A   Y+K++ + P ++P   + +SN  +  +K+ ++ EA+ 
Sbjct: 4   FDTLKAKGNVFFKKCDYETAVLYYQKAITADP-SNP---IGYSNNAMGLIKLEKWSEAVD 59

Query: 385 DASSALKLI-PQGSMNSNI 402
             +  LK+I P+   +  I
Sbjct: 60  ACNKGLKMICPENDKDGKI 78

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 32.7 bits (73), Expect = 0.78,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           SFE+ K++G   F+ G Y  A  +Y++    L    P   V +SN  +  +K+GE+ +A+
Sbjct: 7   SFEKDKQQGNALFKQGLYLEAVDSYDR----LIAAQPQNPVGYSNKAMALIKLGEHAQAI 62

Query: 384 SDASSALK 391
                 L+
Sbjct: 63  QACQQGLQ 70

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK +G   ++   Y  A + Y K +     ++ +    FSN   C L++  YR  ++D
Sbjct: 79  ENFKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVND 138

Query: 386 ASSALKLIP 394
              AL+  P
Sbjct: 139 CRQALQFNP 147

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 58/131 (44%), Gaps = 35/131 (26%)

Query: 315 PNLTELERHSFEE-------FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLR--VVS 365
           PNL++++  + E         K+KG   F+T  +  A + Y  +L        L+   + 
Sbjct: 93  PNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALK-------LKDDPIY 145

Query: 366 FSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVA 425
           +SNI  C   + +Y + +  A+ ALKL P                    +SK++  +A+A
Sbjct: 146 YSNISACYASLLQYEKVIEYATKALKLRPT-------------------FSKVLMRRALA 186

Query: 426 FERVENYEKAL 436
           +E + N+  A+
Sbjct: 187 YEAMGNFGDAM 197

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G  +F   DY  A   + K++    ++     V +SN   C   + ++ EAL+D
Sbjct: 5   DEYKQQGNAAFVAKDYEKAIDLFSKAIE---VSETPNHVFYSNRSACYASLKKFPEALND 61

Query: 386 ASSALKLIPQGSMNSN 401
           A   +K+ P  S   N
Sbjct: 62  AEECVKINPTWSKGYN 77

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           +E+K++G  +F   DY  A   + K++    ++     V +SN   C   + ++ +AL+D
Sbjct: 6   DEYKQQGNAAFTAKDYGKAIDLFTKAIE---VSEAPNHVLYSNRSACYTSLKKFTDALND 62

Query: 386 ASSALKLIPQGSMNSN 401
           A+  +K+ P  S   N
Sbjct: 63  ATECVKINPSWSKGYN 78

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S +EFK++G  +F   DY  A   + K++    ++     V +SN   C     ++ EAL
Sbjct: 2   SADEFKQQGNAAFLAKDYVKAIDLFTKAIE---VSETPNHVLYSNRSACYASNKKFEEAL 58

Query: 384 SDASSALKLIPQGSMNSN 401
            DA   +K+ P  S   N
Sbjct: 59  KDAEECVKISPSWSKGYN 76

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (44%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK++G  +++   Y  A   YE+ +        +  + F N   C L++  YR  ++D
Sbjct: 75  ENFKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCIND 134

Query: 386 ASSALKLIP 394
              AL   P
Sbjct: 135 CKKALSFNP 143

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%)

Query: 328 FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDAS 387
           FK++G   ++   +  A + Y K LN       +    F+N   C L++  YR  + D S
Sbjct: 86  FKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIEDCS 145

Query: 388 SALKLIPQGS 397
            AL + P+ +
Sbjct: 146 KALSINPKNT 155

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK +G + F    +  A   Y K +        +    F+N   C+L++  YR  ++D
Sbjct: 81  ENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCIND 140

Query: 386 ASSALKLIPQG 396
              AL L P+ 
Sbjct: 141 CKHALTLNPKN 151

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 28/125 (22%)

Query: 316 NLTELERHSFEEF----KEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIII 371
           N+ EL +   E +    K++G   F+  DY  A + Y  +L  +    P   V +SNI  
Sbjct: 88  NIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYAL--VVKKDP---VFYSNISA 142

Query: 372 CRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVEN 431
           C + +G+  + + +++ AL+L P                    +SK +  +A A E +EN
Sbjct: 143 CYVSLGQLDKVVENSTKALELKPD-------------------YSKALLRRASANESLEN 183

Query: 432 YEKAL 436
           Y  A+
Sbjct: 184 YADAM 188

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 24/109 (22%)

Query: 328 FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDAS 387
            K+KG   F+  DY  A + Y+ +     LT     V +SNI  C + + +  + + +++
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYA-----LTLKKDPVFYSNISACYVSMNQLDKVVENST 163

Query: 388 SALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436
            AL+L P                    +SK +  +A A E +ENY  A+
Sbjct: 164 KALELKPD-------------------YSKALLRRASANESLENYPDAM 193

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 76/164 (46%), Gaps = 17/164 (10%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S +E+K++G  +F   DY  A   + K+++   ++     V +SN   C   + ++  AL
Sbjct: 4   SADEYKQQGNAAFVAKDYDKAIDLFSKAID---VSEQPNHVLYSNRSACYTSLKKFVNAL 60

Query: 384 SDASSALKLIPQ--------GSMNSNIPNLNPPKT-YKEFWSKIMNNKAVAFERVENYEK 434
            DA   +K+ P         G+ +  + +L+  +  YK+      +NKA A E +E   +
Sbjct: 61  KDAEECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELDASNKA-AQEGLEQVHR 119

Query: 435 ALETYQQLIEAGVTSS----KVLEARRQCQKAIALEKKPVSVAR 474
             E+ + + + G+T       ++E  ++  K   + K P  VA+
Sbjct: 120 TQESRRGMPDMGLTQMFNDPNLIENLKKNPKTAEMMKDPQLVAK 163

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 54/129 (41%), Gaps = 29/129 (22%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S +E KE G  +++   Y  A   +  +L S P T+  + + +SN     + +  Y EAL
Sbjct: 7   SSQELKELGNKTYKEKGYEQAVHYFTSAL-SQPSTN--KHILYSNRAAAHIGLKHYAEAL 63

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAF-------ERVENYEKAL 436
            D  + ++L P                    W K  +   VA+       E  EN++KAL
Sbjct: 64  EDGKNCVELAPN-------------------WDKGYSRVGVAYLGLQKLDEAEENFKKAL 104

Query: 437 ETYQQLIEA 445
           +  +Q + A
Sbjct: 105 QLNEQNVHA 113

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 4/69 (5%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386
           EFK +G ++ +T DY  A + Y +++    L   + +  FSN  +  LK+  ++  ++D 
Sbjct: 14  EFKNRGNDAIKTQDYPGAIELYTEAIK---LDDTVSIY-FSNRAMGHLKMDNFQSGINDC 69

Query: 387 SSALKLIPQ 395
             AL++ P+
Sbjct: 70  DKALEIDPK 78

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 46/110 (41%), Gaps = 24/110 (21%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386
           E K++G   F+  DY  A   Y+ +L       P   V +SN+  C + +   +EA+   
Sbjct: 88  ELKKRGNAYFKVKDYENAINYYKFALQ--LKNDP---VFYSNMAACYISLEHNKEAIEAC 142

Query: 387 SSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKAL 436
           S AL+L P                    +SK++  +A  +E +  +  AL
Sbjct: 143 SKALELNPD-------------------YSKVLLKRAAVYENIGKFADAL 173

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 32/133 (24%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRV----VSFSNIIICRLKVGEYRE 381
           +E K KG   F++ D   A + YE         + LR+    V +SNI  C   + +  +
Sbjct: 159 KELKNKGNQYFKSKDNENAIKYYE---------YALRLDQDPVFYSNISACYFAMNQLDK 209

Query: 382 ALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQ 441
            +  ++ AL+L P                    +SK +  +A A+E + N ++AL  +  
Sbjct: 210 VIESSNKALELKPD-------------------YSKALLRRANAYEALGNNKEALYDFSI 250

Query: 442 LIEAGVTSSKVLE 454
           L   G  S + LE
Sbjct: 251 LSLFGEYSGQYLE 263

>KLTH0H04554g Chr8 (405046..407877) [2832 bp, 943 aa] {ON} similar
           to uniprot|Q7LIB1 Saccharomyces cerevisiae YPL195W APL5
           Delta-like subunit of the yeast AP- 3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway suppressor of loss of
           casein kinase 1 function delta-like subunit of the yeast
           AP-3 adaptin component of the membrane-associated
           clathrin assembly complex
          Length = 943

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 70/173 (40%), Gaps = 12/173 (6%)

Query: 372 CRLKVGEYREALSDASSALKLIP-QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVE 430
           C   +GEY  ++S+    +KLI  Q  +   +  +      K F S    N  V    V+
Sbjct: 514 CLWCIGEYPSSISNGDDIIKLITRQRRLTPEVQQIAAQALIKIFSSWCNTNGNVPINDVK 573

Query: 431 NYEKALETYQQLIE--AGVTSSKVLEARRQCQKAIALEKKPVSVARKSETSIPKAAVTKK 488
           +      T Q+LI     ++SSK  E + +C + +   K       +++  +P       
Sbjct: 574 H------TIQELISFFESLSSSKSFEVQERCVEFLEFFKLCAESLEQNDEELPLLITEVL 627

Query: 489 PSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHD 541
           PS   A          L +VQ  N    DLE   FL  DEV +L++E    H+
Sbjct: 628 PSFFNAYELNPILHGTLKKVQ--NSLSIDLETP-FLSEDEVKNLLEEESSKHE 677

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 31/66 (46%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK +G + +R   Y  A + Y + ++       +    FSN   C L++  YR  ++D
Sbjct: 79  ENFKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVND 138

Query: 386 ASSALK 391
              AL+
Sbjct: 139 CKRALQ 144

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 30.8 bits (68), Expect = 3.6,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 325 FEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALS 384
           FE  KE+G   ++ G Y  A   Y++    L    P   V  SN  +  +K+GE+ +A+ 
Sbjct: 4   FERDKEEGNELYKQGLYRDAIGCYDR----LIAAQPQNPVGHSNKAMALIKLGEHAQAIE 59

Query: 385 DASSALKL 392
                L+L
Sbjct: 60  ACQQGLQL 67

>Suva_10.311 Chr10 complement(544348..545463) [1116 bp, 371 aa] {ON}
           YLR216C (REAL)
          Length = 371

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 35/86 (40%), Gaps = 25/86 (29%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEK-------------------SLNSLPLTHPLRVV 364
           + E  K  G   F+  +Y  A + Y K                   ++N L ++ PL   
Sbjct: 218 AIETVKNIGTEQFKKQNYSVALEKYTKCDKFLKEYFPENLPKEQIETINQLKVSIPL--- 274

Query: 365 SFSNIIICRLKVGEYREALSDASSAL 390
              NI IC LK+ +Y++ L  AS  L
Sbjct: 275 ---NISICALKLKDYKQVLVAASEVL 297

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 22/126 (17%)

Query: 324 SFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREAL 383
           S EE+K++G  +F   D+  A + +    N++  +     V +SN       + ++ EAL
Sbjct: 3   SAEEYKKEGNAAFVAKDFKRAVELF---TNAIQESEEPNHVLYSNRSGAYASLKKFDEAL 59

Query: 384 SDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLI 443
           SDA+  +K+                   K  WSK  N    A   + N ++A E+Y++ +
Sbjct: 60  SDATECVKI-------------------KADWSKGHNRLGAAHFGLGNLDEAEESYKKAL 100

Query: 444 EAGVTS 449
           E   T+
Sbjct: 101 ELDATN 106

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 55/128 (42%), Gaps = 13/128 (10%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK +G + ++   +  A + Y K +        +    ++N   C+L++  +R  +SD
Sbjct: 79  ENFKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISD 138

Query: 386 ASSALKLIPQ--------GSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFER----VENYE 433
             +AL   P+        G   + I      +   EF  KI N+   +FE     ++N E
Sbjct: 139 CKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNK-SFENLLNIIKNKE 197

Query: 434 KALETYQQ 441
           + +  Y++
Sbjct: 198 EEIRKYEE 205

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 32/70 (45%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK++G   ++   +  A + Y K +        +    F+N   C L++  YR  + D
Sbjct: 84  ENFKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIED 143

Query: 386 ASSALKLIPQ 395
            S AL + P+
Sbjct: 144 CSKALTINPK 153

>YLR380W Chr12 (878282..879508) [1227 bp, 408 aa] {ON}
           CSR1Phosphatidylinositol transfer protein with a
           potential role in regulating lipid and fatty acid
           metabolism under heme-depleted conditions; interacts
           specifically with thioredoxin peroxidase; may have a
           role in oxidative stress resistance
          Length = 408

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%)

Query: 374 LKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMN 420
           L+  ++ +  S+A+ A  L  +G ++  + NL+P  T K+FW  I N
Sbjct: 59  LQSSDHTQDSSEAAEAAHLYEKGKIHKALANLDPQTTKKQFWHDIKN 105

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 60/135 (44%), Gaps = 31/135 (22%)

Query: 309 VPATYSPNLTELERHSFEE-------FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPL 361
           + A+  P+L++L+ ++ E+        K+KG   F+      A + Y+ +L         
Sbjct: 83  ITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-----FKK 137

Query: 362 RVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNN 421
             V ++NI  C + + ++ + L + + AL+L P                    +SK++  
Sbjct: 138 DPVFYANISACYVSLNDFEKVLENCNKALELKPD-------------------YSKVLLR 178

Query: 422 KAVAFERVENYEKAL 436
           +A  +E +EN+  A+
Sbjct: 179 RANTYENMENFADAM 193

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 32/70 (45%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E FK++G   ++   +  A + Y K L        +    ++N   C L++  YR  + D
Sbjct: 84  ENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIED 143

Query: 386 ASSALKLIPQ 395
            S AL + P+
Sbjct: 144 CSKALTINPK 153

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 18/114 (15%)

Query: 326 EEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSD 385
           E  K +G  +    DY+ A + Y  ++  +P     + V ++N         +Y EA+ D
Sbjct: 104 EALKLEGNKAMAAKDYNLAVEKYNAAIKLVPT----KAVYYANRAAAYSSQEKYDEAIKD 159

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEF-WSKIMNNKAVAFERVENYEKALET 438
           A SA+K+ P           N  K Y    ++K    K+   E +E Y+KALE 
Sbjct: 160 AESAIKVEP-----------NWSKGYSRLGFAKFAQGKSQ--EALEAYKKALEV 200

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 4/66 (6%)

Query: 327 EFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDA 386
           E+K++G     + DY  A + Y K++         + + FSN  +  LK+  ++ AL D+
Sbjct: 11  EYKDQGNKFVASKDYGQAIEAYTKAIE----LDGCQSIFFSNRALANLKLDRFQSALEDS 66

Query: 387 SSALKL 392
           S A++L
Sbjct: 67  SKAIEL 72

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 57/142 (40%), Gaps = 30/142 (21%)

Query: 329 KEKGANSFRTGDYHAAFQNYEKSLNSLPLTHP--------------LRVVSFSNIIICRL 374
           KE G   F+  DY  AF  Y KSLN +    P              L++  + N+ +   
Sbjct: 244 KESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYLNLSLALF 303

Query: 375 KVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEK 434
            +  Y  A++ A+  L++        N+PN +  K Y          +  ++ R +  ++
Sbjct: 304 NLERYDSAITYATYLLEM-------DNVPNKDRAKAYYR--------RGNSYLRKKRLDE 348

Query: 435 ALETYQQLIEAGVTSSKVLEAR 456
           AL  Y+   E      KV+E R
Sbjct: 349 ALRDYRLCKEMN-PDDKVIEQR 369

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 11/103 (10%)

Query: 298 DFEAPALKTSNVPATYSPNLTELE------RHSFEEFKEKGANSFRTGDYHAAFQNYEKS 351
           D    +LK   +      NL  LE          E  K++G  +   G Y  A + Y ++
Sbjct: 49  DILPTSLKERTLKTILQENLNTLEATQKIHNEEAEALKKEGNEAMIEGQYEEAIKKYTEA 108

Query: 352 LNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIP 394
           +          V  +SN  +   K+G Y +A++DA+ A+ + P
Sbjct: 109 IQ-----FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDP 146

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 65/155 (41%), Gaps = 31/155 (20%)

Query: 328 FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRV--VSFSNIIICRLKVGEYREALSD 385
            K+KG   F+   Y  A + Y+ +L        L+   V +SN   C + + +  + + D
Sbjct: 98  LKDKGNECFKDQRYEEAIKFYDCALK-------LKEDPVFYSNRSACYVPLNKLEKVVED 150

Query: 386 ASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA 445
            ++ALKL P                    +SK +  +A A E + NY  A+     +   
Sbjct: 151 TTAALKLKPD-------------------YSKCLLRRATANESLGNYADAMLDLSAVSLY 191

Query: 446 GVTSSKVLE---ARRQCQKAIALEKKPVSVARKSE 477
           G  SS+ +E    R   ++A+ + K+ +S   K E
Sbjct: 192 GGYSSQTIEPVLERNMNKQAMQVLKQKLSGGEKHE 226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 65,396,568
Number of extensions: 2887620
Number of successful extensions: 9128
Number of sequences better than 10.0: 181
Number of HSP's gapped: 9405
Number of HSP's successfully gapped: 202
Length of query: 623
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 507
Effective length of database: 40,180,143
Effective search space: 20371332501
Effective search space used: 20371332501
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)