Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H14784g5.348ON51451427620.0
Kwal_34.159895.348ON50649213560.0
SAKL0G08910g5.348ON5054346095e-72
Suva_2.4865.348ON4154524096e-44
Skud_4.5835.348ON4154473894e-41
YDR317W (HIM1)5.348ON4144613772e-39
AGR348W5.348ON5424123631e-36
TDEL0E027905.348ON4114613571e-36
Ecym_81855.348ON4714133484e-35
Smik_4.5765.348ON4154523439e-35
ZYRO0F00550g5.348ON4154033421e-34
CAGL0H07161g5.348ON4244593272e-32
Kpol_1051.45.348ON4264543131e-30
TPHA0D020605.348ON4964823081e-29
KAFR0C018805.348ON3451582137e-18
TBLA0A031005.348ON3723641907e-15
KLLA0B10120g5.348ON3481641801e-13
KLTH0H00264g7.148ON2221141166e-06
Ecym_44797.148ON2241101094e-05
Kwal_47.188627.148ON2241021086e-05
TBLA0A105007.148ON2371081087e-05
NCAS0E02080singletonON2251001024e-04
Kpol_312.97.148ON2211231015e-04
ZYRO0D09548g7.148ON2251511006e-04
KNAG0L00925singletonON228104930.005
TBLA0F033107.148ON16192910.005
YER004W (FMP52)7.148ON23198870.032
NDAI0E036407.148ON225153860.035
Suva_5.917.148ON22999860.035
Skud_5.1037.148ON227168850.050
TPHA0L007607.148ON22680840.065
NCAS0E020907.148ON225145830.084
TDEL0H031107.148ON22477830.085
ADR005W7.148ON224103820.12
ZYRO0E07128g6.227ON440135830.16
Smik_5.1187.148ON23198800.20
KAFR0G027507.148ON22598790.28
Ecym_41618.406ON45557714.2
NCAS0C057504.38ON51139714.6
NDAI0A079703.369ON139028715.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H14784g
         (514 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...  1068   0.0  
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   526   0.0  
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   239   5e-72
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   162   6e-44
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   154   4e-41
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   149   2e-39
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   144   1e-36
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   142   1e-36
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   138   4e-35
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   136   9e-35
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   136   1e-34
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   130   2e-32
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   125   1e-30
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   123   1e-29
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...    87   7e-18
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    78   7e-15
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    74   1e-13
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    49   6e-06
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    47   4e-05
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    46   6e-05
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    46   7e-05
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      44   4e-04
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    44   5e-04
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    43   6e-04
KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}               40   0.005
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    40   0.005
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    38   0.032
NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON...    38   0.035
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    38   0.035
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    37   0.050
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    37   0.065
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      37   0.084
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    37   0.085
ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic hom...    36   0.12 
ZYRO0E07128g Chr5 (539098..540420) [1323 bp, 440 aa] {ON} simila...    37   0.16 
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    35   0.20 
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    35   0.28 
Ecym_4161 Chr4 (344715..346082) [1368 bp, 455 aa] {ON} similar t...    32   4.2  
NCAS0C05750 Chr3 complement(1181134..1182669) [1536 bp, 511 aa] ...    32   4.6  
NDAI0A07970 Chr1 complement(1829146..1833318) [4173 bp, 1390 aa]...    32   5.3  

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/514 (100%), Positives = 514/514 (100%)

Query: 1   MGTTCVGVDPENPPTTNSSPLQRLKGKSGSIFKPRQETPIHRQNAIRHDQILIWPRQPSP 60
           MGTTCVGVDPENPPTTNSSPLQRLKGKSGSIFKPRQETPIHRQNAIRHDQILIWPRQPSP
Sbjct: 1   MGTTCVGVDPENPPTTNSSPLQRLKGKSGSIFKPRQETPIHRQNAIRHDQILIWPRQPSP 60

Query: 61  VRSTDDLADGMVSLSTQRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSL 120
           VRSTDDLADGMVSLSTQRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSL
Sbjct: 61  VRSTDDLADGMVSLSTQRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSL 120

Query: 121 YPADLERFTKHNIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASW 180
           YPADLERFTKHNIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASW
Sbjct: 121 YPADLERFTKHNIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASW 180

Query: 181 EHTVRCKGFDLICGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENS 240
           EHTVRCKGFDLICGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENS
Sbjct: 181 EHTVRCKGFDLICGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENS 240

Query: 241 RDPHGDTCGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISH 300
           RDPHGDTCGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISH
Sbjct: 241 RDPHGDTCGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISH 300

Query: 301 WEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVV 360
           WEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVV
Sbjct: 301 WEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVV 360

Query: 361 TSFNSSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKF 420
           TSFNSSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKF
Sbjct: 361 TSFNSSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKF 420

Query: 421 TFLPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAA 480
           TFLPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAA
Sbjct: 421 TFLPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAA 480

Query: 481 HKVAFFAASRAIYSPDSASFVELIKSDEIEKMAN 514
           HKVAFFAASRAIYSPDSASFVELIKSDEIEKMAN
Sbjct: 481 HKVAFFAASRAIYSPDSASFVELIKSDEIEKMAN 514

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/492 (51%), Positives = 342/492 (69%), Gaps = 3/492 (0%)

Query: 22  QRLKGKSGSIFKPRQETPIHRQNAIRHDQILIWPRQPSPVRSTDDLADGMVSLSTQRVTD 81
            R + +SGSIFKPR+E    +Q AIRHDQILI P+Q S V+   +    ++++ + R  D
Sbjct: 18  HRFRDRSGSIFKPRREVTDQQQRAIRHDQILISPQQRSLVQIARNADSEVLNVPSNRTVD 77

Query: 82  NVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKSP 141
           + LI G TGLTG LI ANLAQPW+YLNATNDLQ K+ SL+P   ++  KH+ F+++ +SP
Sbjct: 78  STLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFS-DQLEKHHHFMRRTRSP 136

Query: 142 LCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKGGISRD 201
           LCN+L + KS+EVTKNL+C  RR + +E + LDGLDASWEH++  KG  ++C K  +S +
Sbjct: 137 LCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKENLSCE 196

Query: 202 CTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINVI 261
               +           + P   + +QLQ F++ L Y+NSRD HG+TC H LM++L +N+I
Sbjct: 197 EPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQLRVNII 256

Query: 262 CVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTRH 321
            +++ DSQ+WP LLT +FG+   KR LI +    E    W  P L  + T+VS+LGS   
Sbjct: 257 LIVEEDSQKWPMLLTRIFGKHASKRPLIVKDT--EEPILWTAPPLTQINTMVSSLGSKSF 314

Query: 322 QERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKL 381
           +++K  I RH+ DYELN+ LA  FC+ K RG  KKIV++TSFN+  LS+ S+YFQ+KL L
Sbjct: 315 EKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLML 374

Query: 382 EQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFDRK 441
           EQDL TKV  +D LVLLRPGPLVGNHT   Q+P   +K +F+P A+F +L  KK C +RK
Sbjct: 375 EQDLVTKVQALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKKNCIERK 434

Query: 442 VRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAIYSPDSASFV 501
           ++LLR++ +VG+R KLSEL ARLAYQ  C  L+  V  A+KVAF A+ RA++SPDSASFV
Sbjct: 435 LQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAVFSPDSASFV 494

Query: 502 ELIKSDEIEKMA 513
           ELIKSDEIEKMA
Sbjct: 495 ELIKSDEIEKMA 506

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  239 bits (609), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 165/434 (38%), Positives = 238/434 (54%), Gaps = 39/434 (8%)

Query: 99  NLAQPWIYLNATNDLQSKVDSLYPA-DLERFTKH-NIFVKKPKSPLCNILVRRKSIEVTK 156
           +LA+PW+YL  TND+Q K+  ++ A DL   +   N+     K     IL   KSIE+TK
Sbjct: 92  SLAEPWLYLGTTNDVQDKIQMMFEAGDLSSESNPPNV-----KRTFGQILRGEKSIEITK 146

Query: 157 NLYCLARRPIAVEGMPL--DGLDASWEHTVRCKGFDLICGKGGISRDCTLERNAAMY--- 211
           NL+C  R+ +A+  +P   + ++  WE+++  KG      K  IS      +   +    
Sbjct: 147 NLFCFNRK-LALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTLKFGKLVNSN 205

Query: 212 ELASTHNCPGREIILQLQSFSFKLVYENSRDPHGD---TCGHALMVKLNINVICVIDTDS 268
           E + T+ C       QLQ F +K  ++   DP      T    L++ L INVI +++ +S
Sbjct: 206 ENSITNQC-------QLQQFDYKFEFQR-EDPSMQNLRTRAQTLIISLKINVIQILEPNS 257

Query: 269 QRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTRHQERKSSI 328
           + WP LL   FG+      L  QGQ    +    FPSL  V TLVSALGST  +++KS +
Sbjct: 258 KLWPLLLHSTFGDTDTNVALHVQGQVPTPMI---FPSLSKVNTLVSALGSTTFEQKKSHV 314

Query: 329 PRHYVDYELNLTLAQEFCQRKAR-GTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYT 387
            R +VDY+LN  +A+EF    +  G +KK+VV+TSFN+  LS+ S YF TKLKLEQDL T
Sbjct: 315 SRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLAT 374

Query: 388 KVHGMDNLVLLRPGPLVGNHTPH---AQTPPATNKFTFLPAALFHILVLKKRCFDRKVRL 444
           ++  +D LV+LRPGPL+G+HTP       P +TN    L   L  +   KK C+D K   
Sbjct: 375 RIPELDELVILRPGPLIGSHTPEFIPGDPPKSTNG---LLKPLSTVCYYKKACYDHKRHF 431

Query: 445 LRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAIY----SPDSASF 500
           L+ + +VGL+ K++E+ ARL Y+  C  +        KVA  AA R I      P+S   
Sbjct: 432 LQSVTQVGLKTKMTEVFARLIYRSSCSWMFGYSVPVAKVAVVAAIRTIQKIQNDPESGGI 491

Query: 501 -VELIKSDEIEKMA 513
            V+LIKSDE++ M 
Sbjct: 492 RVQLIKSDELDVMV 505

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  162 bits (409), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 138/452 (30%), Positives = 209/452 (46%), Gaps = 63/452 (13%)

Query: 80  TDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIF----- 134
           TD++L+ G++GL G   L NL     Y+   +DLQ K+DSL   +       +IF     
Sbjct: 9   TDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCINRK 68

Query: 135 -VKKPKSPLCNI-LVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLI 192
            V + KS +  I  V  KSI      Y L  R          G + +   T     F   
Sbjct: 69  SVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSR----------GENETKRETCNSNTFCYD 118

Query: 193 CGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHAL 252
             + GI R+   +     +  A              + FS+ L Y   +D        + 
Sbjct: 119 DFEEGIIRNSMDKDKKGTFSFAYNR-----------KQFSYALHYACGKD-------ESF 160

Query: 253 MVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVGT 311
            +K N  V  ++   S  WP LL +VF G Q ++R  +      + +S    P+L  +GT
Sbjct: 161 GIKYNFIVTQLVIPQSTSWPKLLPEVFSGTQKLERFDV---DSRDYVSDKSLPALNSIGT 217

Query: 312 LVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTV 371
           +V ALGS+  + RKS +P  +VDY L+  LAQEF       T KK+VV+TSFN+  LS  
Sbjct: 218 MVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEF----TNTTDKKLVVITSFNNDFLSRT 273

Query: 372 SNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNH-------TPHAQTPPATNKFTFL 423
             YF+ K KLE DL   + + +  L++LRPGP+ G H           Q P  + +F + 
Sbjct: 274 FEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYY 333

Query: 424 PAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKV 483
           P    +IL  K++C       + ++ KVGLR +LSE+ A   Y+ P   L+       KV
Sbjct: 334 PR---YILKYKQQC-------ISEVRKVGLRTRLSEVIASSIYRMPGSALLGYSVPVSKV 383

Query: 484 AFFAASRAI--YSPDSASFVELIKSDEIEKMA 513
           ++ A+  AI   S ++   VE+I S +I+ +A
Sbjct: 384 SYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  154 bits (389), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 136/447 (30%), Positives = 198/447 (44%), Gaps = 53/447 (11%)

Query: 80  TDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIF----- 134
           TD +L+ G++GL G   L NL     Y+   +DLQ K+DSL     +     ++F     
Sbjct: 9   TDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIKEDVVLNKHVFCINRR 68

Query: 135 -VKKPKSPLCNI-LVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLI 192
            V + KS L  I  V  KSI      Y L  R     G      D  +            
Sbjct: 69  NVTEQKSFLKTIDYVNMKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDNF-------- 120

Query: 193 CGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHAL 252
             + G  R    E     +  A              + FS+ L Y   ++        + 
Sbjct: 121 --EEGFIRGAAYEGQKGNFSFAYNQ-----------KQFSYSLHYACRKE-------ESF 160

Query: 253 MVKLNINVICVIDTDSQRWPALLTDVFG-EQPMKRGLIPQGQGLEGISHWEFPSLGDVGT 311
            +K N  V  +I   S+ WP LL+ +F  EQ +++  I        ++    PSL D+GT
Sbjct: 161 GIKYNFTVTQLIIPPSESWPRLLSRIFSKEQKLEKFDIDNKTY---VADKSLPSLRDIGT 217

Query: 312 LVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTV 371
           +V  LGST  + R++ +P  +VDY L  +LAQEF    A  T K++VVVTSFN+ LL   
Sbjct: 218 MVCTLGSTSARVRRTQVPNSFVDYHLVFSLAQEF----ANTTNKRLVVVTSFNNDLLMRT 273

Query: 372 SNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALF-- 428
             YF+ K KLE DL   + + +  LV+LRPGP+ G H       P   K        F  
Sbjct: 274 FEYFRIKAKLENDLEEALPNKLKELVILRPGPMCGQH-----GDPVNVKLDVQENPTFSE 328

Query: 429 HILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAA 488
            IL   +     K + + +  KVGLR KLSEL A   Y+ P   L+       KV++  +
Sbjct: 329 RILYYPRYVLKYKKQYISEARKVGLRTKLSELIASSIYRMPGSALLGYSVPVSKVSYVTS 388

Query: 489 SRAI--YSPDSASFVELIKSDEIEKMA 513
            +AI   S ++   VE+I S +I+ +A
Sbjct: 389 LKAIEKRSKEAGPKVEMINSYQIDMIA 415

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  149 bits (377), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 132/461 (28%), Positives = 206/461 (44%), Gaps = 66/461 (14%)

Query: 72  VSLSTQRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKH 131
           +S S    TD VL+ G++ L G  IL NL    +Y+   +DLQ K+DSL           
Sbjct: 1   MSYSVNTFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLDSLSEI-------- 52

Query: 132 NIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKG--F 189
                            + ++ + K+++C+ RR I  E   +  +D     +V  +G  +
Sbjct: 53  -----------------KGNVVLNKHVFCVNRRCINEEKSFMKTIDYINMRSVTWQGGRY 95

Query: 190 DLICGKGGISRDCTLERNAAMY---ELASTHNCP------GREIILQLQSFSFKLVYENS 240
            L   K   +       N   Y   E     N P      G   +   + FS+ L Y   
Sbjct: 96  YLRSRKEKDTEKVPSSPNTFCYDNFEEGFIKNTPEERGKDGYSFVYNQKQFSYTLHY--- 152

Query: 241 RDPHGDTCGHALMVKL--NINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEG 297
                  CG    +++  N  V  +I   S+ WP LL  +F G Q +++  I     + G
Sbjct: 153 ------ACGKEKGIEIICNFTVTQLIIPRSETWPKLLPRIFSGTQKLEKFDIDNKNYVPG 206

Query: 298 ISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKI 357
            S    PSL D+ T+V +LGST  + R++ +P  + DY L   LAQEF       T K++
Sbjct: 207 RS---LPSLCDISTMVCSLGSTSARVRRTQVPSSFADYYLPFNLAQEF----TNTTNKRL 259

Query: 358 VVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTPHAQTPPA 416
           VV T+FN+  LS    YF+ K KLE DL   + + +  LV+LRPGP+ G H         
Sbjct: 260 VVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVILRPGPMCGQHGNPINVELG 319

Query: 417 TNKFTFLPAALF--HILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLV 474
               TFL    +  H L++ K+ +  + R      ++GLR KLSE+ A   Y+ P   L+
Sbjct: 320 KENSTFLEKIFYYPHYLLVYKKKYISEAR------RIGLRTKLSEIIASSIYRMPGSALL 373

Query: 475 SSVNAAHKVAFFAASRAI--YSPDSASFVELIKSDEIEKMA 513
                  KV++ A+  AI   S ++   +E+I S +I+ + 
Sbjct: 374 GYAVPVSKVSYVASLMAIERKSKEAGPKLEVISSYQIDMIV 414

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/412 (28%), Positives = 175/412 (42%), Gaps = 76/412 (18%)

Query: 81  DNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKS 140
           +N ++LG+TGLTGS +L +L  PWI                                  +
Sbjct: 171 ENYVLLGSTGLTGSQVLQDLITPWI---------------------------------GA 197

Query: 141 PLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKGGISR 200
           PL  +  R          +C +R+   VE + +  L  +W   V  +G   +  K  +  
Sbjct: 198 PLEGVTAR--------TFWCFSRKFQDVE-IDISNLPKTWTAIVEFEGEKHVIRKNDVRL 248

Query: 201 DCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINV 260
              L     M  L    +    +++L                    T G   +    INV
Sbjct: 249 IRHLSECGGMLGLKCHWDQYNWDVVL--------------------TTGE--VRNATINV 286

Query: 261 ICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTR 320
           + V+  DS+RWP L   +F       G +   +     S    P++ ++ TL+S LGST 
Sbjct: 287 VQVVQPDSRRWPDLFNKMFT------GGV---RTFNAYSEIYMPAVTEIETLISTLGSTS 337

Query: 321 HQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLK 380
            + RKS  PR +VDY LN+ +A+ F     +GT K +V+VTSFN   L  VS YF+TK +
Sbjct: 338 WEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQR 397

Query: 381 LEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFDR 440
           LE DL   V G+ +L +LRPGPL+G H       P TN  T     L      KK     
Sbjct: 398 LENDLTYDVPGLTHLTILRPGPLLGEHGSKPVISP-TNPDT--GNMLTRCYTYKKNVMRT 454

Query: 441 KVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAI 492
           +   L  + +VG   K++EL A+  Y  P   +V     A +VA  AA  A+
Sbjct: 455 QFNWLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEAL 506

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  142 bits (357), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/461 (27%), Positives = 211/461 (45%), Gaps = 80/461 (17%)

Query: 77  QRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVK 136
           Q+  D+ L  G++GL GSL L  L +  +YL    ++Q ++++    +L  F        
Sbjct: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNF-------- 56

Query: 137 KPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDG---LDASW-------EHTVRC 186
                              K +YC+ R+ I  + + LD    L A         +   R 
Sbjct: 57  ----------------RFNKLIYCINRK-IGYKNILLDNEQYLKADKLAPISFNKADYRF 99

Query: 187 KGFDLICGKGGISRDCTLERNAA-----MYELASTHNCPGREII---LQLQSFSFKLVYE 238
           +    IC       + +L  N +     +Y     HN     ++     +Q++  +   E
Sbjct: 100 EKITSICPSVKKHSNQSLVNNVSDESGTLY----IHNNSAGNVLKYHRSMQTYQVEYKSE 155

Query: 239 NSRDPHGDTCGHALMVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEG 297
           NS+          L++  N  ++ +   DS +W  LL D+F G   ++    P G     
Sbjct: 156 NSKK---------LLITFNFVILQIACPDSSKWCELLPDIFSGCVALRSEAEPDG----- 201

Query: 298 ISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKI 357
            +  + P L ++ T++  LG+     R+S   RHYVDYEL   LAQ F   +     K++
Sbjct: 202 -TTNKLPPLDEIPTMICTLGAG---SRQSKAKRHYVDYELTFKLAQSFNNCEG----KRL 253

Query: 358 VVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNHTPHAQTPPA 416
           V+VT+FN+ L+  +  YF+TK KLE DL  K+   +  LV+LRPGPLVG H       P 
Sbjct: 254 VIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVGEHGR-----PL 308

Query: 417 TNKFTFLPAA--LFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLV 474
           T   T   +   L  IL  K+ CF  K+ L ++  ++G R + SEL AR  Y+ P   ++
Sbjct: 309 TKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKPGSWML 368

Query: 475 SSVNAAHKVAFFAASRAI--YSPDSASFVELIKSDEIEKMA 513
                A K A+ AAS+A    S +++  VE+I S++++ +A
Sbjct: 369 GYCIPATKAAYVAASKATDEASDEASDPVEIITSEQMDHIA 409

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  138 bits (348), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 117/413 (28%), Positives = 176/413 (42%), Gaps = 77/413 (18%)

Query: 81  DNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKS 140
           DNV+ILG+TGLTGS +L     PW          S V  LY                   
Sbjct: 100 DNVIILGSTGLTGSQVLKGCMAPWT---------SGV--LY------------------- 129

Query: 141 PLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKGGISR 200
                      +++TKN++C  RR   V+   +  L  +W   V         G+  I R
Sbjct: 130 ----------DLKLTKNIWCFNRRLKTVD-FSISKLPPTWTAVVNY------GGEPHIIR 172

Query: 201 DCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINV 260
              L+    + E+       G E       +  KL  +  ++             + +NV
Sbjct: 173 KYDLKIKQHITEIG---KLDGLEFQWDQFDWELKLPTDEVKN-------------VTVNV 216

Query: 261 ICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGST 319
             +I  DS++W    +++F G +       P    +E       PS+  V TL+S LGS+
Sbjct: 217 FQIIQNDSKKWDKTFSELFTGNRK------PLNDRIEVY----LPSIDQVETLISTLGSS 266

Query: 320 RHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKL 379
             + RK   PR +VDY LN+ +A+ F   + +   K +V+VTSFN+  L  +S YF+TK 
Sbjct: 267 SWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQ 326

Query: 380 KLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFD 439
           KLE DL   V G+ +L +LRPGPL+G H       P   +       L+     K+    
Sbjct: 327 KLENDLTYDVPGLTHLTILRPGPLIGQHGKQIILAP---QLPVGSGVLYKCYAWKRSLLK 383

Query: 440 RKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAI 492
            K+  L  +  VG   K++EL A+  Y  P   +V     + KVA  AA  A+
Sbjct: 384 AKLHWLSQVKDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAM 436

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  136 bits (343), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 122/452 (26%), Positives = 206/452 (45%), Gaps = 63/452 (13%)

Query: 80  TDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPK 139
           TD +L+ G++GL G   L N+     Y+   +DLQ K++SL                   
Sbjct: 9   TDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEI---------------- 52

Query: 140 SPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKG--FDLICGKGG 197
                    +  + + K+++C+ RR I  E   +  +D     ++  K   + L      
Sbjct: 53  ---------KGDVVLNKHVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNEN 103

Query: 198 ISRDCTLERNAAMYE------LASTHNCPGRE---IILQLQSFSFKLVYENSRDPHGDTC 248
            ++      +   Y+      +  T +  G++   I    + FS+ L Y       G   
Sbjct: 104 ETKKIPSNPDTFCYDAFEEGFIKKTTDENGKDNFCIPYNQKRFSYALYY-----ASGKKE 158

Query: 249 GHALMVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLG 307
           G  ++ K  +  + +    S+ W  LL+ +F G Q +++        + G S    P+L 
Sbjct: 159 GFEIIYKFTVTQLII--PRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKS---LPNLR 213

Query: 308 DVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367
           D+ T+V  LGST  + R++ +P  +VDY L  +LAQEF       T K++V++TSFN+  
Sbjct: 214 DISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTN----TTDKRLVIITSFNNKF 269

Query: 368 LSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTPHAQTP-PATNKFTFLPA 425
           LST   YF+ K KLE DL   + +    L++LRPGP+ G H    +         TF   
Sbjct: 270 LSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQENLTFSDK 329

Query: 426 ALFH--ILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKV 483
            L++   L++ K+ +  +VR      K+GLR KLSEL A   Y+ P   L+       KV
Sbjct: 330 ILYYPRYLLMYKKQYISEVR------KIGLRTKLSELIASSTYRMPGSALLGYSVPVSKV 383

Query: 484 AFFAASRAI--YSPDSASFVELIKSDEIEKMA 513
           ++ A+  AI   S ++   +E+I S +I+ +A
Sbjct: 384 SYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  136 bits (342), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 110/403 (27%), Positives = 184/403 (45%), Gaps = 50/403 (12%)

Query: 77  QRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFV- 135
           Q   D++L+ G+TGL GSL L  L +  +YL+A NDLQSK++    +D+  FT +  F  
Sbjct: 11  QSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYC 70

Query: 136 ------KKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGF 189
                  + +SP    L+ R          C A  P+   G      + +       +  
Sbjct: 71  VNRKLNNEKRSPGNEYLMER----------CKAT-PLVFRGQDYYLHNNTSATPPASQSS 119

Query: 190 DLICGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSF--SFKLVYENSRDPHGDT 247
           +   G      D T++          T     R + L+ +    S++L Y  S+D     
Sbjct: 120 NPSLGNNVFEEDGTIQL---------TKTVDNRSVTLRFRQTRKSYQLEYI-SKDLKN-- 167

Query: 248 CGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLG 307
               L++  +  ++ ++  DS RW  LL  +F  +     L+P+            P L 
Sbjct: 168 ----LLITFHFTIVQLVFEDSTRWADLLPSIFSGEV---ELVPEESNHTSP---RLPHLD 217

Query: 308 DVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367
            V T++  LG      + S   R++V+Y+L   + Q F    A    K++V++TSFN+SL
Sbjct: 218 QVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNF----ASCEDKRLVIMTSFNNSL 273

Query: 368 LSTVSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAA 426
           +S +  YF+ K +LE DL  KV   +  LV+LRPGP+VGN   H        +  + P+ 
Sbjct: 274 VSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGN---HVNLNDRDLRLRYSPSL 330

Query: 427 LFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHP 469
              +   K+ C++ K   ++++ K+G + K SEL A+  Y+ P
Sbjct: 331 CEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRKP 373

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  130 bits (327), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 121/459 (26%), Positives = 202/459 (44%), Gaps = 89/459 (19%)

Query: 64  TDDLADGMVSLSTQRVTD-NVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYP 122
           T +L +   SLS ++  + N+L+ G+TGLTGSL+   L  P  YLN+  +L+  +     
Sbjct: 3   TTNLENTSGSLSREKTFEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIE 62

Query: 123 ADLERFTKHNIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEH 182
             LE  T                        +   LYC  R+     G PLD     +  
Sbjct: 63  EGLENVT------------------------IKTCLYCFNRKI----GEPLD----KYLK 90

Query: 183 TVRCKGFDLICGKGG-------------ISRDCTLERNAA----MYELASTHNCPGREII 225
           +     F   C  G              I +D     +A     +Y      N  G+  I
Sbjct: 91  SPSANSFGPFCFNGSQYHYNKGTCVPLDIDQDIETSNDATFDGFLYYKDKGKNVTGKNPI 150

Query: 226 ---LQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQ 282
                 + + + L Y ++        G+ L +    N I +I  +S  WP+++  +F ++
Sbjct: 151 SGEYYGKEYMYYLEYMSAE-------GNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFSDE 203

Query: 283 PMKRGLIPQGQGLEGISHWE-------FPSLGDVGTLVSALGSTRHQERKSSIPRHYVDY 335
                       +E IS  E       FP L D+ T++S +G+T ++ + S+   + +DY
Sbjct: 204 ------------VEAISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDY 251

Query: 336 ELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKVH-GMDN 394
           +LN+ L + F    +    K +++VTSFN++++STVS YF+ K+KLE  L   +   +  
Sbjct: 252 QLNVDLVKAF----SNTDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKT 307

Query: 395 LVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFDRKVRLLRDLMKV-GL 453
           L +LRPGPLVG H+        TN      ++LF   +L K+ F + +    D ++  G+
Sbjct: 308 LTILRPGPLVGRHSDIY----PTNDSILKNSSLFERALLHKKAFLQNMECFVDDIRTGGM 363

Query: 454 RAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAI 492
             K SE+ AR  Y+ P  +L+     A KVA+  +  A+
Sbjct: 364 SIKASEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAV 402

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  125 bits (313), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 108/454 (23%), Positives = 207/454 (45%), Gaps = 57/454 (12%)

Query: 77  QRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVK 136
           +  ++ + I+G+TGL     L +L     YL  +N+++ K++    +D+E  + H     
Sbjct: 13  KNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPR--SDIEIPSNHQ---- 66

Query: 137 KPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKG 196
                      +  +I++ KN++C+ RR   ++    D L++     ++ K  +    K 
Sbjct: 67  -----------KMNTIKIVKNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRLDKT 115

Query: 197 GISRDCTLERNAAMYELAS---THNC--PGREIILQLQSFSFKLVYENSRDPHGDTCGHA 251
               + + E +    E+ S     +C  P   +  +LQ    +L Y+          G+ 
Sbjct: 116 --PGETSYESSYLTNEIESGKINFDCEHPFSPLSFELQKKRAQLTYKAKE-------GNM 166

Query: 252 LMVKLNINVICVIDTDSQRWPALLTDVFGE-------QPMKRGLIPQGQGLEGISHWEFP 304
           L ++  I+V  +I   S +WP LL  +F         +  +  ++P G           P
Sbjct: 167 LQIQFEISVYHIIIPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTG----------LP 216

Query: 305 SLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFN 364
            L ++ T++S+LG    Q+         +D++L L L Q F    A    KK+VV+T+FN
Sbjct: 217 DLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTF----ANNNNKKLVVITTFN 272

Query: 365 SSLLSTVSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFL 423
           + ++S +  YF  K K+E+ L  +++  +  LV+LRPGP+VG     A  P         
Sbjct: 273 NKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMTDAINPEFNPILKKS 332

Query: 424 PAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKV 483
              +   ++LKK   D K+  L+     G+  +L+++ A+  Y+ P   ++     A KV
Sbjct: 333 DNLVEQSILLKKYLLDYKLATLKKYRSTGIAPRLTDILAKTMYRKPGTSVLGYCIPATKV 392

Query: 484 AFFAASRAIYSPDSASF----VELIKSDEIEKMA 513
           A  AA +AI    ++++    V++I S +I+++ 
Sbjct: 393 AKVAALKAIEPTIASTYSKPDVQIITSRQIDELV 426

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  123 bits (308), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 122/482 (25%), Positives = 209/482 (43%), Gaps = 73/482 (15%)

Query: 46  IRHDQILIWPRQPSPVRSTDDLADGMVSLSTQRVTDNVLILGATGLTGSLILANLAQPWI 105
           I+H + +I P  P             +  S  R +DN+L++G+TGL G  +L +     +
Sbjct: 11  IKHTEEIINPDVP-------------IESSIDRFSDNILVVGSTGLIGRNVLKSFFDTDL 57

Query: 106 YLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKSPLCNILVRRKSIEVTKNLYCLARRP 165
           Y+  + +L+  + S       R  +  + +KK    L     +R+S+E+ KN   + ++ 
Sbjct: 58  YIKHSQELKRLIASSEYDSTTRIKE--VTIKKTAYSLTR---KRQSVELFKNKTIVGQKL 112

Query: 166 IAVEGMPLDGL------------------DASWEHTVRCKGF--DLICGKG--------- 196
             VE   LDG                     S+  ++  K     L  GKG         
Sbjct: 113 KEVE---LDGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKE 169

Query: 197 --GIS----RDCTLERNAAMYELASTHNCPGREIILQLQSFS-----FKLVYENSRDPHG 245
             GIS        L+++ ++      +N     +ILQ Q +S     F L   +S     
Sbjct: 170 NQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQEYSNVECYFNLQQYDSSLIFA 229

Query: 246 DTCGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGI--SHWEF 303
            + G  L +  ++ +  +   DS  WP+LL  +F        L+P    +E I  ++ + 
Sbjct: 230 SSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNT---KLVPNKGLIENIDLTNEKL 286

Query: 304 PSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSF 363
           P L +V  ++++LGS  H  +  +     +DY+LNL+L   F       + KK++++TS 
Sbjct: 287 PLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSFNNT----SDKKVIIITSV 340

Query: 364 NSSLLSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTF 422
           N  + +  S Y   K+ LE+DL T + + ++ LV+LRPGPLVG        P  T     
Sbjct: 341 NKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKR 400

Query: 423 LPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHK 482
             ++L  ++  K+  FD KV LLR +   G     + + A+  Y+ P   L+     A K
Sbjct: 401 NDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRPGTSLLGYTIPASK 460

Query: 483 VA 484
           VA
Sbjct: 461 VA 462

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 91/158 (57%), Gaps = 8/158 (5%)

Query: 252 LMVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLGDVG 310
           L V  N+  + ++  +S++WP LL  +F GE  +K     + +    +  ++  ++ D+ 
Sbjct: 144 LNVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPEL--FKLANINDIS 201

Query: 311 TLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLST 370
           T+V  LG++    +K ++  + +DY+L   L + F   +     KK+++VTSFN++L+S 
Sbjct: 202 TVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTE----NKKVIIVTSFNNALISN 257

Query: 371 VSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNH 407
           +  YF+TKL+LE DL T +   +  L +LRPGP+ G H
Sbjct: 258 IFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKH 295

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 96/364 (26%), Positives = 149/364 (40%), Gaps = 69/364 (18%)

Query: 82  NVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKSP 141
           N +  G+TG+TG   L NL     YL A  D QS +D+L P D +               
Sbjct: 6   NYIFFGSTGMTGFTTLTNLLNINSYLQAK-DPQSAIDNL-PQDFQW-------------Q 50

Query: 142 LCNILVRRKSIEVTKNLYCLARR----PIAVEGMPLDGLDASWEHTVRCKGFDLICGKGG 197
            C+       + + KN++C+ RR    PI ++   +   + S  +  +            
Sbjct: 51  ACD---DSLDLYLVKNIFCINRRFFDSPIYLDEKIISS-NISINYKDKTFELQFQSNTNS 106

Query: 198 ISRDCTLERNAAMYELAST--------------HNCPGREIIL------------QLQSF 231
           +S + T E+N     L ST                 PG+E  +            QL   
Sbjct: 107 VSNNIT-EQNELKLPLVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQL 165

Query: 232 SFKLVYENSRDPHGDTCGHALMVKLN--INVICVIDTDSQRWPALLTDVFGEQPMKRGLI 289
           +FK +  N  +   D       +KLN  IN+   +   S  W  +L ++F    +    I
Sbjct: 166 NFKQINLNENENDNDNVQEKF-IKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKI 224

Query: 290 P-----QGQGLEGISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQE 344
                   Q     S+   P L D+  ++  LG+    ++K       +D++L   L+  
Sbjct: 225 NCTWNYIDQFTNEKSNIVLPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNW 278

Query: 345 FCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDL-YTKVHGMDNLVLLRPGPL 403
           F  R      KK+V+VT+FN+SLLS   NYF  K +LE+ L Y     +  LV+LRPGPL
Sbjct: 279 FSNRLG----KKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPL 334

Query: 404 VGNH 407
           +G H
Sbjct: 335 LGTH 338

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 87/164 (53%), Gaps = 12/164 (7%)

Query: 311 TLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTR-KKIVVVTSFNSSLLS 369
           +++S LGST  + +++ + R +VD  LNL + +          +  + +++TSFN+  +S
Sbjct: 135 SVISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDILSQKLSQYIIMTSFNNFAIS 194

Query: 370 TVSNYFQTKLKLEQDL-YTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTF--LPAA 426
            +  YF+ K +LE +  +   +   ++V+LRPGPL+G H        +T+ FT   L   
Sbjct: 195 RMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKHG-------STSSFTVPELDDR 247

Query: 427 LFH-ILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHP 469
           L H IL  KK  F   VR + +   VG+  + SEL A+ +Y  P
Sbjct: 248 LLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMP 291

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 58/114 (50%), Gaps = 9/114 (7%)

Query: 295 LEGISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTR 354
           LE  S+W      +   L S L +TR +  K +   + VD+++NL LA     R A+   
Sbjct: 52  LEDSSNWSAAVPENYDILFSGLATTRGEAGKENF--YKVDHDMNLQLA-----RSAKEKG 104

Query: 355 KKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHT 408
               VV S   +  +++  Y +TK +LE+D+     G +  ++LRPGPL+G  T
Sbjct: 105 YSTYVVVSSTGADENSMFYYMKTKGELERDILA--LGFERTIILRPGPLLGERT 156

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 62/110 (56%), Gaps = 14/110 (12%)

Query: 309 VGTLVSALGSTRHQERKSSIPRHY-VDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367
           +  L SALG+T+      SI   Y +D+ LNL +A+     K +G  K +V+V+S  +S+
Sbjct: 64  INVLFSALGTTKAAA--GSIENQYKIDHGLNLAVAK---AAKEKGC-KTLVLVSSLGASI 117

Query: 368 LSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVG----NHTPHAQT 413
            S +  YF+ K +LE+D+     G +  +LLRPG L+G    N+T   ++
Sbjct: 118 ESRLP-YFKMKGELERDVLA--LGFERTILLRPGVLLGERDSNYTGFGRS 164

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 304 PSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSF 363
           P   DV  + +AL +TR Q  K     ++VD++LNL LAQ   + K  G  K  V+V+S 
Sbjct: 64  PEKSDV--VFTALATTREQAGKEHF--YWVDHDLNLQLAQ---KAKENGC-KTFVLVSSA 115

Query: 364 NSSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVG 405
            +S  S    YF+TK ++E+D+       +  ++LRPG L G
Sbjct: 116 GASEKSPFF-YFKTKAEIERDIL--ALNFEKTIILRPGALFG 154

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 59/108 (54%), Gaps = 11/108 (10%)

Query: 298 ISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKI 357
           ISH  FP+   +  L++ L +T+ +    +  ++Y+D++LN+    +F ++         
Sbjct: 59  ISH--FPT-DKIDILMTGLATTK-KAAGGAQQQYYIDHDLNI----DFAKKAKENGCSTF 110

Query: 358 VVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVG 405
           VVV+S  +S     S +F  K+K E +   K    D+L++LRPGPL+G
Sbjct: 111 VVVSSAGAS---ADSRFFYLKMKGEIERDLKAIDFDHLIILRPGPLLG 155

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 7/100 (7%)

Query: 330 RHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV 389
           ++ +D++LNL LA+     KA+G    IVVV+S  +SL S  S Y + K ++E+D+    
Sbjct: 83  QYKIDHDLNLELAK---AAKAKGC-STIVVVSSDRASLDSRFS-YMRMKGEIERDIVAL- 136

Query: 390 HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFH 429
              D+ ++LRPG L+G   P       T+    +   +F+
Sbjct: 137 -DFDHTIILRPGILLGERDPQTAHKSFTHDAMRMIGGMFY 175

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 12/123 (9%)

Query: 308 DVGTLVSALGSTRHQERKSSIPRHY-VDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSS 366
           D   L S L +TR       +   Y +DY+LN+ LA+     K +G    +V+V+S  ++
Sbjct: 61  DTKYLFSGLATTRAA--AGGLDNQYKIDYDLNIELAK---AAKEKGC-STLVLVSSAGAN 114

Query: 367 LLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAA 426
             S ++ Y + K ++E+D+     G D+ ++LRPG ++G  T H +     N F      
Sbjct: 115 EHSWIA-YLKMKGEIERDMIK--LGFDHTIILRPGAILGERTSHHK--GFGNDFGVFVGR 169

Query: 427 LFH 429
           +F+
Sbjct: 170 MFY 172

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 68/151 (45%), Gaps = 41/151 (27%)

Query: 259 NVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGS 318
           NV  +++TDS +W  L                            FP  G V    SA G+
Sbjct: 43  NVKQIVETDSSKWAQL----------------------------FPETG-VKFYFSAFGT 73

Query: 319 TRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVV--VTSFNSSLLSTVSNYFQ 376
           TR     S+   + +D++LN+ LA+     K +G    ++V  V +  +S+L     YF+
Sbjct: 74  TRAAA-GSAENFYKIDHDLNVELAK---AAKTKGCTTMVLVSSVGANENSMLP----YFK 125

Query: 377 TKLKLEQDLYTKVHGMDNLVLLRPGPLVGNH 407
            K ++E+D+       D+ ++LRPGPL+G  
Sbjct: 126 DKGEIERDIL--ALDFDHTIILRPGPLLGRQ 154

>KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}
          Length = 228

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 12/104 (11%)

Query: 307 GDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTR--KKIVVVTSFN 364
           GD+  L+SALG+TR         ++ VD++L + +A     R AR  +  K + +V+S  
Sbjct: 67  GDLDVLLSALGTTRAAAGAEG--QYAVDHDLCVAVA-----RAARNDKNCKSVALVSSAG 119

Query: 365 SSLLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHT 408
           +    T S +F T++K + +         + V LRPG L+G  T
Sbjct: 120 AH---TDSRFFYTRMKGDTERDIAALAFPHAVFLRPGILLGQRT 160

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 51/92 (55%), Gaps = 15/92 (16%)

Query: 314 SALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSN 373
           +A GST+ Q R        +D+ LN+ LA+   + K  G    ++V +S  ++   +   
Sbjct: 9   AAAGSTQEQYR--------IDHNLNIHLAK---KAKENGCSTFVLVSSSLANA--DSRFT 55

Query: 374 YFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVG 405
           Y + K ++E+DL  +  G D+L++LRPG L+G
Sbjct: 56  YLKMKGEIERDL--EAIGFDHLIILRPGKLLG 85

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 53/98 (54%), Gaps = 11/98 (11%)

Query: 330 RHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV 389
           ++ +D++LNL LAQ     K +G  + IV+V+S  +   S    Y + K ++E+D+    
Sbjct: 86  QYKIDHDLNLQLAQA---AKEKGC-ETIVLVSSAGAHPDSRFG-YMKMKGEIERDVIAL- 139

Query: 390 HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAAL 427
               ++++LRPGPL+G  T   Q+    N    L AAL
Sbjct: 140 -DFKHIIILRPGPLLGERTNSKQSGFGGN----LTAAL 172

>NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON}
           Anc_7.148 YER004W
          Length = 225

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 72/153 (47%), Gaps = 13/153 (8%)

Query: 308 DVGTLVSALGSTRHQERKSSIPRHY-VDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSS 366
           ++  L ++L +TR           Y +D++LN+ LA+     K +G    IV+V+S  + 
Sbjct: 64  EINVLFTSLSTTRGA--AGGFDEQYKIDHDLNIELAK---AAKEKGC-STIVLVSSRGAH 117

Query: 367 LLSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAA 426
             S ++ Y + K ++E+D+     G D+ ++LRPG L+G    +  +       + +   
Sbjct: 118 ADSRMA-YTRMKGEIERDIIAL--GFDHTIILRPGILLGQRDSNGDSGFGGGIASMIGGF 174

Query: 427 LFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSE 459
           L++    K+  F        D+ KVG+   L E
Sbjct: 175 LYN---HKRNLFKGHSVEAEDVGKVGVHLALDE 204

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 330 RHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV 389
           ++ +D++LN+ LA+     K RG    IV+V+S  + + S    Y + K ++E+D+    
Sbjct: 86  QYKIDHDLNMQLARA---AKDRGC-DTIVLVSSAGAHVDSRFG-YMKMKGEIERDIIAL- 139

Query: 390 HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALF 428
               + ++LRPGPL+G  T   Q     N    L A ++
Sbjct: 140 -NFKHTIILRPGPLLGKRTNSKQNGFGGNLAAALGARVY 177

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 69/168 (41%), Gaps = 40/168 (23%)

Query: 260 VICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGST 319
           V+ V++ D+ +W  L+TDV   Q +   L        G+ +                   
Sbjct: 45  VVTVVEKDNSQWSELVTDVMHPQVLFTALATTRAAAGGLDN------------------- 85

Query: 320 RHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKL 379
                     ++ +D++LNL LA     R A+    + +V+ S   +   +   Y + K 
Sbjct: 86  ----------QYKIDHDLNLQLA-----RAAKEKGCETIVLVSSAGAHPDSRFGYMKMKG 130

Query: 380 KLEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAAL 427
           ++E+D+        + ++LRPGPL+G  T   Q+    N    L AAL
Sbjct: 131 EIERDVIAL--NFKHTIILRPGPLLGERTKSKQSGFGGN----LTAAL 172

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 37.0 bits (84), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 48/80 (60%), Gaps = 8/80 (10%)

Query: 327 SIPRHY-VDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDL 385
           S+   Y +D++LNL L +     KA+    K VV+ S + +   + + Y + K ++E+D+
Sbjct: 82  SLENQYKIDHDLNLQLLE-----KAKENGCKTVVLISSSGANEHSWAGYLKMKGEIERDV 136

Query: 386 YTKVHGMDNLVLLRPGPLVG 405
            TK+ G D+ ++LRPG L+G
Sbjct: 137 -TKL-GFDHTIILRPGVLLG 154

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 66/145 (45%), Gaps = 40/145 (27%)

Query: 263 VIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTRHQ 322
           +++TD+ +W               GLIP                 D   + +AL +TR  
Sbjct: 47  IVETDNSKWT--------------GLIPD----------------DTKFIFTALATTRGA 76

Query: 323 ERKSSIPRHY-VDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKL 381
                    Y +D++LN+ LA+     K +G    +V+V+S  +SL S  S Y + K ++
Sbjct: 77  V--GGFDNQYKIDHDLNVDLAK---AAKEKGC-STVVLVSSSGASLDSRFS-YMRMKGEI 129

Query: 382 EQDLYTKVHGMDNLVLLRPGPLVGN 406
           E+D+       D+ ++LRPG L+G+
Sbjct: 130 ERDILA--LDFDHTIILRPGILLGD 152

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 36.6 bits (83), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 44/77 (57%), Gaps = 7/77 (9%)

Query: 330 RHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV 389
           ++ +D++LN+ LA+   + K   T     V+ S   +   ++  Y + K ++E+D+    
Sbjct: 83  QYKIDHDLNIELAK-VAKEKGCST----FVLVSSGGAKEDSMFAYMKMKGEIERDILA-- 135

Query: 390 HGMDNLVLLRPGPLVGN 406
            G D+ ++LRPGPL+G+
Sbjct: 136 LGFDHTIILRPGPLLGD 152

>ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER004W
          Length = 224

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 10/103 (9%)

Query: 309 VGTLVSALGSTRHQERKSSIPRHY-VDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367
           V    S LG+TR       +   Y VD++LN+ +A+     K RG R   V+V++  +S+
Sbjct: 63  VDVFFSGLGTTRAN--AGGLENQYKVDHDLNIAVAK---AAKERGCRV-CVIVSAIGASV 116

Query: 368 LSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVGNHTPH 410
            + +  Y + K  +E+DL       +  V+LRPG L+G    H
Sbjct: 117 NARLP-YNKLKGDIERDLLA--LEFERTVILRPGVLLGERETH 156

>ZYRO0E07128g Chr5 (539098..540420) [1323 bp, 440 aa] {ON} similar
           to uniprot|Q01163 Saccharomyces cerevisiae YGL129C RSM23
           Mitochondrial ribosomal protein of the small subunit
          Length = 440

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 63/135 (46%), Gaps = 22/135 (16%)

Query: 10  PENPPTTNSSPLQRLKGKSGSIFKPRQETPIHRQNAIRHDQI-LIWPRQPSPVR--STDD 66
           P   PT  SS LQ L  K  + +  +Q   ++   A +  Q   ++P+  S VR  ST  
Sbjct: 65  PVEIPTFKSSELQSLLNKV-TFYSSQQYRSLYHLGAFKKSQFNELFPKPISFVREESTQK 123

Query: 67  LADGMVSLSTQR--------VTDNVLILGATGL---TGSLILANLAQPWIYLNATNDLQS 115
           L   + + S +R        V  +VL+  A      +G +IL N +QP+++LN  ND   
Sbjct: 124 LIGLLQNSSNKRFVLTGEPGVGKSVLLSQAQAYAAESGQIIL-NFSQPYLFLNGRNDF-- 180

Query: 116 KVDSLYPADLERFTK 130
                Y A+L+++ +
Sbjct: 181 ----FYDANLKQYVQ 191

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 11/98 (11%)

Query: 330 RHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV 389
           ++ +D++LNL LA     R A+    + +V+ S   +   +   Y + K ++E+D+    
Sbjct: 86  QYKIDHDLNLQLA-----RAAKDKGCETIVLVSSAGAHADSRFGYMKMKGEIERDVIAL- 139

Query: 390 HGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAAL 427
               + ++LRPGPL+G      Q+    N    L AAL
Sbjct: 140 -NFKHTIILRPGPLLGERENSKQSGFGGN----LAAAL 172

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 51/98 (52%), Gaps = 9/98 (9%)

Query: 308 DVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367
           ++  L +AL +TR      +  ++ +D++LN+ LA+   ++        IV+VT+  +  
Sbjct: 66  NIDVLFTALATTR--AVGGTGYQYKIDHDLNVELAKAAREKGC----STIVIVTAHGAH- 118

Query: 368 LSTVSNYFQTKLKLEQDLYTKVHGMDNLVLLRPGPLVG 405
               S +F TK+K E +      G +  ++LRPG L+G
Sbjct: 119 --ADSRFFYTKMKGEIERDISDLGFNRTIILRPGILLG 154

>Ecym_4161 Chr4 (344715..346082) [1368 bp, 455 aa] {ON} similar to
           Ashbya gossypii AGL108C
          Length = 455

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%)

Query: 190 DLICGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGD 246
           D I G+G +  D +L RN  +  + S +      +I  +  F+ KLV      PHG+
Sbjct: 30  DDIFGRGVLLVDGSLRRNEELVSIPSEYQLNFHSVIYHISKFNKKLVVPGVSFPHGE 86

>NCAS0C05750 Chr3 complement(1181134..1182669) [1536 bp, 511 aa]
           {ON} Anc_4.38
          Length = 511

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 82  NVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSL 120
           N+L +G +GL  S ++ +L       NAT D+ +K+DSL
Sbjct: 113 NILCVGQSGLGKSTLIDSLFNTNFNENATTDIDAKIDSL 151

>NDAI0A07970 Chr1 complement(1829146..1833318) [4173 bp, 1390 aa]
           {ON} Anc_3.369 YBR115C
          Length = 1390

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%)

Query: 73  SLSTQRVTDNVLILGATGLTGSLILANL 100
           SL T + T NV + GATG  GS IL+N+
Sbjct: 961 SLVTNQQTINVFVTGATGFLGSYILSNI 988

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,383,998
Number of extensions: 2196181
Number of successful extensions: 5454
Number of sequences better than 10.0: 43
Number of HSP's gapped: 5498
Number of HSP's successfully gapped: 53
Length of query: 514
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 400
Effective length of database: 40,409,475
Effective search space: 16163790000
Effective search space used: 16163790000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)