Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H10736g1.317ON81081039520.0
Kwal_14.25871.317ON80880828350.0
SAKL0D06974g1.317ON81381223810.0
AEL166C1.317ON80679021640.0
Ecym_62881.317ON80681121380.0
TDEL0D018601.317ON80980821380.0
KAFR0A017301.317ON82181420510.0
ZYRO0G20724g1.317ON81281620420.0
NCAS0A092201.317ON83181120410.0
KLLA0F01705g1.317ON78779120220.0
TBLA0F013301.317ON82781219590.0
Kpol_1035.261.317ON83582919490.0
NDAI0G057401.317ON85784519410.0
KNAG0C058301.317ON83082418610.0
TPHA0O014801.317ON82482118190.0
CAGL0J05236g1.317ON84283117830.0
Smik_10.1781.317ON83184016360.0
YJL062W (LAS21)1.317ON83084316280.0
Skud_10.1591.317ON83183116220.0
Suva_6.1381.317ON83084116120.0
Ecym_55594.28ON10143334921e-50
ZYRO0B01034g4.28ON10093374804e-49
Kwal_55.20667singletonOFF6023384686e-49
CAGL0G04015g4.28ON10193464787e-49
KAFR0I014104.28ON10163704771e-48
Kwal_YGOB_55.206644.28ON9563384733e-48
KLTH0E06094g4.28ON10163404724e-48
NDAI0H003204.28ON10344044644e-47
SAKL0H25542g4.28ON10134024645e-47
KNAG0J028204.28ON10173644592e-46
KLLA0C17534g4.28ON10053354573e-46
TDEL0F016904.28ON10053354539e-46
YLL031C (GPI13)4.28ON10173344493e-45
TPHA0K021804.28ON10283534484e-45
Kpol_478.14.28ON10093524441e-44
Smik_12.254.28ON10173354422e-44
Suva_10.414.28ON10173364395e-44
TPHA0F003104.28ON10263534371e-43
NCAS0C058004.28ON10113394342e-43
AGR126C4.28ON10133354315e-43
Skud_12.364.28ON10163364272e-42
TBLA0A085004.28ON10653474032e-39
SAKL0C05434g1.184ON10353511568e-10
AEL113C1.184ON9253781532e-09
Ecym_80941.184ON9263321405e-08
Skud_11.601.184ON9193371371e-07
NDAI0A009801.184ON9253321371e-07
Suva_11.581.184ON9193311352e-07
CAGL0M08448g1.184ON9213311325e-07
KLLA0B07249g1.184ON9193411309e-07
KLTH0F04884g1.184ON9223321282e-06
TPHA0A028001.184ON9203281272e-06
Kwal_33.138561.184ON9223591262e-06
TBLA0C058401.184ON9473621262e-06
TBLA0E014804.28ON10401901244e-06
Smik_11.641.184ON9453301245e-06
YKL165C (MCD4)1.184ON9193251227e-06
ZYRO0G18458g1.184ON9213401228e-06
KAFR0G005001.184ON9223281192e-05
Kpol_2001.281.184ON9193331182e-05
KNAG0C010801.184ON9313341182e-05
NCAS0B082601.184ON9243311173e-05
TDEL0C036901.184ON9203251121e-04
KLLA0F21714gna 1ON66983870.089
KLLA0A11374g1.444ON621175781.3
Kpol_543.105.477ON87688743.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H10736g
         (810 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...  1526   0.0  
Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {O...  1096   0.0  
SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {...   921   0.0  
AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON} S...   838   0.0  
Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar t...   828   0.0  
TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.3...   828   0.0  
KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {O...   794   0.0  
ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]...   791   0.0  
NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa] ...   790   0.0  
KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {...   783   0.0  
TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {O...   759   0.0  
Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {O...   755   0.0  
NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON} Anc_1...   752   0.0  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...   721   0.0  
TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {...   705   0.0  
CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa] ...   691   0.0  
Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062...   634   0.0  
YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}  LAS21Inte...   631   0.0  
Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {...   629   0.0  
Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON...   625   0.0  
Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} simila...   194   1e-50
ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar...   189   4e-49
Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa] {...   184   6e-49
CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highl...   188   7e-49
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....   188   1e-48
Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)...   186   3e-48
KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa] ...   186   4e-48
NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON...   183   4e-47
SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON} sim...   183   5e-47
KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4...   181   2e-46
KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON} sim...   180   3e-46
TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4....   179   9e-46
YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}  ...   177   3e-45
TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4...   177   4e-45
Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON} co...   175   1e-44
Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON...   174   2e-44
Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON...   173   5e-44
TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON...   172   1e-43
NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON} Anc_...   171   2e-43
AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON} ...   170   5e-43
Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON...   169   2e-42
TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]...   159   2e-39
SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa] ...    65   8e-10
AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON} S...    64   2e-09
Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar t...    59   5e-08
Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {O...    57   1e-07
NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {O...    57   1e-07
Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {O...    57   2e-07
CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa] ...    55   5e-07
KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {...    55   9e-07
KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {...    54   2e-06
TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {O...    54   2e-06
Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {...    53   2e-06
TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa] ...    53   2e-06
TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {...    52   4e-06
Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {O...    52   5e-06
YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON} ...    52   7e-06
ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} high...    52   8e-06
KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {O...    50   2e-05
Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]...    50   2e-05
KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {O...    50   2e-05
NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON} Anc_1...    50   3e-05
TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.1...    48   1e-04
KLLA0F21714g Chr6 (2020262..2022271) [2010 bp, 669 aa] {ON} cons...    38   0.089
KLLA0A11374g Chr1 complement(985471..987336) [1866 bp, 621 aa] {...    35   1.3  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    33   3.2  

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score = 1526 bits (3952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/810 (92%), Positives = 751/810 (92%)

Query: 1   MNKRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60
           MNKR       EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA
Sbjct: 1   MNKRLLVLLVLEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60

Query: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
           VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE
Sbjct: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180

Query: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240
           VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA
Sbjct: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300
           VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS
Sbjct: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300

Query: 301 PEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLS 360
           PEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLS
Sbjct: 301 PEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLS 360

Query: 361 ISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXX 420
           ISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNY           VVSSVALFFSW   
Sbjct: 361 ISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYLLLGIGFLTLLVVSSVALFFSWTSF 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLA 480
                                    IEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLA
Sbjct: 421 PSTFGLFLLLGTSLLLSLSTFGSSFIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLA 480

Query: 481 VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL 540
           VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL
Sbjct: 481 VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL 540

Query: 541 MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT 600
           MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT
Sbjct: 541 MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT 600

Query: 601 AAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSR 660
           AAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSR
Sbjct: 601 AAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSR 660

Query: 661 RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFA 720
           RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFA
Sbjct: 661 RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFA 720

Query: 721 PSIYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVF 780
           PSIYWSLSCLKILYSKSTQSKWETFFTSRLPS             SCVILRYHLFIWSVF
Sbjct: 721 PSIYWSLSCLKILYSKSTQSKWETFFTSRLPSFLYYCLFGCFLLGSCVILRYHLFIWSVF 780

Query: 781 SPKLCYYVSWNLFMNAIIAWFFEGTLVALL 810
           SPKLCYYVSWNLFMNAIIAWFFEGTLVALL
Sbjct: 781 SPKLCYYVSWNLFMNAIIAWFFEGTLVALL 810

>Kwal_14.2587 s14 complement(824261..826687) [2427 bp, 808 aa] {ON}
           YJL062W (LAS21) - putative membrane protein, a member of
           the major facilitator super family [contig 224] FULL
          Length = 808

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/808 (64%), Positives = 626/808 (77%), Gaps = 1/808 (0%)

Query: 1   MNKRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60
           M+K+       ++VAILTFSAGFFPQKSVL+GDA+FN++P+  R+++PKF K+VL+++DA
Sbjct: 1   MSKKLLILVVAQLVAILTFSAGFFPQKSVLKGDAEFNFQPDEQRQISPKFNKLVLIVIDA 60

Query: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFVFQKDMS F F+H LLN+G AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFQKDMSNFEFVHGLLNRGQAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
           VAEDD SSNLKEQDSWLRQF ++ K+IKFFGDDTWLKLFP EFFDETDGTNSFFVSDFEE
Sbjct: 121 VAEDDSSSNLKEQDSWLRQFHINNKRIKFFGDDTWLKLFPQEFFDETDGTNSFFVSDFEE 180

Query: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240
           VD NVTRHLP+QL +QDSWDVLILH+LGLDHIGHKGGAFS FM PK REMD VIEQ+YN+
Sbjct: 181 VDFNVTRHLPKQLATQDSWDVLILHFLGLDHIGHKGGAFSHFMAPKQREMDEVIEQVYNS 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300
           VGEDTLICVMGDHGMNDLGNHGGSSAGETSA L+FIS+LLE YEKPLAQ  +  P+ + +
Sbjct: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAGLIFISRLLEGYEKPLAQNHETFPIKTKN 300

Query: 301 PEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLS 360
            +Y+Y++KVNQID VP+I++LFN P+PKNSIGV++PD L+LLSP DA+ K++DNY QL +
Sbjct: 301 DDYSYVSKVNQIDLVPSISSLFNFPIPKNSIGVVMPDVLRLLSPKDAQLKLMDNYLQLTT 360

Query: 361 ISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXX 420
           ISG       D D I + MR++Q DLAK AT YNY            ++++A F      
Sbjct: 361 ISGDLMANSSDQDVIYQHMRDIQGDLAKNATKYNY-FMLGFGFSLLFITAIATFLLLKPT 419

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLA 480
                                    +EEEHQ+WWW +IAL G SY  AP E+ +HL +L 
Sbjct: 420 ISKPALVLLIGVSLLLSLSTFGSSFVEEEHQLWWWLAIALTGASYTQAPSEIKEHLIILL 479

Query: 481 VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL 540
            LRLIRGWNNSGQK+ YE+TL E+LKQ YQ++WLLIT TIFV QF+ + KG  +FQ SFL
Sbjct: 480 CLRLIRGWNNSGQKYTYEHTLLEILKQKYQLQWLLITLTIFVTQFRAKNKGLVSFQCSFL 539

Query: 541 MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT 600
           +S LCL+YKATWSIVN E+VP+WLQ + ++S+SIM G +  Q D  ++LVPMARLFF+  
Sbjct: 540 VSTLCLIYKATWSIVNGEKVPSWLQRVVMKSFSIMNGENNSQADLKESLVPMARLFFKTI 599

Query: 601 AAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSR 660
            AV  +E++ H++ P+  R L  I A+ +  LILQTS ANIPQFL + ILS KL S+W R
Sbjct: 600 LAVTLLEIVLHKWNPDRKRFLHNIQAYCTAFLILQTSPANIPQFLVYLILSEKLESVWRR 659

Query: 661 RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFA 720
           R+WS  +LM   +VLQ+L+FFQFGNTNSIATV+LTNAYNG+SENYNIYVVG LMCVSNFA
Sbjct: 660 REWSPSILMLAGIVLQNLAFFQFGNTNSIATVNLTNAYNGISENYNIYVVGFLMCVSNFA 719

Query: 721 PSIYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVF 780
           PSIYWSL+CLKILYS   + KW+ F  SR+PS             SCVILRYHLFIWSVF
Sbjct: 720 PSIYWSLNCLKILYSFPVKDKWKIFLASRMPSFLFYCIFGCFLLGSCVILRYHLFIWSVF 779

Query: 781 SPKLCYYVSWNLFMNAIIAWFFEGTLVA 808
           SPKLCYYVSWN+FMNA+I W  E TL+ 
Sbjct: 780 SPKLCYYVSWNIFMNAVIGWLVEATLLV 807

>SAKL0D06974g Chr4 complement(576570..579011) [2442 bp, 813 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 813

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/812 (55%), Positives = 566/812 (69%), Gaps = 3/812 (0%)

Query: 1   MNKRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60
           M KR       +IVAI TFS GFFPQKSVLQGDA F Y P+   R  P F K+VLV++DA
Sbjct: 1   MGKRSVILLLLQIVAIFTFSIGFFPQKSVLQGDASFLYLPQQQSRSDPVFRKLVLVVIDA 60

Query: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+FQ+  S+F F+H+LLN G AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFLFQESNSKFNFVHQLLNDGAAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
           VAEDD+SS+L +QDSWLRQF  + K+IKFFGDDTWLKLFP EFF E +GTNSFFVSDFE+
Sbjct: 121 VAEDDLSSSLNDQDSWLRQFHNNNKRIKFFGDDTWLKLFPLEFFQEYEGTNSFFVSDFEQ 180

Query: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240
           VDLNVTRHLP Q   +D WDVLILHYLGLDHIGHKGG+ S FMP K  EMD VI+QIY +
Sbjct: 181 VDLNVTRHLPHQFSHKDEWDVLILHYLGLDHIGHKGGSSSRFMPGKQEEMDNVIKQIYES 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300
           +  DTL+CVMGDHGMNDLGNHGGSS GETSAAL FIS  L++++ P+ Q+   +P+   S
Sbjct: 241 MDRDTLLCVMGDHGMNDLGNHGGSSNGETSAALTFISPKLKQFQPPVTQRNAHLPLKEHS 300

Query: 301 PEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLS 360
             Y YL +V QID VPT+A+LFNLP+PKNS+G++I DFL+L     A+ K+ DN+ QL++
Sbjct: 301 ENYKYLDEVQQIDLVPTLASLFNLPIPKNSLGIIITDFLQLFPGELAEIKITDNFHQLMN 360

Query: 361 ISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXX 420
           I G +     D    +E+M+ +QS LAK  TNYNY           +V+     F+    
Sbjct: 361 IIGETPSDTKDIQNSVEKMKRIQSTLAKATTNYNYQLISIGYIILLLVTVATTGFTLSLV 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLA 480
                                    +EEE Q+WWW S  ++ LS I  P+E+ +HL V  
Sbjct: 421 KLNYDSALLLGVSFTLGISTFGSSFVEEEQQLWWWISTGILLLSAILVPQEIINHLLVFT 480

Query: 481 VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGR--AKGFSAFQYS 538
            LRLIRGWNNSGQKF+Y+ TLYELLK H    W L   TIFV  F      +G  +F  S
Sbjct: 481 CLRLIRGWNNSGQKFIYDCTLYELLKVHTSWNWALNALTIFVTSFTCTLGERGPLSFVSS 540

Query: 539 FLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQ 598
           FL++ LCLVYK TWS+VN EQ+  WL+ +  +S  ++   + ++  ++D+LVPMARLFFQ
Sbjct: 541 FLLATLCLVYKGTWSVVNGEQISQWLKAVIRKSCILLLDDTDNRDMYTDSLVPMARLFFQ 600

Query: 599 VTAAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLW 658
           +T  +I   +  ++      +  ++IH+ +S +LILQTSSANIPQFL F IL  +L  L 
Sbjct: 601 ITLTLILFRIALNKLMDRKTKYFKDIHSIVSMILILQTSSANIPQFLVFWILQDRLKYLL 660

Query: 659 SRRQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSN 718
           +    S  ++M ++L+LQ+L+FFQFG TNSIATV+LTNAYNG+S +YNI+VVG LMC+ N
Sbjct: 661 TAYTPSDCLVMVISLILQNLTFFQFGGTNSIATVNLTNAYNGISGDYNIHVVGLLMCIGN 720

Query: 719 FAPSIYWSLSCLKILY-SKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIW 777
           FAPSIYWS++ L  L+ +K    KWE FF +RLP+             SCVILRYHLFIW
Sbjct: 721 FAPSIYWSMATLPTLFENKKNTDKWEIFFATRLPALMFYSIIGCFIMGSCVILRYHLFIW 780

Query: 778 SVFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809
           SVFSPKLCYYV+WN+FMN +++W  EG LVAL
Sbjct: 781 SVFSPKLCYYVTWNVFMNFMVSWCAEGLLVAL 812

>AEL166C Chr5 complement(322853..325273) [2421 bp, 806 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL062W
           (LAS21)
          Length = 806

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/790 (52%), Positives = 537/790 (67%), Gaps = 17/790 (2%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           +++A+L F+AGFFPQK VL+GDAQF Y  E  R + P F+K+VLV++DALR+DF+FQ+++
Sbjct: 12  QLLAVLIFAAGFFPQKKVLKGDAQFQYMAETQRALEPAFDKLVLVVIDALRADFLFQQNV 71

Query: 72  SEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLK 131
           S F F+H+LLN+G AWG+TAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD SSNLK
Sbjct: 72  SHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDSSSNLK 131

Query: 132 EQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQ 191
           +QDSW+ QF  H KKI FFGDDTWLKLFP EFF + DGTNSFFVSDFEEVD NVTRHLP 
Sbjct: 132 DQDSWISQFAKHGKKIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEEVDTNVTRHLPH 191

Query: 192 QLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMG 251
           +LQ +D WDVLILHYLGLDHIGHKGGA S FMPPKHREMDAVI QIY+ V   TL+CVMG
Sbjct: 192 ELQHKD-WDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQVDNRTLLCVMG 250

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQ 311
           DHGMNDLGNHGGSSAGETSA +VFISK+L  Y +P AQ G   PV +++ +Y + T++ Q
Sbjct: 251 DHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPV-TAAEDYQFFTRIQQ 309

Query: 312 IDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGGSTKKLG- 370
           +DFVPTIA+LFN+P+PKNS+GV + +F  LL    A TK+I+NY QL+ ++   T   G 
Sbjct: 310 VDFVPTIASLFNIPIPKNSLGVFVREFSSLLG-QHATTKIIENYHQLMQLAAKKTAARGN 368

Query: 371 -DPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXXXXXXXXXXX 429
            D D+++ EM++VQ+ LA+TATNYNY           +V++   +               
Sbjct: 369 DDIDSMLAEMKDVQATLARTATNYNYAMLFLGVGMLSIVTAATAYCYISSARLNEASVLM 428

Query: 430 XXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLAVLRLIRGWN 489
                           +EEEHQIWWW  IA+VG S+ + P     HL  L   RL+RGWN
Sbjct: 429 IAVTALLGSSVFGSSFVEEEHQIWWWIIIAVVGYSWATRPSCTPSHLVFLVCARLLRGWN 488

Query: 490 NSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFLMSVLCLVYK 549
           NSGQKF+Y++T+ ELLK H  ++WLL+  T+ VV   G  +      ++ L  +L  VYK
Sbjct: 489 NSGQKFMYDFTVAELLKSHPSIKWLLVCATLAVVALDGFTERPLLSIFNLLAGLLWFVYK 548

Query: 550 ATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVTAAVIAVEVI 609
             W+ VN E  P + Q +  ++ S++        D    LVP+ARLFF+VTAA++ +  I
Sbjct: 549 TCWANVNGEVSPTYAQTLVTKACSLLFA-GGTPWDDKQLLVPLARLFFKVTAAIVCMR-I 606

Query: 610 RHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLW--SRRQWSFPV 667
            +       + L E+    + +LI+QT+S NIP FL F I+   L ++      Q    +
Sbjct: 607 AYNVVFAKRKFLSELFPLFTIVLIMQTASQNIPLFLVFTIMRSSLRNILRVGYPQQRCEM 666

Query: 668 LMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSL 727
              ++L+LQ+LSFFQFG TNSIAT+ LTN+YNG+SENYNIYVVG LMC+ N AP+IYWSL
Sbjct: 667 FFVLSLILQNLSFFQFGGTNSIATIDLTNSYNGISENYNIYVVGLLMCIGNMAPAIYWSL 726

Query: 728 SCL--KILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLC 785
           + +    LYSK + ++       +L S             +C+ +RYHLFIWSVFSPKLC
Sbjct: 727 AAVVDHQLYSKKSYAQ------QKLSSMFFYSVNSLLLLVACICMRYHLFIWSVFSPKLC 780

Query: 786 YYVSWNLFMN 795
           Y + WN+ ++
Sbjct: 781 YLLGWNILIH 790

>Ecym_6288 Chr6 (540338..542758) [2421 bp, 806 aa] {ON} similar to
           Ashbya gossypii AEL166C
          Length = 806

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/811 (51%), Positives = 544/811 (67%), Gaps = 16/811 (1%)

Query: 4   RXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRS 63
           R       ++VAILTF+ GFFPQKSVL GD++F Y PE H+ M P+FEKMV++++DALRS
Sbjct: 4   RAISLLICQLVAILTFAIGFFPQKSVLTGDSEFLYMPEEHKPMEPQFEKMVVMVIDALRS 63

Query: 64  DFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123
           DF+FQ ++S F F+H L+NKG AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAE
Sbjct: 64  DFLFQANVSGFHFVHDLINKGEAWGYTAYSNPPTVTLPRLKGITTGSMPNFLDAILNVAE 123

Query: 124 DDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDL 183
           DD SSNLK+QDSWL Q   H K+I F+GDDTWLKLFPS FF  +DGTNSFFVSDFEEVD 
Sbjct: 124 DDTSSNLKDQDSWLSQLHKHGKRIHFYGDDTWLKLFPSHFFQRSDGTNSFFVSDFEEVDR 183

Query: 184 NVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGE 243
           NVTRHLP  L  Q+ WD+LILHYLGLDHIGHKGG+ S FM PKH EMDAVI+ IY+AV E
Sbjct: 184 NVTRHLPYDLSYQE-WDILILHYLGLDHIGHKGGSASQFMFPKHIEMDAVIKDIYDAVDE 242

Query: 244 DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEY 303
            TL+CV+GDHGMND+GNHGGSSAGETSAA+VFISK L  Y+ P AQ+G  +P+ +S  +Y
Sbjct: 243 RTLVCVLGDHGMNDMGNHGGSSAGETSAAMVFISKKLANYKAPEAQRGVQVPLINSDGDY 302

Query: 304 NYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISG 363
            YLT++ Q+D VPT+ +LFN P+P+NS+G++I DFL LL    A+ KV DN++QL+ ++ 
Sbjct: 303 QYLTRIQQVDIVPTLVSLFNFPIPQNSVGIIIKDFLPLLGTF-AEIKVKDNFRQLMKLAN 361

Query: 364 GSTKKLGDP-DAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXXXX 422
            + +  G   D ++E+M+  Q DLA  ATNYNY            ++ +     +     
Sbjct: 362 NTPEFAGASIDMLLEQMKITQDDLATAATNYNYIFLIIGLSILCFITIIISCEFYRTFKQ 421

Query: 423 XXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLAVL 482
                                  +EEEHQIWWW   A VG+S++  P    DH  V    
Sbjct: 422 TKILSLTVAISLSLGLSMFSSSFVEEEHQIWWWILTAAVGISWVMNPSLTWDHFLVSVCA 481

Query: 483 RLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFLMS 542
           RLIRGWNNSGQK++YE T+Y++L+++   +WL+   T+F+V F+        F  SF+  
Sbjct: 482 RLIRGWNNSGQKYIYENTIYQILERYPNTKWLINAATMFLVAFETVEFNLMTFVSSFVTV 541

Query: 543 VLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVTAA 602
            LCL YK  W++VN   VP WLQ     + S + G   D +   +ALVP+ARL FQ   A
Sbjct: 542 TLCLAYKGCWTLVNEGLVPNWLQAFVNMTCSFLIG--PDNM-LKEALVPLARLCFQSILA 598

Query: 603 VIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHIL----SRKLNSLW 658
            I   V  ++FK + P+ L+ I   I+T+L+LQTS +NIP FL F ++    +R L +L 
Sbjct: 599 SIVFRVCYNRFK-SSPKTLQSIIPLINTILVLQTSPSNIPLFLLFTVMKIAINRILTNLS 657

Query: 659 SRRQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSN 718
           S        +++  L++Q+ +FFQFG TNSIAT++LTN+YNGVS++YNIYVVG L  +SN
Sbjct: 658 SNDLSQISCILS--LIMQNFTFFQFGGTNSIATINLTNSYNGVSQSYNIYVVGFLTFISN 715

Query: 719 FAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWS 778
           FAP IYWSL+ +++       +K  T+   RLP              SC+ LRYHLFIWS
Sbjct: 716 FAPVIYWSLNLIEVY---QEPNKKHTYLVERLPILFHYSVTGVFLLISCLALRYHLFIWS 772

Query: 779 VFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809
           VFSPKLCYY++W++ +N ++   F   L+ +
Sbjct: 773 VFSPKLCYYIAWSILINGLLEHLFNPLLLTV 803

>TDEL0D01860 Chr4 (363606..366035) [2430 bp, 809 aa] {ON} Anc_1.317
           YJL062W
          Length = 809

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/808 (51%), Positives = 529/808 (65%), Gaps = 11/808 (1%)

Query: 1   MNKRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60
           M KR       ++VA+  F AGFFPQK VL+ +AQF  +P       P F K+VLV++DA
Sbjct: 1   MQKRLLALLISQLVAVSLFCAGFFPQKKVLKSEAQFIEEPALQNEAKPVFNKLVLVVIDA 60

Query: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+F+K  S+F FLH LLN+G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFLFEKSNSKFSFLHSLLNEGSAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
           VAEDD SSNL +QDSW+RQF  H KK++FFGDDTWLKLFP E+FDE DGTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLNDQDSWVRQFFSHGKKLRFFGDDTWLKLFPKEYFDEYDGTNSFFVSDFEQ 180

Query: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240
           VD NVTRHLP+QL +Q  WD LILHYLGLDHIGHKGG  S FMP K  EMD +++QIY  
Sbjct: 181 VDHNVTRHLPKQLNNQQEWDALILHYLGLDHIGHKGGPNSQFMPAKQEEMDEILKQIYEN 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSS 300
           V ++TLICVMGDHGMND+GNHGGSSAGETSAAL  ISK L +Y  P  Q G  +PV ++ 
Sbjct: 241 VDDETLICVMGDHGMNDVGNHGGSSAGETSAALALISKKLRRYAPPAEQIGVQLPVQNAD 300

Query: 301 PE--YNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQL 358
            E  Y YLT++ Q+D VPT+A LFN P+PKNS+G+LI + L+LL P  AK K+++N +QL
Sbjct: 301 GEVDYQYLTRIQQVDIVPTLAALFNFPIPKNSVGILIQETLQLLDPKLAKIKLLENLKQL 360

Query: 359 LSISGGS--TKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFS 416
            SIS G    +   + D + + M+++QSDL ++ATNYNY           + + + +   
Sbjct: 361 DSISNGHEVIQDEANIDQLYDLMKDIQSDLTRSATNYNYDLMGMGLALLVITTIITVLVG 420

Query: 417 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHL 476
                                        +EEEHQIWWW S      S +    E   H 
Sbjct: 421 SNRMEFGHPFFFTMIVSLLIGLSSFGSSFVEEEHQIWWWISTGATLASSVYLVDEKYTHF 480

Query: 477 TVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQ 536
            +L  LR+IR WNNSGQK   E T++++LK++   +W L    I +   +G +     F 
Sbjct: 481 VILVCLRIIRAWNNSGQKHFNENTVFDILKRNPTEQWYLNFFAIVICGLKGSSGDIVTFM 540

Query: 537 YSFLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLF 596
            SF+++ LCLVYK TW++VN E VP WL  +  +S SIM G + D  D   +L+P+A+LF
Sbjct: 541 CSFVLTALCLVYKVTWALVNRETVPHWLYEVAYKSCSIMMGDTTDVFD--KSLIPLAQLF 598

Query: 597 FQVTAAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNS 656
           F+  A  +AV V+    K  G +    I   I+ LLI Q+ S NIP F  F +L   LN 
Sbjct: 599 FRCFAGCVAVAVVAC--KMGGNKNSHAISTFITLLLIFQSQSPNIPLFFVFDVLKSSLNK 656

Query: 657 LWSRRQWSFPVLMT-VNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMC 715
           + S+R  S   +++ V+L+LQ+ +FF FG TNSIATV L+NAYNGVSENYNIY VG +MC
Sbjct: 657 IVSKRYNSDAYMISAVSLILQYFTFFHFGGTNSIATVDLSNAYNGVSENYNIYAVGFMMC 716

Query: 716 VSNFAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLF 775
           VSNFAPSIYWS     +LY   T  KW  FF S+L               +CV LR+HLF
Sbjct: 717 VSNFAPSIYWSTFTWNLLY--KTNKKWHNFFQSKLTFLMFNCISGCCLMFACVALRFHLF 774

Query: 776 IWSVFSPKLCYYVSWNLFMNAIIAWFFE 803
           IWSVFSPKLCYY +WN+FMN +I W  E
Sbjct: 775 IWSVFSPKLCYYATWNIFMNLVIGWILE 802

>KAFR0A01730 Chr1 complement(352169..354634) [2466 bp, 821 aa] {ON}
           Anc_1.317 YJL062W
          Length = 821

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/814 (48%), Positives = 536/814 (65%), Gaps = 22/814 (2%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           +++++L F+ GFFPQK+V+ G+A F+   +        F+K+VL+++DALRSDF+F +  
Sbjct: 12  QLLSVLLFAIGFFPQKNVMNGNATFSINKKLQEETKQPFKKLVLIVIDALRSDFLFDESS 71

Query: 72  SEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLK 131
           S F F+H  LN G AWGYTAYSNPPTVTLPRLKGITTGSTPNFLDA+LNVAEDD SSN+K
Sbjct: 72  SNFHFVHSKLNSGEAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDALLNVAEDDSSSNVK 131

Query: 132 EQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQ 191
           +QDSWL+QF     +++FFGDDTWLKLFP EFF++ +GTNSFFVSDFE+VDLNVTRH+P+
Sbjct: 132 DQDSWLKQFHSKGYRMRFFGDDTWLKLFPLEFFNDYEGTNSFFVSDFEQVDLNVTRHIPR 191

Query: 192 QLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMG 251
           QL+  + WDVLILHYLGLDHIGHKGGA S FMP KHREMD ++ ++Y+ + EDTL+ VMG
Sbjct: 192 QLEKTEDWDVLILHYLGLDHIGHKGGANSKFMPAKHREMDQIVGKLYDNLDEDTLLIVMG 251

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQ 311
           DHGMND GNHGGSSAGETSA LVF SK L K++ P+ Q    +P+ S+S +Y YLT+V Q
Sbjct: 252 DHGMNDAGNHGGSSAGETSAGLVFFSKKLSKFKIPIRQLNARLPITSNSSDYQYLTQVQQ 311

Query: 312 IDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSIS--------- 362
           +D VPT+A L+N+P+PKNS+GV+IPDFL+LL P    TK+++NY+QLL +S         
Sbjct: 312 MDLVPTLAALYNVPIPKNSVGVIIPDFLQLLDPNIIDTKLLENYKQLLELSKVEYDDELF 371

Query: 363 GGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXXXX 422
             +   L         M+ +Q  L    T Y+Y           V++ V   FS+     
Sbjct: 372 NLNVFDLEKRSECQRIMKTLQEKLIAATTEYDYTMLAIGCFMSLVLTLVMAIFSFFQMAS 431

Query: 423 XXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELG--DHLTVLA 480
                                  +EEEHQIWWW    + G  +ISA + +   +H  +L 
Sbjct: 432 NKYFFASVLLASILGFSCFGSSFVEEEHQIWWW---VITGCLFISAAKTMHYFEHSVILL 488

Query: 481 VLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL 540
            LRLIRGWNN+GQK VY Y + ++L+++  ++W L   T FV+   G       F  S  
Sbjct: 489 CLRLIRGWNNTGQKTVYPYVISKILEENSTLQWNLNALTFFVISLNGNQNSMWGFISSST 548

Query: 541 MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT 600
           + +LCL YKATW++VN E VP ++Q+I     S  +  +K   D+S  L+PMA  F    
Sbjct: 549 LGILCLAYKATWAVVNKEIVPWYIQNIMDNCASFFQDGNKK--DYSSTLIPMASFFLHSV 606

Query: 601 AAVIAVEVIRHQFKPNGPRL-LEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWS 659
           AA+I   ++  +F  + P   L+ I  +++ L++  +SS NIPQFL F I+ R   S   
Sbjct: 607 AAIIFFTLLWGKFNKHHPSFSLKCISKYVTILMMFLSSSVNIPQFLIFEIM-RSFISKIL 665

Query: 660 RRQWSFPVLMT--VNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVS 717
           ++ ++  + +T  ++L LQ+ +FFQFG TNSIAT+ ++NAY+G+SENYNIYV+G LM +S
Sbjct: 666 KKHYNSNIYLTSLISLCLQNFAFFQFGGTNSIATIDISNAYHGISENYNIYVIGVLMVLS 725

Query: 718 NFAPSIYWSLSCLKILYS--KSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLF 775
           NFAPSIYW++    I+Y   ++  +KW +F  S++P+             +CV+ RYHLF
Sbjct: 726 NFAPSIYWAMFSWDIIYDIKETNFNKWASFTKSKIPTSLFNCIVGLCLMLACVMFRYHLF 785

Query: 776 IWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809
           +WSVFSPKLCY+V WNLFMNAI  W  E  L+++
Sbjct: 786 VWSVFSPKLCYFVGWNLFMNAIFGWVLEVLLLSI 819

>ZYRO0G20724g Chr7 complement(1705835..1708273) [2439 bp, 812 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 812

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/816 (49%), Positives = 530/816 (64%), Gaps = 13/816 (1%)

Query: 1   MNKRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDA 60
           M ++       + VAI  F  GFFPQK+VL+G+A F  +     +  P F+K VL++VDA
Sbjct: 1   MLRQIITLLLAQFVAIFIFCCGFFPQKNVLKGNADFIIESSIQTQSKPVFDKFVLIVVDA 60

Query: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDFVF++ +S F F+H L+N G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILN
Sbjct: 61  LRSDFVFEESISNFKFVHSLINDGEAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
           VAEDD SSNLKEQDSWL+QF    KK++FFGDDTWLKLFP +FF E +GTNSFFVSDFE+
Sbjct: 121 VAEDDSSSNLKEQDSWLKQFVRQGKKMRFFGDDTWLKLFPLDFFQEYEGTNSFFVSDFEQ 180

Query: 181 VDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNA 240
           VDLNVTRHLP QL++Q  WDVLILHYLGLDHIGHKGGA S FMP KH EMD++++ IY  
Sbjct: 181 VDLNVTRHLPHQLETQKDWDVLILHYLGLDHIGHKGGARSVFMPGKHAEMDSIVKNIYEN 240

Query: 241 VGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVAS-- 298
           V E+TL+CVMGDHGMN++GNHGGSS GETS+ALV ISK L++++ PL Q+   +P+ +  
Sbjct: 241 VDENTLVCVMGDHGMNEVGNHGGSSPGETSSALVMISKKLKQFQPPLHQRDVHLPITTQF 300

Query: 299 --SSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQ 356
                 Y+YLTKV Q+DFVPT+A LFN+P+PKN++G++IPDFL+LL    A  KV DN+ 
Sbjct: 301 QDGEVNYDYLTKVQQVDFVPTLAALFNIPIPKNNVGIIIPDFLQLLDSKMAAIKVKDNFN 360

Query: 357 QLLSISGGSTK-KLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFF 415
           QL S+ G + + K    +   E+M+++Q  L K+ATNY Y           V+++VAL++
Sbjct: 361 QLASLLGRTLEVKNESINEEFEQMKDLQEVLTKSATNYKYPILAAGFGLLTVLTAVALWY 420

Query: 416 SWXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDH 475
                                         +EEEHQIWWW     + LS +   + LG H
Sbjct: 421 GISIMQLSKSSLLTIVLSLLLGIATFSSSFVEEEHQIWWWVITGALLLSQLYLRKALGLH 480

Query: 476 LTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAKGFSAF 535
                 +RLIRGWNNSGQK+ Y+ T++ELLK +  V+W L   TIF V   G      +F
Sbjct: 481 FVCFVCVRLIRGWNNSGQKYTYDNTIFELLKANPGVQWYLNILTIFTVGLGGSLGDRLSF 540

Query: 536 QYSFLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIM-KGVSKDQIDFSDALVPMAR 594
             SF +  LC  YK +W+IVN E VP W+Q +  +S     K  +  +  F  ALVPMA+
Sbjct: 541 ILSFSLCALCGSYKISWAIVNREDVPFWMQELAFKSCLFFTKEHTNPEEVFGKALVPMAQ 600

Query: 595 LFFQVTAAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKL 654
            FF+   A + V++   +       L     + +S LL+ Q+ +ANIP F  F +L   L
Sbjct: 601 FFFKYFIACLVVKISASKIGVCKANLF----SMLSILLMFQSPTANIPLFFIFEVLRAAL 656

Query: 655 NSLWSRRQWSFPVLMTV-NLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGAL 713
           + L++    S    +++ +L+LQ+ +F+QFG TNSIA++ L+NAYNGV ENYNIY+VG +
Sbjct: 657 SRLFTDYYGSNTYFVSLSSLLLQYFTFYQFGGTNSIASIDLSNAYNGVPENYNIYLVGFM 716

Query: 714 MCVSNFAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYH 773
           M VSNFAP+IYWSL   K    +    KW  +   ++P              +C + R+H
Sbjct: 717 MFVSNFAPTIYWSL--YKSTIPRPESRKWILYAEQKIPFLIFNCVVGVFLLIACYVFRFH 774

Query: 774 LFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809
           LFIWSVFSPKLCY+VSWN+FMN II    E  + A+
Sbjct: 775 LFIWSVFSPKLCYFVSWNIFMNIIIECGLESIVWAV 810

>NCAS0A09220 Chr1 complement(1823213..1825708) [2496 bp, 831 aa]
           {ON} Anc_1.317 YJL062W
          Length = 831

 Score =  790 bits (2041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/811 (49%), Positives = 525/811 (64%), Gaps = 22/811 (2%)

Query: 20  SAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDMSEFGFLHK 79
           + GFFPQK+VL+G A F+Y  E  R   P F+K+VLV++DALRSDF+F +  S F F+H 
Sbjct: 21  AIGFFPQKNVLKGLADFHYNSEQQRETKPVFQKLVLVVIDALRSDFLFDETNSHFHFIHS 80

Query: 80  LLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQ 139
            LN+G AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVS+ L +QDS L Q
Sbjct: 81  QLNEGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSTTLADQDSLLAQ 140

Query: 140 FRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQLQSQDSW 199
           F +  KKI FFGDDTWLKLFP ++F+E +GTNSFFVSDFE VD NV+RHL +QL+    W
Sbjct: 141 FHLQNKKINFFGDDTWLKLFPRDWFNEVEGTNSFFVSDFEVVDTNVSRHLTKQLKHNHDW 200

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLG 259
           DVLI+HYLGLDHIGHK GA S FMP KH EMD ++ Q+Y  + +DTL+ VMGDHGMN++G
Sbjct: 201 DVLIMHYLGLDHIGHKDGASSKFMPEKHIEMDNIVRQVYENIDDDTLLVVMGDHGMNEVG 260

Query: 260 NHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPE-YNYLTKVNQIDFVPTI 318
           NHGGSSAGETSA LVF+S  L+K E PL Q+  ++P+   + E + +LT V QID VPT+
Sbjct: 261 NHGGSSAGETSAGLVFLSNKLKKGELPLKQRHLNLPIKRQTDENFQFLTSVQQIDLVPTL 320

Query: 319 ATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGGSTK-----KLGDPD 373
           ATLFN+P+PKN++G++IP+FL+ L       K+++NY QLL +S G           D  
Sbjct: 321 ATLFNIPIPKNNVGIVIPEFLQFLRKDMINIKLMENYHQLLQLSKGQDLPNIPFDHMDSK 380

Query: 374 AIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXXXXXXXXXXXXXXX 433
            I+ +M+E+Q +L K ATNYNY           + ++V +F  +                
Sbjct: 381 NIMNKMKEIQDELTKNATNYNYSYLGRGYLLL-IFTTVTVFIVFILNQKSLYCATTIITI 439

Query: 434 XXXXXXXXXX---XXIEEEHQIWWWTSIALVGLS----YISAPRE--LGDHLTVLAVLRL 484
                          +EEEHQIWWW     +  S     IS P +  + +H  +    R+
Sbjct: 440 VISLLVGLSSFGSSFVEEEHQIWWWIITGSIMFSCIETLISNPSKSTVFNHFLIAVCARI 499

Query: 485 IRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGRAK-GFSAFQYSFLMSV 543
           IRGWNNSGQK VYE+ L  +LK HY   W LI TTI+ +  +   +  F +F   F M+ 
Sbjct: 500 IRGWNNSGQKHVYEFILTNILKNHYNTLWYLICTTIYYIGLKNTIRTDFLSFLGPFFMTT 559

Query: 544 LCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQID-FSDALVPMARLFFQVTAA 602
           LC VYK  W+IVNNE VP W   I   +  I+  V     D F +AL+P+A LF+Q   A
Sbjct: 560 LCFVYKLDWAIVNNESVPEWFYVITKEASDILLKVGHSPKDAFKEALLPLATLFYQTFVA 619

Query: 603 VIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWS--R 660
           ++++ +I   F        ++I  +IS LLI Q+++ NIPQFL F  L + +  +     
Sbjct: 620 LVSIRIIFLVFFSRRKTFFDDISNYISLLLIFQSTATNIPQFLVFEFLKKSITKVLQNYH 679

Query: 661 RQWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFA 720
           ++     L  ++L+LQ  +FFQFG TNSIAT+ ++NAY+G+SENYNIY+VG  M +SNFA
Sbjct: 680 QENKNNYLPLISLILQSFTFFQFGGTNSIATIDISNAYHGISENYNIYLVGIFMTISNFA 739

Query: 721 PSIYWSLSCLKILYSK--STQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWS 778
           PSIYW +S   ILY++   + SKW  +F ++LP              +C ILRYHLFIWS
Sbjct: 740 PSIYWIISMWPILYAEIPESSSKWNIYFKNKLPLLVFNCIVGCCLLAACYILRYHLFIWS 799

Query: 779 VFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809
           VFSPKLCY++ WN+FMN ++ W  EGTLVAL
Sbjct: 800 VFSPKLCYFLGWNVFMNFVVGWLVEGTLVAL 830

>KLLA0F01705g Chr6 complement(159469..161832) [2364 bp, 787 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 787

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/791 (52%), Positives = 514/791 (64%), Gaps = 39/791 (4%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           ++VA+  F  GFFPQK VL+ D++F   PE      P F+K+VLV++DALRSDF+FQKD 
Sbjct: 13  QLVAVFLFCGGFFPQKVVLKNDSKFIVNPEVQLASKPVFKKLVLVVIDALRSDFLFQKDS 72

Query: 72  SEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLK 131
           S+F FLH LLN G AWGYTAYSNPPTVTLPRLKGITTGS PNFLDAILNVAEDD SSNLK
Sbjct: 73  SDFEFLHGLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTSSNLK 132

Query: 132 EQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQ 191
           EQDS L+QF  H  K+ FFGDDTWLKLFP EFF E DGTNSFFVSDFEEVD NVTRH+P 
Sbjct: 133 EQDSLLKQFHTHHYKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPY 192

Query: 192 QLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMG 251
           Q++ Q +WDVLILHYLGLDHIGHKGG+ S FMP KHREMD+VI+QIY  +  DTL+ V+G
Sbjct: 193 QMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKIDGDTLMVVLG 252

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQ 311
           DHGMNDLGNHGGSS+GETSAAL F+SK L+KY+    QQ  ++PV  + P+Y YL +V Q
Sbjct: 253 DHGMNDLGNHGGSSSGETSAALAFLSKRLKKYQSSDIQQSSNVPVEDAHPDYKYLKEVEQ 312

Query: 312 IDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGGSTKKLGD 371
           ID VPT++ LFNLP+PKNS+GV+I + L+LL    A  KV DNY QL  +  G   +L  
Sbjct: 313 IDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQDNYLQLTKLKPGYEAQLEK 372

Query: 372 PDA--IIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXXXXXXXXXXX 429
             A  ++EEMRE+QS LA  ATNYNY           + + +   +++            
Sbjct: 373 KSAGTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTVWNF---QLSQEYIEH 429

Query: 430 XXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLAVLRLIRGWN 489
                           IEEEHQIWWW +I+++ L  IS     G  L VL+ LRLIRGWN
Sbjct: 430 VGTSVLLGISMFASSFIEEEHQIWWWITISVLLLMQISN----GKKLVVLSGLRLIRGWN 485

Query: 490 NSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQF------QGRAKGFSAFQYSFLMSV 543
           NSGQK++Y+  L+ LLK H  V W L   T   V F          K  S    SFL ++
Sbjct: 486 NSGQKYIYDNVLHTLLKSHTSVLWWLNVVTFLSVGFPFLRNKDESEKMVSLLSVSFL-AL 544

Query: 544 LCLVYKATWSIVNNEQVPAWLQHICLRSYSI-MKGVSKDQIDFSDALVPMARLFFQVTAA 602
             + YK  ++IVN ++VP+ L    LRS ++ +   +  + D S  LVP+AR+FFQ+   
Sbjct: 545 SSITYKICFAIVNGDKVPSGLYTFALRSCAMYLANENATESDISQCLVPIARIFFQICGV 604

Query: 603 VIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLWSRRQ 662
            I + +           +L ++ + I  +L+LQTSSANIP FL F IL+     +     
Sbjct: 605 SIIILLFMKYALNKSTNMLNKLLSVIKFVLLLQTSSANIPLFLIFEILTSVTPDIT---- 660

Query: 663 WSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVSNFAPS 722
              P+    +L LQ+L+FFQFG TNSIATV+LTNAYNGVS NYNIYVVG LM +SN+APS
Sbjct: 661 ---PIF---SLCLQNLTFFQFGGTNSIATVNLTNAYNGVSSNYNIYVVGVLMFLSNYAPS 714

Query: 723 IYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVFSP 782
           IYW+LS +   Y + T      + T                  +C+ LRYHLFIWSVFSP
Sbjct: 715 IYWALSLIPQSYKQKTLRLQHYYITGTC------------LMIACIALRYHLFIWSVFSP 762

Query: 783 KLCYYVSWNLF 793
           KLCYY +W+L+
Sbjct: 763 KLCYYAAWSLY 773

>TBLA0F01330 Chr6 complement(333140..335623) [2484 bp, 827 aa] {ON}
           Anc_1.317 YJL062W
          Length = 827

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/812 (48%), Positives = 514/812 (63%), Gaps = 17/812 (2%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           ++ A+  F  GFFPQKSVL G + F  +    +   P F K++LV++DALRSDF+F  ++
Sbjct: 13  QLAAVFIFCIGFFPQKSVLNGSSTFQIEKSLQQEAPPVFSKLILVVIDALRSDFIFDSNI 72

Query: 72  SEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLK 131
           S F F H LLN G+AWG+TAYSNPPTVTLPRLKG+TTGSTPNFLDAILNVAEDD SSNLK
Sbjct: 73  SNFPFTHSLLNNGNAWGFTAYSNPPTVTLPRLKGLTTGSTPNFLDAILNVAEDDNSSNLK 132

Query: 132 EQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQ 191
           +QDS L QF ++ KKI+FFGDDTWLKLFP ++F+E +GTNSFFVSDF +VD NVTRH+P+
Sbjct: 133 DQDSLLNQFYLNNKKIRFFGDDTWLKLFPLDYFEEHEGTNSFFVSDFTQVDNNVTRHIPK 192

Query: 192 QLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMG 251
           QLQ ++ WDVLILHYLGLDHIGHKGG  S FMP KH EMD +I Q+Y  +  D L+C++G
Sbjct: 193 QLQEKNDWDVLILHYLGLDHIGHKGGPRSKFMPTKHEEMDGIIRQLYENLDNDGLLCILG 252

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYN---YLTK 308
           DHGMN+LGNHGGSS GETSAA+VF S  L  +E P  Q+   +P+   S + N   YLT+
Sbjct: 253 DHGMNELGNHGGSSNGETSAAMVFASPKLSNFELPSKQKEIKLPITKPSEDENSFKYLTE 312

Query: 309 VNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKT-KVIDNYQQLLSISG---- 363
           + Q+DFVPTIATLFNLP+P+NS+G++I   LKLL  +  ++ K+ +NY+QLL ++     
Sbjct: 313 IQQVDFVPTIATLFNLPIPRNSVGIIIEPLLKLLRNSKLESIKLKENYKQLLDLAHIHST 372

Query: 364 -GSTKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWXXXXX 422
                 L D + +  +M  +Q DL ++ATNY Y           + + +           
Sbjct: 373 MDDISSLEDFE-LFTKMVSIQEDLTRSATNYFYEFLAAGIISSIIGTILYAVLITKDLKF 431

Query: 423 XXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHLTVLAVL 482
                                  +EEEHQIWWW    L+ LS    P     HLT+   +
Sbjct: 432 NGIEIISIIISLLIGLSMFGSSFVEEEHQIWWWIVTGLITLSLYLKPNTKLLHLTLFICV 491

Query: 483 RLIRGWNNSGQKFVYEYTLYELLK--QHYQVEWLLITTTIFVVQFQGRAKGFSAFQYSFL 540
           RLIRGWNNSGQK+VYE T+  +L   ++  ++W LI  TI  V F    K    F  S  
Sbjct: 492 RLIRGWNNSGQKYVYESTISNILSRIEYKDMQWYLILATITFVSFNDSMKNLPTFAMSLS 551

Query: 541 MSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFSDALVPMARLFFQVT 600
           + VL   +K +WSI N E+VP  ++ +      ++       I FS AL P+A+LFF  T
Sbjct: 552 LGVLVFSFKVSWSITNGEKVPFVIKDMARTVVKLLFPDESKDIIFSLALNPLAQLFFHCT 611

Query: 601 AAVIAVEVIRHQFKPNGP--RLLEEIHAHISTLLILQTSSANIPQFLAFHILSRKLNSLW 658
              + ++++  + K +     + +E+   ++ + I+QT  +NIP F  F I+   L  + 
Sbjct: 612 LGFLVIKLLIQKLKIDKTVDNIFDELTKVMNLVAIMQTRPSNIPMFCVFEIMKMILVKII 671

Query: 659 SRRQWSFPVLMTV-NLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNIYVVGALMCVS 717
                S P + ++ +LVLQH +FFQFG TNSIATV L+NAYNGVSENYNIY VG LM ++
Sbjct: 672 KHDYNSNPYVTSIASLVLQHFTFFQFGGTNSIATVDLSNAYNGVSENYNIYYVGLLMTIA 731

Query: 718 NFAPSIYWSLSCLKILYSKSTQS--KWETFFTSRLPSXXXXXXXXXXXXXSCVILRYHLF 775
           NFAPSIYW++    ILYS  T S  + + F  S++               SC ILRYHLF
Sbjct: 732 NFAPSIYWAVFSWDILYSYDTNSILRRQNFMKSKVLPLLFYFIIGCFLFLSCFILRYHLF 791

Query: 776 IWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLV 807
           IWSVFSPKLCYYV+W++FMN I+ W FEG LV
Sbjct: 792 IWSVFSPKLCYYVAWSIFMNCIVGWVFEGILV 823

>Kpol_1035.26 s1035 complement(61260..63767) [2508 bp, 835 aa] {ON}
           complement(61260..63767) [2508 nt, 836 aa]
          Length = 835

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/829 (47%), Positives = 537/829 (64%), Gaps = 38/829 (4%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           +++++L F  GFFP K+VL+GDA F    +A     P F K+VLV++DALRSDF+F +D+
Sbjct: 13  QLISVLIFCIGFFPSKNVLEGDAVFEISSDAQLNAKPAFNKLVLVVIDALRSDFLFDQDI 72

Query: 72  SEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLK 131
           S+F ++H+L N G+AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SSNLK
Sbjct: 73  SQFNYIHELSNNGYAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDSSSNLK 132

Query: 132 EQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQ 191
            QDSW  QF  H KKI+FFGDDTWLKLFP E F E +GTNSFFVSDFE+VD NVTRHL +
Sbjct: 133 NQDSWPMQFAKHGKKIRFFGDDTWLKLFPHEIFTEYEGTNSFFVSDFEQVDHNVTRHLEK 192

Query: 192 QLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGED--TLICV 249
           Q++ ++ WD LILHYLGLDHIGHKGG  S FM PKHREMD++I+ ++  VG+D  TLICV
Sbjct: 193 QIKEKNDWDALILHYLGLDHIGHKGGPTSKFMGPKHREMDSIIKNLFETVGQDENTLICV 252

Query: 250 MGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVAS--SSPE----Y 303
           MGDHGMN++GNHGGSS GETSA LV ISK L+ +E P  Q+G  +P+ S   +PE    Y
Sbjct: 253 MGDHGMNEVGNHGGSSPGETSAGLVLISKKLKNFEVPSDQKGVKLPIKSVNVAPEEDKQY 312

Query: 304 NYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISG 363
            +LT++ Q+D VPT++ LFN+P PKN++GV++P  L+LL P   + K+ +N++QL+ +S 
Sbjct: 313 KFLTQIQQVDIVPTLSALFNIPFPKNNVGVMMPSILELLDPKLFRIKLQENFRQLMIVSN 372

Query: 364 GSTKKL---------GDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVS-SVAL 413
               +           +   II EM+++Q +L  +ATNYN            +++ +++ 
Sbjct: 373 NKDIRQLYESYDFENTEIKDIISEMKDIQGELTSSATNYNVPLLYLGLGLIFILTLTISF 432

Query: 414 FFSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELG 473
           +F +                            +EEEHQIWWW    L+ +S I+ P +  
Sbjct: 433 WFYFSVLEVDFKNVLIVIISLLIGLSSFASSFVEEEHQIWWWIITGLITVSAINLPDQKI 492

Query: 474 DHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQ-VEWLLITTTIFVVQFQGRAKGF 532
            HL +   +R+IRGWNNSGQK+ Y+ T+  LL   Y+  +W L   TI  +  +      
Sbjct: 493 AHLVMFVCVRIIRGWNNSGQKYSYDRTISILLNTEYEDFQWYLNIATILYIMLKDSTDNL 552

Query: 533 SAFQYSFLMSVLCLVYKATWSIVNNEQVPAWLQ----HICL---RSYSIMKGVSKDQIDF 585
            +F +S+ +  +C++YK  W+I+N + VP  +     +IC    R YS+     +D    
Sbjct: 553 ISFMFSYNLGSVCILYKVCWTIINQDHVPEPIYKAAIYICRRLSRDYSL-----QDISVV 607

Query: 586 SDALVPMARLFF-QVTAAVIAVEVIRHQFKPNGPRLLEEIHAHISTLLILQTSSANIPQF 644
            + L+P+AR FF  V A VIA+           P  +++I   ++ LLI Q+ S+ I  F
Sbjct: 608 EENLIPIARFFFYSVLAIVIAIYGSAKLKLIKNP--IKDIQKTLTFLLIFQSPSSYIGLF 665

Query: 645 LAFHILSRKLNSLWSRRQWSFPVLM--TVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVS 702
           + + IL   L+SL    Q+S  V++  T++LVLQ+ +FFQFG TNSIAT  LTNAYNGVS
Sbjct: 666 MVYDILQSSLSSL-LVNQYSSNVMITSTISLVLQYFTFFQFGGTNSIATADLTNAYNGVS 724

Query: 703 ENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSK-STQSKWETFFTSRLPSXXXXXXXXX 761
           E+YNIY VG LMCVSNFAP+IYW++   K++Y++    +KW  F  ++LP          
Sbjct: 725 EDYNIYFVGFLMCVSNFAPAIYWAMFPWKVIYNQIKPNNKWNVFAENKLPIVYFNCIAGC 784

Query: 762 XXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVALL 810
               SC ILRYHLFIWSVFSPKLCYY +WN+FMN I+ W  E  +++++
Sbjct: 785 FLLLSCFILRYHLFIWSVFSPKLCYYATWNIFMNLIVGWVLEIAVLSMV 833

>NDAI0G05740 Chr7 (1421943..1424516) [2574 bp, 857 aa] {ON}
           Anc_1.317 YJL062W
          Length = 857

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/845 (46%), Positives = 520/845 (61%), Gaps = 61/845 (7%)

Query: 19  FSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDMSEFGFLH 78
           F+ GFFPQK+V++GD+QF        +  P F K+VL+++DALRSDF+F    S F F+H
Sbjct: 19  FATGFFPQKTVIKGDSQFQINATLQSQTRPTFNKLVLIVIDALRSDFLFDSQKSHFHFVH 78

Query: 79  KLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLR 138
             LNKG AWG+TAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD+SS L++QDS ++
Sbjct: 79  SQLNKGTAWGFTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDISSTLEDQDSLIK 138

Query: 139 QFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQLQSQDS 198
           QF M  K +KFFGDDTWLKLFP  +F E +GTNSFFVSDFE VD NVTRHLP+QL + D+
Sbjct: 139 QFYMQGKNLKFFGDDTWLKLFPHHWFSEFEGTNSFFVSDFEIVDKNVTRHLPEQLAANDA 198

Query: 199 WDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIY------NAVGEDTLICVMGD 252
            DVLILHYLGLDHIGHK GA S FM  KH EMD +I+ IY      N   ++TL+ VMGD
Sbjct: 199 -DVLILHYLGLDHIGHKDGASSKFMKHKHLEMDEIIKMIYESTQYSNEYDDNTLMVVMGD 257

Query: 253 HGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPE-----YNYLT 307
           HGMN++GNHGGSSAGETSA +VF+S+ L KY  P  Q   ++P+  +  E     + YL 
Sbjct: 258 HGMNEVGNHGGSSAGETSAGMVFLSEKLAKYSTPQEQMNFEVPLLPNLNEEGQNNFQYLN 317

Query: 308 KVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGGSTK 367
            + Q+D VPT+ATLF LP+PKNS+GV+IP+FL++L P    TK+ +NY QLL +S  S  
Sbjct: 318 SIQQVDLVPTLATLFGLPIPKNSVGVIIPEFLQMLDPQIISTKIKENYNQLLQLSKKSAN 377

Query: 368 KL-----GDPDAIIE----EMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFSWX 418
           +       D D   E    EM+ +Q++L KTATNYNY           + +       W 
Sbjct: 378 EYEYNFDSDLDVNQEILQNEMKNIQNELTKTATNYNYNLLIIGYSILVISTLFTSLLIWK 437

Query: 419 XXXXXXXXXX--XXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYIS--------A 468
                                        +EEEHQIWWW +   + +S +S        +
Sbjct: 438 DYSKKNIFQLIPITVISIMLGVSTFSSSFVEEEHQIWWWITTGFITVSLVSTLTLQNGFS 497

Query: 469 P-RELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQG 527
           P + +  HL +    R++RGW+NSGQK++Y++ L  +LK H  ++W L   TI ++ FQ 
Sbjct: 498 PLKTILYHLIIFGCARILRGWSNSGQKYIYDHVLSNVLKSHTNIQWYLNLLTILIIGFQK 557

Query: 528 RA-KGFSAFQYSFLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIMKGVSKDQIDFS 586
            +   F  F  +F +SVLC +YK  W+IVNNE VP W       + SI+ G +     F 
Sbjct: 558 DSTSNFFKFTITFFLSVLCFIYKVNWAIVNNENVPDWFYASTYEACSILIGPTATT--FQ 615

Query: 587 DALVPMARLFFQVTAAVIAVEVIRHQF---KPNGPRLL-EEIHAHISTLLILQTSSANIP 642
           D+L+PMA LF +     I   +I  +    K N   LL  +I  +I  LLI +TSS  I 
Sbjct: 616 DSLIPMANLFLKAIVTTIIGRIIYSKIFIGKNNKDSLLIPDIVKYIKLLLIFETSSTKIS 675

Query: 643 QFLAFHILSRKLNSLWSR--------------RQWSFPVLMTVNLVLQHLSFFQFGNTNS 688
           QFL F I    +N +W +                    ++  ++L+LQ+ +FFQFG TNS
Sbjct: 676 QFLIFEI----INHIWPKLLNLVKDTSDNDIANSIELSLIPLISLILQNFTFFQFGGTNS 731

Query: 689 IATVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSKST----QSKWET 744
           IAT+ ++NAY+G+SENYNIY VG  M +SNFAPSIYW++     LY+ ++     SKW  
Sbjct: 732 IATIDISNAYHGISENYNIYQVGLFMTISNFAPSIYWTIITWPTLYNSTSITNKNSKWII 791

Query: 745 FFTSRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEG 804
           F +++LP              SC ILRYHLFIWSVFSPKLCY++ WNLFMN+I+ +  EG
Sbjct: 792 FASNKLPILFFNCIVGCCLLASCYILRYHLFIWSVFSPKLCYFLGWNLFMNSIVGYIVEG 851

Query: 805 TLVAL 809
            +VAL
Sbjct: 852 LIVAL 856

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/824 (46%), Positives = 513/824 (62%), Gaps = 28/824 (3%)

Query: 1   MNKRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMA-----PKFEKMVL 55
           M  R       +++AI  F  GFFPQK VL+G A+FN  PE   R+      P F K +L
Sbjct: 1   MLGRLGAALILQLIAIFIFCLGFFPQKKVLKGQAEFN--PENLDRLGSNREEPVFNKFIL 58

Query: 56  VIVDALRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFL 115
           V+VDALRSDF+F    S F F+H  LN G AWG+TA+S+PPTVTLPRLKGITTGSTPNFL
Sbjct: 59  VVVDALRSDFIFDSHNSHFDFVHSKLNSGEAWGFTAFSSPPTVTLPRLKGITTGSTPNFL 118

Query: 116 DAILNVAEDDVSSNLKEQDSWLRQFRMH-QKKIKFFGDDTWLKLFP--SEFFDETDGTNS 172
           DA+LNVAEDD +S +KEQDSW+ QF  +  + I+FFGDDTWLKLF   +E F E +GTNS
Sbjct: 119 DALLNVAEDDQTSTIKEQDSWINQFLTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNS 178

Query: 173 FFVSDFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDA 232
           FFVSDF +VDLNVTRH+P QLQ +D WD LILHYLGLDHIGHKGGA+S FMP KH+EMD 
Sbjct: 179 FFVSDFTQVDLNVTRHIPTQLQEKDQWDTLILHYLGLDHIGHKGGAYSHFMPEKHKEMDN 238

Query: 233 VIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQ 292
           V++ +Y  V  DTLI VMGDHGMND+GNHGGSS GET A LVF+S+ L ++ KP +Q  +
Sbjct: 239 VLKDLYENVDPDTLIVVMGDHGMNDVGNHGGSSPGETHAGLVFLSEKLSRFPKPHSQY-E 297

Query: 293 DIPV-----ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADA 347
            IP+     A     + YLT+V Q+D VPT+ATLFN+P+PKNS+G+LI DF+ LL     
Sbjct: 298 TIPLNTPVTADGDKTFEYLTQVQQVDIVPTLATLFNVPIPKNSVGILIKDFIPLLDKHLR 357

Query: 348 KTKVIDNYQQLLSISGG-STKKLG-DPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXX 405
           + KV +NYQQL ++S    T  +G   D + E+MR VQ +L + AT+YNY          
Sbjct: 358 EAKVGENYQQLFTLSNSMETVNVGLTVDEMYEKMRAVQENLTRNATDYNYRALVPGYVIL 417

Query: 406 XVVSSVALFFSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWW--TSIALVGL 463
             V++  L  +                             +EEEHQ+WWW  T   L  L
Sbjct: 418 VCVTAYCLILAVQRMRLSGAFVALLGISFLTGISMFGSSFVEEEHQLWWWVITGSILFTL 477

Query: 464 SYI-SAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFV 522
           ++  S+       +T+   +RLIRGWNN+GQK  Y Y +  +L  H  ++W L     F+
Sbjct: 478 AFRQSSWHTTSSCITLSLAVRLIRGWNNTGQKTTYTYVIGNILAAHPTIKWNL-NVLAFL 536

Query: 523 VQFQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQVPAW-LQHICLRSYSIMKGVSKD 581
              Q   +   +F    ++ V+ L YK  W++VN E VP +  Q + +    I   V +D
Sbjct: 537 AVCQSNTESLMSFCGHIVLIVVALAYKINWALVNKENVPVYAFQFLQIIGRLIKVNVGED 596

Query: 582 QIDFSDALVPMARLFFQVTAAVIAVEVIRHQFKPNGPR-LLEEIHAHISTLLILQTSSAN 640
             +  +AL+P+AR+F+++  +   V+++  + +   P  L+++I  +   LL+  +S++N
Sbjct: 597 IENLEEALIPLARVFYRLVLSFTVVKIVLAKIRLQPPHSLIKDISKNFVVLLMFLSSTSN 656

Query: 641 IPQFLAFHILSRKLNSLWSRRQWS-FPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYN 699
           IPQFL F I+   +  +      S   +   V+L+LQ+ +FFQFG TNSIAT+ L+NAY+
Sbjct: 657 IPQFLIFEIMKVCITQIIKDEYGSDISITAIVSLILQNFTFFQFGRTNSIATIDLSNAYH 716

Query: 700 GVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSKST---QSKWETFFTSRLPSXXXX 756
           G+SENYNIY VG LM +SNFAP++YW++    I Y   T   +++W  F   +LP     
Sbjct: 717 GISENYNIYAVGWLMVISNFAPALYWAIYPWNITYVTPTGICKARWLRFAKGKLPITLFN 776

Query: 757 XXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAW 800
                    +CV LRYHLFIWSVFSPKLCYYV WNLFM +II W
Sbjct: 777 GLVGCCLLAACVALRYHLFIWSVFSPKLCYYVFWNLFMASIIGW 820

>TPHA0O01480 Chr15 complement(296533..299007) [2475 bp, 824 aa] {ON}
           Anc_1.317 YJL062W
          Length = 824

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/821 (48%), Positives = 518/821 (63%), Gaps = 37/821 (4%)

Query: 14  VAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDMSE 73
           +AI  F  GFFP K+VLQG  +FN++ E      P F K+V V++DALRSDF++++  S 
Sbjct: 12  IAITIFCVGFFPSKNVLQGSGEFNFEKELQLTTKPVFTKLVFVVIDALRSDFLYEEQNSH 71

Query: 74  FGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQ 133
           F F+H++LN G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSS+LK+Q
Sbjct: 72  FHFVHRVLNSGEAWGFTAFSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSSLKDQ 131

Query: 134 DSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQL 193
           DSWL QF  H K I+FFGDDTWLKLFP   F E +GTNSFFVSDFE+VDLNVTRHL +Q 
Sbjct: 132 DSWLMQFYKHNKNIRFFGDDTWLKLFPLNIFSEYEGTNSFFVSDFEQVDLNVTRHLEKQF 191

Query: 194 QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVG--EDTLICVMG 251
           + ++ WDVLILHYLGLDHIGHKGG+ S FM  KH EMD+++E IYN++G  EDTL+CVMG
Sbjct: 192 KEKEQWDVLILHYLGLDHIGHKGGSQSKFMKGKHEEMDSILEDIYNSIGDTEDTLLCVMG 251

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV------ASSSPEYNY 305
           DHGMN+ GNHGGSS+GETSA L  ISK  +K  KP  Q    +P+           +Y +
Sbjct: 252 DHGMNNGGNHGGSSSGETSAGLTMISKKFKKLAKPKDQINTVLPIKWNENLTEEEKDYKF 311

Query: 306 LTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSISGG- 364
           L+ V Q+DFVPT++ LFNLP+P NS+GVLIP+ L+LL P   +TK+ +N+ QL  +S   
Sbjct: 312 LSFVQQVDFVPTLSALFNLPMPINSVGVLIPELLRLLDPKLTRTKLKENFSQLTELSKSL 371

Query: 365 STKKLGDP--------DAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVALFFS 416
           +T+ + +         + II +M+ VQS+L K+ATNYN            ++S V L   
Sbjct: 372 TTRNIYNAIDFQNDTIEDIISQMQSVQSELMKSATNYN---MNAIYIAIILLSIVTLIII 428

Query: 417 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAPRELGDHL 476
                                        IEEEHQIWWW    +   S +        + 
Sbjct: 429 HKAFSNYKFNILPVAVSLIIGLSSFASSFIEEEHQIWWWLITGMCAFSLVYNSDSKFSNF 488

Query: 477 TVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHY-QVEWLLITTTIFVVQFQGRAKGFSAF 535
            V   LRLIRGWNNSGQK+ Y + L  LLK  Y   +W L T+TI    F+G    F +F
Sbjct: 489 IVFLCLRLIRGWNNSGQKYYYPFALSSLLKLKYVNYQWYLNTSTILYFMFKGSMNNFPSF 548

Query: 536 QYSFLMSVLCLVYKATWSIVNNEQVPAWLQH----ICLRSYSIMKGVSKDQIDFSDALVP 591
             SFL++ LCL+YK +W+IVN E VP  ++H    +C    S  + V+  Q+ F   L+P
Sbjct: 549 MSSFLLANLCLMYKVSWAIVNQEHVPDTIKHYVLVLCTHLMS-ARNVAPLQL-FESTLIP 606

Query: 592 MARLFFQVTAAVIAVEVIRHQFKPNGPRL---LEEIHAHISTLLILQTSSANIPQFLAFH 648
           +ARLFF     ++++ ++  +  P   RL   +  I   I  LLI QTS  NI  +L F 
Sbjct: 607 LARLFFCCVVILLSLTLVIGKLSPT--RLGNPVSNIKKIIIFLLIFQTSPENIGLYLLFG 664

Query: 649 ILSRKLNSLWSRR-QWSFPVLMTVNLVLQHLSFFQFGNTNSIATVSLTNAYNGVSENYNI 707
           IL   L  +  +    +  ++ T++LV+Q+ +F+QFGNTNSIAT+ LTNAYNGVSE+YNI
Sbjct: 665 ILETNLTDIIDKHYSGNTQLITTISLVMQYFTFYQFGNTNSIATIDLTNAYNGVSEDYNI 724

Query: 708 YVVGALMCVSNFAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPSXXXXXXXXXXXXXSC 767
           Y VG +M +SN+AP+IYWS+    I      + KW+ F   +                +C
Sbjct: 725 YFVGWMMSISNYAPAIYWSMFPWII---DDNKQKWKKFIERKNIILLFNCISGLFLLITC 781

Query: 768 VILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVA 808
            ILRYHLFIWSVFSPKLCYY+ WN+FMN II W  E TLV 
Sbjct: 782 TILRYHLFIWSVFSPKLCYYMMWNIFMNVIIGWILE-TLVT 821

>CAGL0J05236g Chr10 complement(504544..507072) [2529 bp, 842 aa]
           {ON} similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062w LAS21
          Length = 842

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/831 (45%), Positives = 513/831 (61%), Gaps = 46/831 (5%)

Query: 14  VAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDMSE 73
           +A+L F  GFFPQK VL G A  +     H R  P F+K+V+V+VDA+RSDF+F   +S+
Sbjct: 11  IAVLIFGCGFFPQKKVLDGHAALD---GTHAR-DPVFDKLVVVVVDAMRSDFLFDASISK 66

Query: 74  FGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQ 133
           F F+H+ L  G AWG+TA+SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDD SS+L  Q
Sbjct: 67  FHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDTSSSLLAQ 126

Query: 134 DSWLRQFRMHQ-KKIKFFGDDTWLKLFP--------SEFFDETDGTNSFFVSDFEEVDLN 184
           DSWL QFR +  K+I+FFGDDTWLKLFP           FDE +GTNSFFVSDF +VDLN
Sbjct: 127 DSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQTMFDEYEGTNSFFVSDFTQVDLN 186

Query: 185 VTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVG-E 243
           VTRH+ +QL+    WDVLILHYLGLDHIGHK G +S FM PKH EMD++I ++Y+ +  +
Sbjct: 187 VTRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYSRFMGPKHEEMDSIIRKLYDELDMQ 246

Query: 244 DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQ--GQDIPV----- 296
            TL+ +MGDHGMNDLGNHGGSSAGETSA +VF+S  L  Y KP  +Q   ++ P+     
Sbjct: 247 STLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSDKLAAY-KPSKEQSSAKEFPMKIPSL 305

Query: 297 -ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVI-DN 354
            A     ++YL K+ QID VPTI++LFN+ +PKN++GV+IP+FL+L      +  ++ +N
Sbjct: 306 NAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNNVGVIIPEFLQLFKDVSLQKAIVKEN 365

Query: 355 YQQLLSISGGSTKKLGDP-----DAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVS 409
           + QL  ++ G T+ + +      + +I+ M++VQ +LAKTAT+YNY           V++
Sbjct: 366 WNQLSGLTKGKTQIMEETKNFVIEDVIKNMKDVQENLAKTATDYNYPLLFIGCFLSIVIT 425

Query: 410 SVALFFSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLSYISAP 469
               +                               IEEEHQ WWW    LV LS ++  
Sbjct: 426 GTIYYRYARHVAININTSILIAIAALMGISVFGSSFIEEEHQFWWWIITGLVLLSMVNLN 485

Query: 470 -RELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQFQGR 528
                 H+ VL  LRLIRGWNNSGQK+ Y+  +  LLK +    W L   T+ VV    +
Sbjct: 486 FSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNVIANLLKGNIDALWWLNLITVTVVGLNLK 545

Query: 529 AK----------GFSAFQYSFLMSVLCLVYKATWSIVNNEQVPAWLQHICLRSYSIM--- 575
           +           GFS      L+S++  +YK  WSIVN E+VP       L + S++   
Sbjct: 546 SLRFGNHTVSLLGFSDLLSMGLLSMITFLYKVNWSIVNGERVPDLFYKWVLETASLIVED 605

Query: 576 KGVSKDQIDFSDALVPMARLFFQVTAAVIAVEVIRHQF--KPNGPRLLEEIHAHISTLLI 633
             + +++     AL+P+AR+FF++  AV+   ++  +F    +  + L  +  +++  L+
Sbjct: 606 ATLYREEDLIHTALIPLARIFFKLFFAVLVSRLMIQKFFQVSDISKSLAVVSRYVTIFLV 665

Query: 634 LQTSSANIPQFLAFHILSR-KLNSLWSRRQWSFPVLMTVNLVLQHLSFFQFGNTNSIATV 692
            QT S NI  FL F I++   ++ +  R Q  + + +   ++LQ  +FFQ G TNSIATV
Sbjct: 666 FQTPSHNIGLFLFFEIINEITVHIIRERYQSDYLLAVIFGIILQFFTFFQSGGTNSIATV 725

Query: 693 SLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYSKSTQSKWETFFTSRLPS 752
            L+NAYNGVSENYNIYVVG +MC+SNFAP+IYWS    +I Y+ +  S+W+T   ++ P 
Sbjct: 726 DLSNAYNGVSENYNIYVVGLMMCISNFAPTIYWSFYNWRITYANANSSRWQTLVAAKYPF 785

Query: 753 XXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFE 803
                        +C+ILRYHLFIWSVFSPKLCYY+ W +F+  I+ W  E
Sbjct: 786 IIIQSTIGCCLLLACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHWIPE 836

>Smik_10.178 Chr10 (309109..311604) [2496 bp, 831 aa] {ON} YJL062W
           (REAL)
          Length = 831

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/840 (42%), Positives = 497/840 (59%), Gaps = 51/840 (6%)

Query: 3   KRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALR 62
           K+       +++AI+ F   FFP+K VL G +Q +   +   +    F+K+V VI+DALR
Sbjct: 4   KQLTCITCAQLLAIVLFIFAFFPRKIVLTGISQQDADQDRDLQHNRPFQKLVFVIIDALR 63

Query: 63  SDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           SDF+F   +S F  +H+ LN G AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA
Sbjct: 64  SDFLFDSHISHFNNVHEWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVA 123

Query: 123 EDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVD 182
           +D  S++L E DSWL+QF  H   I+F GDDTWLKLFP E+FD TD T+SFFVSDF +VD
Sbjct: 124 QDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQEWFDFTDPTHSFFVSDFTQVD 183

Query: 183 LNVTRHLPQQL-QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV 241
            NVTR+LP ++ Q    WDV ILHYLGLDHIGHK G  S FM  KH+EMD++++ IY+ V
Sbjct: 184 NNVTRNLPGKIFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMGTKHQEMDSILKSIYDQV 243

Query: 242 -----GEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV 296
                 EDTLICV+GDHGMN+LGNHGGSSAGETSA L+F+S  L K+ KP +Q  + +P+
Sbjct: 244 LVHEHEEDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSKFVKPESQINRTLPI 303

Query: 297 -ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNY 355
            A+   ++ YL  V QID VPTIA LF +P+P NS+G++IPDFL+LL    A  K  +N+
Sbjct: 304 NAAPDRDFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASIK--ENF 361

Query: 356 QQLLSIS---GGSTKKLGDPDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVA 412
             L  +S   G  T      D I  +M  +Q  L K+ATNYNY           +++ +A
Sbjct: 362 MHLWKLSDHNGDFTLDDLTIDGIYTKMYSIQETLTKSATNYNYPLLALAFISFLIITIIA 421

Query: 413 LF-----FSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWW--TSIALVGL-S 464
           ++                                    IEEEHQ+WWW  T+ ++V L  
Sbjct: 422 IYQLQRNSGSSLWQPRTSPLSVLLISVILGISTFASSFIEEEHQLWWWIVTAFSVVPLFV 481

Query: 465 YISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQ 524
           Y      +     ++  +RLI+ WNNSGQKF+Y   +  LL Q+   +W L   T+  + 
Sbjct: 482 YNLNVFVVARWFIMMVCVRLIKFWNNSGQKFIYSNVMSNLLNQNPIWKWWLNLFTLLALI 541

Query: 525 FQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQ--VPAWLQHICLRSYSIMKGVSKDQ 582
                     F  + ++  LC  YK +W IVN  Q  +P ++  +  +            
Sbjct: 542 IASSRFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPIFMHDLLAK------------ 589

Query: 583 IDF---SDALVPMARLFFQVTAAVIAVEVIRHQFKP-NGPRLLEEIHAHISTLLILQTSS 638
           IDF      L+ +AR+FFQ  A V+   ++  + K  N   L+E+I  +I+ LLILQTSS
Sbjct: 590 IDFVPTESNLILLARVFFQAWAIVVVSRLVLTKLKVLNKNYLIEDIKVYITILLILQTSS 649

Query: 639 ANIPQFLAFHILSRKLNSLWSRRQWSFPVLMT----------VNLVLQHLSFFQFGNTNS 688
            NI QF+ F IL  ++   +  +    P L+T          V+L+LQ+ +FFQFG TNS
Sbjct: 650 QNIGQFIIFQILQSQIYYFF--KSLPAPFLLTPSSKVYLSNLVSLILQNFTFFQFGGTNS 707

Query: 689 IATVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILY-SKSTQSKWETFFT 747
           I+T+ L NAY+GVS +YN+  VG LM ++NFAPSIYWS+    + Y S S+Q K +TF  
Sbjct: 708 ISTIDLGNAYHGVSSDYNMCTVGMLMSIANFAPSIYWSMLPWSMNYDSTSSQVKIQTFIR 767

Query: 748 SRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLV 807
           S+LP+             +C+ LR+HLFIWSVFSPKLCY++ WN  M  +  W  E T++
Sbjct: 768 SKLPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNFVMGFLNGWITELTVL 827

>YJL062W Chr10 (317284..319776) [2493 bp, 830 aa] {ON}
           LAS21Integral plasma membrane protein involved in the
           synthesis of the glycosylphosphatidylinositol (GPI) core
           structure; mutations affect cell wall integrity
          Length = 830

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/843 (42%), Positives = 495/843 (58%), Gaps = 52/843 (6%)

Query: 3   KRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALR 62
           K+       +++AIL F   FFP+K VL G ++ +   +   +    F+K+V VI+DALR
Sbjct: 4   KQFTCLSCAQLLAILLFIFAFFPRKIVLTGISKQDPDQDRDLQRDRPFQKLVFVIIDALR 63

Query: 63  SDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           SDF+F   +S F  +H+ LN G AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA
Sbjct: 64  SDFLFDSQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVA 123

Query: 123 EDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVD 182
           +D  S++L E DSWL+QF  H   I+F GDDTWLKLFP ++FD  D T+SFFVSDF +VD
Sbjct: 124 QDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVD 183

Query: 183 LNVTRHLPQQL-QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV 241
            NVTR+LP +L Q    WDV ILHYLGLDHIGHK G  S FM  KH+EMD++++ IY+ V
Sbjct: 184 NNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEV 243

Query: 242 GE-----DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV 296
            E     DTLICV+GDHGMN+LGNHGGSSAGETSA L+F+S  L ++ +P +Q    +P+
Sbjct: 244 LEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPI 303

Query: 297 ASSSPEYN--YLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDN 354
            ++SP++N  YL  V QID VPTIA LF +P+P NS+G++IPDFL+LL    A  K  +N
Sbjct: 304 -NASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--EN 360

Query: 355 YQQLLSISGGSTKKLGD---PDAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSV 411
           +  L  +S    +   D    + I  +M  +Q  L K+ATNYNY           +++ +
Sbjct: 361 FMHLWKLSDHHGEVALDDFTAEDIYTKMYTIQETLTKSATNYNYPLLTLAFVGFLIITII 420

Query: 412 ALFFSWXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWWTSIALVGLS-- 464
           A++                                    IEEEHQ+WWW   A   +   
Sbjct: 421 AIYVLLRYSGPDFWQLRVSSLSVLLVSIILGVSTFASSFIEEEHQLWWWIVTAFSAVPLF 480

Query: 465 -YISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVV 523
            Y      +     ++A +R I+ WNNSGQKF+Y   +  LL Q+   +W L   T  V+
Sbjct: 481 VYRLNVLIIVRWFIMMACVRSIKFWNNSGQKFIYSNVMSNLLNQNPSWKWCLNMLTFLVL 540

Query: 524 QFQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQ--VPAWLQHICLRSYSIMKGVSKD 581
                      F  + ++  LC  YK +W IVN  Q  +P ++  +  +           
Sbjct: 541 IMASAGFQVLHFIVTTILVGLCFTYKISWEIVNGNQAEIPLFMHDLLAK----------- 589

Query: 582 QIDFSDA---LVPMARLFFQVTAAVIAVEVIRHQFKP-NGPRLLEEIHAHISTLLILQTS 637
            IDF+     L+ +AR+FFQ  A V+   ++  + K  N   L++++  +I+ LL+ QTS
Sbjct: 590 -IDFAPTESNLIVLARVFFQAWAIVVISRLVLTKLKVLNKNYLIKDMKVYITILLMFQTS 648

Query: 638 SANIPQFLAFHILSRKL---------NSLWSRRQWSFPVLMTVNLVLQHLSFFQFGNTNS 688
           S NI QFL F IL  ++          SL S  +  F  L  V+L+LQ+ +FFQFG TNS
Sbjct: 649 SQNIGQFLVFQILESQIFYFFQNIPTASLTSTSKIYFSNL--VSLILQNFTFFQFGGTNS 706

Query: 689 IATVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILY-SKSTQSKWETFFT 747
           I+T+ L NAY+GVS +YNIYVVG LM V+NFAP+IYWS+    I Y S   Q K +TF  
Sbjct: 707 ISTIDLGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYASIPAQVKLQTFIR 766

Query: 748 SRLPSXXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLV 807
           S+LP+             +CV+LR+HLFIWSVFSPKLCY++ WN  M  +  W  E  L+
Sbjct: 767 SKLPAFTYHCIFGTCLMTACVVLRFHLFIWSVFSPKLCYFLGWNFVMGLLNGWLPELALL 826

Query: 808 ALL 810
             L
Sbjct: 827 CAL 829

>Skud_10.159 Chr10 complement(299147..301642) [2496 bp, 831 aa] {ON}
           YJL062W (REAL)
          Length = 831

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/831 (42%), Positives = 492/831 (59%), Gaps = 41/831 (4%)

Query: 3   KRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALR 62
           K+       ++ AIL F   FFP+K VL G +Q +   +   +    F+K+V VI+DALR
Sbjct: 4   KQFTCLSCAQLFAILLFIFAFFPRKIVLTGISQQDPDEDRDLQHNRPFQKLVFVIIDALR 63

Query: 63  SDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           SDF+F   +S F  +H+ LN G AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LNVA
Sbjct: 64  SDFLFDAQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVA 123

Query: 123 EDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVD 182
           +D  S++L E DSWL+QF  H   I+F GDDTWLKLFP E+FD  D T+SFFVSDF +VD
Sbjct: 124 QDIDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFADPTHSFFVSDFTQVD 183

Query: 183 LNVTRHLPQQL-QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV 241
            NVTR+L ++L Q    WDV ILHYLGLDHIGH+ G  S FM  KH+EMD++++ IY+ V
Sbjct: 184 NNVTRNLQKKLFQEWAQWDVAILHYLGLDHIGHRDGPHSKFMGTKHQEMDSILKSIYDQV 243

Query: 242 GE-----DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV 296
            E     DTLICV+GDHGMN+LGNHGGSSAGETSA L+F+S  L ++ KP  Q+   +P+
Sbjct: 244 LEHENDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSRFAKPEPQETHILPI 303

Query: 297 -ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNY 355
             +   ++ YL  V QID VPTIA LF +P+P NS+G++IPDFL+LL    A  K  +N+
Sbjct: 304 NGTPDHDFQYLESVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKLASMK--ENF 361

Query: 356 QQLLSISGGSTKKLGDP---DAIIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSSVA 412
             L  +S        D    + I  +M ++Q  L ++ATNYNY             + VA
Sbjct: 362 MHLWRLSDHHDDVALDDFTINDIYTKMHDIQETLTRSATNYNYPLLAVAFVSFLFTTIVA 421

Query: 413 LF----FSW-XXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWW--TSIALVGL-S 464
           ++    +S                              IEEEHQ+WWW  T+ ++V L  
Sbjct: 422 VYQLQRYSGPSFCHLHISSLSVILVSVILGVSTFASSFIEEEHQLWWWIVTASSVVPLFL 481

Query: 465 YISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFVVQ 524
           Y S          ++A +RLI+ WNNSGQKF+Y   +  LL Q+   +W L ++T   + 
Sbjct: 482 YPSNAFVFARWFIMIACVRLIKFWNNSGQKFIYSNVMSNLLNQNPFWKWYLNSSTFLALI 541

Query: 525 FQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQ--VPAWLQHICLRSYSIMKGVSKDQ 582
                     F  + ++  LC  YK +W IVN  Q  +P ++Q +  +          D 
Sbjct: 542 IPSARSQLLHFIVTTILVGLCFTYKISWEIVNGNQAEIPPFMQGLLTK---------MDF 592

Query: 583 IDFSDALVPMARLFFQVTAAVIAVEVIRHQFKPNGPR-LLEEIHAHISTLLILQTSSANI 641
           +   + L+ +AR+FFQ  + V+   +   + K    R L+E++  +I+ LLI QTSS NI
Sbjct: 593 LPTENNLLLLARVFFQAWSIVVISRLALTKLKVLDKRYLIEDMKLYITVLLIFQTSSQNI 652

Query: 642 PQFLAFHILSRKLNSLWSRRQWSFPVLMT--------VNLVLQHLSFFQFGNTNSIATVS 693
            QF+ F IL  ++   +     S  +           V+L+LQ+ +FFQFG TNSI+T+ 
Sbjct: 653 GQFIIFQILQSQIYYFFQHLPTSLSLTSPSEVYLSSLVSLILQNFTFFQFGGTNSISTID 712

Query: 694 LTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILY-SKSTQSKWETFFTSRLPS 752
           L NAY+GVS +YNIYVVG LM V+NFAP+IYWS+    I Y S S+Q+K +TF  S++P+
Sbjct: 713 LGNAYHGVSSDYNIYVVGILMSVANFAPAIYWSMLPWSINYGSASSQNKLQTFIMSKMPA 772

Query: 753 XXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFE 803
                        +C+ LR+HLFIWSVFSPKLCY++ WNL M  +  W  E
Sbjct: 773 FTYHCIFGACLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGLLNGWLPE 823

>Suva_6.138 Chr6 complement(231325..233817) [2493 bp, 830 aa] {ON}
           YJL062W (REAL)
          Length = 830

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/841 (42%), Positives = 498/841 (59%), Gaps = 48/841 (5%)

Query: 3   KRXXXXXXXEIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPK--FEKMVLVIVDA 60
           K+       ++ AIL F   FFP+K VL G +Q     +  R +  +  F+K+V V++DA
Sbjct: 4   KQLMCLSCAQLFAILLFIFAFFPRKIVLPGISQQAPDQDQDRDLQHERPFQKLVFVVIDA 63

Query: 61  LRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           LRSDF+F   +S F  +H+ LN G AWGYT+++NPPTVTLPRLK ITTGSTP+F+D +LN
Sbjct: 64  LRSDFLFDSRISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLN 123

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
           VA+D  S++L E DSWL+QF  H   I+F GDDTWLKLFP E+FD TD T+SFFVSDF +
Sbjct: 124 VAQDVDSNDLSEHDSWLQQFIQHNNTIRFMGDDTWLKLFPHEWFDFTDPTHSFFVSDFTQ 183

Query: 181 VDLNVTRHLPQQL-QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYN 239
           VD NVTR+L  +L Q    WDV ILHYLGLDHIGHK G  S FM  KH+EMD++++ IY+
Sbjct: 184 VDNNVTRNLQGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMSTKHQEMDSILKTIYD 243

Query: 240 AVGE-----DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI 294
            V E     DTLICV+GDHGMN+LGNHGGSSAGETSA L+F+S  L ++ KP +Q    +
Sbjct: 244 QVLEHESDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLSQFVKPASQAENAL 303

Query: 295 PVASS-SPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVID 353
           P+  +   ++ YL  V QID VPTIA LF +P+P NS+G++IPDFL+LL    A  K  +
Sbjct: 304 PINGTLDRDFQYLDSVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLPNKVASMK--E 361

Query: 354 NYQQLLSISGGSTK-KLGDPDA--IIEEMREVQSDLAKTATNYNYXXXXXXXXXXXVVSS 410
           N+  L  +S    +  L D D   I  +M ++Q  L K+ATNYNY           +++ 
Sbjct: 362 NFMHLWRLSDHQEEVVLDDLDIGDIYSKMHDIQETLTKSATNYNYPLLSLAFASFLIITI 421

Query: 411 VALF-----FSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEEHQIWWW--TSIALVGL 463
           +A +                                    IEEEHQ+WWW  T+ A V L
Sbjct: 422 IATYQLQRHSGPTFCKLRTSSLSVLLVSVILGVSTFASSFIEEEHQLWWWIVTAFAAVPL 481

Query: 464 -SYISAPRELGDHLTVLAVLRLIRGWNNSGQKFVYEYTLYELLKQHYQVEWLLITTTIFV 522
            +Y      +     +LA +RLI+ WNNSGQKF+Y   +  +L ++   +W L + T  +
Sbjct: 482 FAYQLNASVIARWFIMLACVRLIKFWNNSGQKFIYTNVMSSILNRNPFWKWSLNSLTFLI 541

Query: 523 VQFQGRAKGFSAFQYSFLMSVLCLVYKATWSIVNNEQ--VPAWLQHICLRSYSIMKGVSK 580
           +              S ++  LC  YK +W IVN +Q  +P +LQ +  +          
Sbjct: 542 LLMASVRSQLLHCIMSTILVGLCFTYKISWEIVNGDQAEIPLFLQDLLTK---------I 592

Query: 581 DQIDFSDALVPMARLFFQVTAAVIAVEVIRHQFKP-NGPRLLEEIHAHISTLLILQTSSA 639
           D I     L+ +AR+FFQ  A V+   ++  + K  +   L+ ++  +I+ LLILQTSS 
Sbjct: 593 DFIPNESNLITLARVFFQAWAIVVISRLVLTKLKVLDQKYLIRDMKLYITILLILQTSSQ 652

Query: 640 NIPQFLAFHILSRKLNSLWSRRQWSFP-------VLMT--VNLVLQHLSFFQFGNTNSIA 690
           NI  F+ F IL  ++   +     +FP       V ++  V+LVLQ+ SFFQFG TNSI+
Sbjct: 653 NIGLFIVFQILQSQICYFFQ----NFPSSSSTTKVYLSNLVSLVLQNFSFFQFGGTNSIS 708

Query: 691 TVSLTNAYNGVSENYNIYVVGALMCVSNFAPSIYWSLSCLKILYS-KSTQSKWETFFTSR 749
           T+ L NAY+G+S +YNI VVG LM ++NFAP+IYWS+    I Y   S+Q+K +TF  S+
Sbjct: 709 TIDLGNAYHGISSDYNISVVGLLMSIANFAPAIYWSMLPWSINYEPASSQNKLQTFVKSK 768

Query: 750 LPSXXXXXXXXXXXXXSCVILRYHLFIWSVFSPKLCYYVSWNLFMNAIIAWFFEGTLVAL 809
           LP+             +C+ LR+HLFIWSVFSPKLCY++ WNL M  +  W  E  ++  
Sbjct: 769 LPAFTYHCIFGTCLMTACIFLRFHLFIWSVFSPKLCYFLGWNLVMGFLNGWLPELAVILA 828

Query: 810 L 810
           L
Sbjct: 829 L 829

>Ecym_5559 Chr5 (1131115..1134159) [3045 bp, 1014 aa] {ON} similar
           to Ashbya gossypii AGR126C
          Length = 1014

 Score =  194 bits (492), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/333 (36%), Positives = 174/333 (52%), Gaps = 27/333 (8%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + +AI  F+ GF   ++VL   A F+   +++     KF+K V++IVDALR DFV   D 
Sbjct: 54  QAIAIAFFTRGFLLSRTVLDNVASFDETKDSY----GKFDKAVILIVDALRFDFVIPVDT 109

Query: 72  SEFGFLHKLLNKGHA----WGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAILNVAE 123
           +  G+     N        W  +      ++PPT TL RLKG+TTGS P F+DA  N   
Sbjct: 110 AAEGYNDNYHNNLKVLYEYWDNSVLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFNG 169

Query: 124 DDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDL 183
           D +      +D+ ++Q  +H K I F GDDTW  LF     + +    S  V D + VD 
Sbjct: 170 DVIV-----EDNLIKQLYLHNKSIYFVGDDTWDALFHPYLSNMSVPYESLNVWDLDTVDN 224

Query: 184 NVTRHLPQQLQSQD----SWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYN 239
            V  +  + L  +D     WDVLI H LG+DH+GHK G     M  K +++D  I ++  
Sbjct: 225 GVISYFEEHLLDKDPLDREWDVLIGHMLGIDHVGHKYGPNHFTMSEKQQQVDKFIRKVIA 284

Query: 240 AVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASS 299
           ++ EDTL+ VMGDHGM+  GNHGG S  E  + L   SK    ++     Q       +S
Sbjct: 285 SIDEDTLLVVMGDHGMDHTGNHGGDSNDELESTLWLHSKRKNAWKLKSPDQYN-----TS 339

Query: 300 SPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
               NY  +VNQID VPT++ L   P+P N++G
Sbjct: 340 RLGENY-RQVNQIDLVPTLSLLLGTPIPFNNLG 371

>ZYRO0B01034g Chr2 (87543..90572) [3030 bp, 1009 aa] {ON} similar to
           uniprot|Q07830 Saccharomyces cerevisiae YLL031C
          Length = 1009

 Score =  189 bits (480), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 177/337 (52%), Gaps = 32/337 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + +AI  F+ GF   + VL  D   +  P  +     KF+K V++++DALR DFV   D 
Sbjct: 46  QFIAIAFFTRGFLLTRQVL--DNVSSPFPNQYG----KFDKAVVLVIDALRFDFVIPVDE 99

Query: 72  SE-------FGFLHKLLN----KGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILN 120
           S           +  L N    KG +  +   ++PPT TL RLKG+TTGS P F+DA   
Sbjct: 100 SHPQHNPNYHNNIKALWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSLPTFIDA--- 156

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
               +   ++ E+D+ ++Q  + QK + F GDDTW  LF      +++   S  V D + 
Sbjct: 157 --GSNFDGSVIEEDNLIKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYPSLNVWDLDT 214

Query: 181 VDLNVT----RHLPQQLQSQD-SWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIE 235
           VD  V     RHL +  Q++   WDVL+ H LG+DH+GHK G     M  K  ++D  I 
Sbjct: 215 VDNGVMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREKQLQVDEFIR 274

Query: 236 QIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIP 295
           +I  A+ +DTL+ VMGDHGM+  GNHGG S  E  + L   SK        + Q  +D  
Sbjct: 275 KIIAAIDKDTLLIVMGDHGMDHTGNHGGDSIDELESTLFLYSK-----RPDMWQPNEDPN 329

Query: 296 VASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           V   S       +VNQID VPT++ L NLP+P NS+G
Sbjct: 330 VYDVSDLGKNYKQVNQIDLVPTLSLLLNLPIPFNSLG 366

>Kwal_55.20667 s55 complement(511335..513140) [1806 bp, 602 aa]
           {OFF} YLL031C (GPI13) - phosphoryltransferase that adds
           phosphoethanolamine to the third mannose residue of the
           GPI anchor precursor [contig 141] PARTIAL
          Length = 602

 Score =  184 bits (468), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 121/338 (35%), Positives = 174/338 (51%), Gaps = 36/338 (10%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           +I+AI  F+ GF   ++VL+  A        H    PKF+K V++++DALR DF    D 
Sbjct: 56  QIIAIAFFARGFLLTRTVLENVA-------THADYEPKFDKCVILVIDALRFDFSIPIDP 108

Query: 72  SEFGF---LHKLLNKGHAWGYTA----------YSNPPTVTLPRLKGITTGSTPNFLDAI 118
            E G+    H  L+  H+ G+             S+PPT TL RLKG+TTGS P F+DA 
Sbjct: 109 QENGYNPYYHNNLDVFHS-GFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTFIDAG 167

Query: 119 LNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDF 178
            N      +  + E+D+ ++Q  ++ K I F GDDTW  LF +     +    S  V D 
Sbjct: 168 SNF-----NGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLNVWDL 222

Query: 179 EEVDLNVTRHLPQQL----QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVI 234
           + VD  V  +  + L    + +  WDVLI H LG+DH+GHK G     M  K  + +  I
Sbjct: 223 DTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFI 282

Query: 235 EQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI 294
           ++I   + +DTL+ VMGDHGM+  GNHGG S  E  A L   S   + +   L Q   + 
Sbjct: 283 KRICEKLDDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWNH-LPQDAYNT 341

Query: 295 PVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
            V   +       +VNQID V T++ L  LP+P N++G
Sbjct: 342 SVLGENHR-----EVNQIDLVSTLSLLLGLPIPFNNLG 374

>CAGL0G04015g Chr7 (379330..382389) [3060 bp, 1019 aa] {ON} highly
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031c GPI13
          Length = 1019

 Score =  188 bits (478), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 179/346 (51%), Gaps = 40/346 (11%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + VAI  F+ GF   ++VL   +  +  P A  +   KF+KMVL++VDALR DFV     
Sbjct: 46  QFVAIAFFAKGFLLSRTVLDNVSTTSDNPLAVDK---KFDKMVLLVVDALRFDFVVPVST 102

Query: 72  SEFGFLHKLLNK----GHAW------GYTAYSN------------PPTVTLPRLKGITTG 109
           S   +     N      + W      G   YSN            PPT TL RLKG+TTG
Sbjct: 103 SHPNYNENFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLKGLTTG 162

Query: 110 STPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDG 169
           S P F+DA       +   ++ E+D+ ++Q  +  K + F GDDTW  LF     + ++ 
Sbjct: 163 SLPTFIDA-----GSNFDGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEP 217

Query: 170 TNSFFVSDFEEVDLNVTRHLPQQL--QSQD-SWDVLILHYLGLDHIGHKGGAFSSFMPPK 226
             S  V D + VD  V  +    L  +S D +WD+L+ H LG+DH+GHK G     M  K
Sbjct: 218 YPSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMREK 277

Query: 227 HREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKP 286
             +++  I++I  ++  DTL+ VMGDHGM+  GNHGG S  E  + L F +K    ++  
Sbjct: 278 QNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTWK-- 335

Query: 287 LAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
              Q  +  + + +  Y+    VNQID VPT++ L ++PVP N++G
Sbjct: 336 --NQNGNYDIENLAQNYH---SVNQIDLVPTLSLLLDIPVPFNNLG 376

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 190/370 (51%), Gaps = 35/370 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + +AI  F+ GF   + VL      N  P     +  KF+K V++IVDALR DFV   D 
Sbjct: 46  QFIAIAFFTKGFLLSRQVLD-----NITPLDSNVIDAKFDKAVILIVDALRFDFVIPVDS 100

Query: 72  SE---------FGFLHKLLNKGHAWGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAI 118
           +E            L+     G++ G +      ++PPT TL RLKG+TTGS P F+DA 
Sbjct: 101 TEHLNNNYHNNIDILYDTFKNGNSHGSSILLKFLADPPTTTLQRLKGLTTGSLPTFIDA- 159

Query: 119 LNVAEDDVSSNLKEQDSWLRQFRMH-QKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSD 177
                 + + N+  +D+ +RQ   +  ++I F GDDTW  LF     + +    S  V D
Sbjct: 160 ----GSNFNGNVIFEDNLIRQLSENLNREILFVGDDTWDALFHPFLSNNSLPYESLNVWD 215

Query: 178 FEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQI 237
            + VD  V     + L+  D WDVLI H LG+DH+GHK G     M  K  +++  I++I
Sbjct: 216 LDTVDNGVIDFFDENLKKNDDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNTFIKKI 275

Query: 238 YNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI-PV 296
            +++  +TL+ VMGDHGM+  GNHGG S  E  + L   +K     +K + ++  D  P 
Sbjct: 276 IDSIDNNTLLVVMGDHGMDHTGNHGGDSIDELESTLFLYTK-----KKNIFRKHDDFTPY 330

Query: 297 ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTK-VID-- 353
             +    NY   VNQID V T++ L  +P+P N++G  I +     +     TK V+D  
Sbjct: 331 NITDLGKNY-RAVNQIDLVSTLSYLLGIPIPFNNLGWPIEEIFHSKNDKIKMTKRVLDQL 389

Query: 354 -NYQQLLSIS 362
             YQ+++ IS
Sbjct: 390 RTYQEIMGIS 399

>Kwal_YGOB_55.20664 s55 complement(510269..511291,511293..513140)
           [2871 bp, 956 aa] {ON} ANNOTATED BY YGOB -
          Length = 956

 Score =  186 bits (473), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 121/338 (35%), Positives = 174/338 (51%), Gaps = 36/338 (10%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           +I+AI  F+ GF   ++VL+  A        H    PKF+K V++++DALR DF    D 
Sbjct: 56  QIIAIAFFARGFLLTRTVLENVA-------THADYEPKFDKCVILVIDALRFDFSIPIDP 108

Query: 72  SEFGF---LHKLLNKGHAWGYTA----------YSNPPTVTLPRLKGITTGSTPNFLDAI 118
            E G+    H  L+  H+ G+             S+PPT TL RLKG+TTGS P F+DA 
Sbjct: 109 QENGYNPYYHNNLDVFHS-GFRDQNHSSLLLKFISDPPTTTLQRLKGLTTGSLPTFIDA- 166

Query: 119 LNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDF 178
                 + +  + E+D+ ++Q  ++ K I F GDDTW  LF +     +    S  V D 
Sbjct: 167 ----GSNFNGAIIEEDNLIKQMYLNNKTILFAGDDTWDNLFGTFLSPSSKPYESLNVWDL 222

Query: 179 EEVDLNVTRHLPQQLQS----QDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVI 234
           + VD  V  +  + L S    +  WDVLI H LG+DH+GHK G     M  K  + +  I
Sbjct: 223 DTVDNGVIDYFEEHLLSPAKDEAHWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFI 282

Query: 235 EQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI 294
           ++I   + +DTL+ VMGDHGM+  GNHGG S  E  A L   S   + +   L Q   + 
Sbjct: 283 KRICEKLDDDTLLVVMGDHGMDHTGNHGGDSRSELEATLWMYSTKPDMWNH-LPQDAYNT 341

Query: 295 PVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
            V   +       +VNQID V T++ L  LP+P N++G
Sbjct: 342 SVLGENHR-----EVNQIDLVSTLSLLLGLPIPFNNLG 374

>KLTH0E06094g Chr5 complement(550258..553308) [3051 bp, 1016 aa]
           {ON} similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1016

 Score =  186 bits (472), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 122/340 (35%), Positives = 178/340 (52%), Gaps = 37/340 (10%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           +I+AI  F+ GF   ++VL+  A      EA      +F K V++++DALR DF    D 
Sbjct: 52  QIIAIAFFARGFLLTRTVLENVAT-GADHEA------RFSKCVILVIDALRFDFSIPVDP 104

Query: 72  SEFGF----------LHKLLNKGHAWGYTAY-----SNPPTVTLPRLKGITTGSTPNFLD 116
           ++  F          LH   N   +  +++      ++PPT TL RLKG+TTGS P F+D
Sbjct: 105 ADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSLPTFID 164

Query: 117 AILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVS 176
           A       + +  + E+D+ ++Q  ++ + + F GDDTW  LF       +    S  V 
Sbjct: 165 A-----GSNFNGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFESLNVW 219

Query: 177 DFEEVDLNVTRHLPQQL----QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDA 232
           D + VD  V R     L    +  + WDVLI H LG+DH+GHK G     M  K  + + 
Sbjct: 220 DLDTVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANE 279

Query: 233 VIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQ 292
            I++I  ++ +DTL+ VMGDHGM+  GNHGG S  E  AAL   SK    +   L +Q  
Sbjct: 280 FIKRICESIDDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKRPNMWSH-LPEQFY 338

Query: 293 DIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           DI    S+   NY  +VNQID VPT++ L  LP+P N++G
Sbjct: 339 DI----SALGENY-RQVNQIDLVPTLSLLLGLPIPFNNLG 373

>NDAI0H00320 Chr8 complement(57504..60608) [3105 bp, 1034 aa] {ON}
           Anc_4.28
          Length = 1034

 Score =  183 bits (464), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 197/404 (48%), Gaps = 38/404 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEA--------HRRMAPKFEKMVLVIVDALRS 63
           + +AI  F  GF   ++VL+  +  N             +     KF+K V+V++DALR 
Sbjct: 46  QFIAIAFFIKGFLLTRNVLENVSTLNDYTSILESNPIFNNPSDIAKFDKTVIVVIDALRF 105

Query: 64  DFVFQKDMSE----------FGFLHKLLNKGHAWGYTAY----SNPPTVTLPRLKGITTG 109
           DFV   D S           F  ++   N+  +   +      ++PPT TL RLKG+TTG
Sbjct: 106 DFVIPVDESNPNYNPNYHNNFKVMYDHFNETSSADSSLLLKFIADPPTTTLQRLKGLTTG 165

Query: 110 STPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDG 169
           S P F+DA       +   ++ E+D+ ++Q  ++ K + F GDDTW  LF      ++  
Sbjct: 166 SLPTFIDA-----GSNFDGSVIEEDNLIKQMYLNNKTVYFVGDDTWDSLFHPFLSSKSQP 220

Query: 170 TNSFFVSDFEEVDLNVTRHLPQQLQSQDS-------WDVLILHYLGLDHIGHKGGAFSSF 222
             S  V D + VD  V  +  ++L S+ +       WDVLI H LG+DH+GHK G     
Sbjct: 221 FESLNVWDLDTVDNGVISYFEKELISKKNNQKEEKEWDVLIGHMLGMDHVGHKYGPSHFS 280

Query: 223 MPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEK 282
           M  K  +++  + ++ +++ EDTL+ VMGDHGM+  GNHGG S  E  + L   SK  + 
Sbjct: 281 MKDKQLQLNEFVTKVIDSLDEDTLLVVMGDHGMDHTGNHGGDSQDELESTLFLFSKKQQM 340

Query: 283 YEKPLAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLL 342
           +      Q     V      Y    +VNQID VPT++ L  LP+P N++G  I +  K  
Sbjct: 341 WNLDPDNQETLYNVNKLGKHYR---QVNQIDLVPTLSLLTGLPIPFNNLGWPIKEIAKNF 397

Query: 343 SPADAKTKVIDNYQQLLSISGGSTKKLGDPDAIIEEM-REVQSD 385
                 TK I N  +  + + G      +   ++EE+ ++ Q+D
Sbjct: 398 DEDRFYTKAILNQLERYTHTIGIEPPTQEKKRLLEELWQQAQND 441

>SAKL0H25542g Chr8 (2236849..2239890) [3042 bp, 1013 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C
          Length = 1013

 Score =  183 bits (464), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 131/402 (32%), Positives = 198/402 (49%), Gaps = 44/402 (10%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFV----- 66
           + +AI  F+ GF   + VL   A         +     F+K V+++VDALR DFV     
Sbjct: 51  QFIAIAFFTRGFLLTRHVLDNVA-------TKKSEYGTFDKAVVLVVDALRFDFVIPVSE 103

Query: 67  --------FQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAI 118
                   +  ++       K +++  +      ++PPT TL RLKG+TTGS P F+DA 
Sbjct: 104 TQDYYNENYHNNLEVLYEKFKDVSESSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDA- 162

Query: 119 LNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDF 178
                 + +  + E+D+ ++Q  ++ K + F GDDTW  LF     +++    S  V D 
Sbjct: 163 ----GSNFNGEVIEEDNLIKQMFLNDKTVFFAGDDTWNALFSPFLAEQSRPYESLNVWDL 218

Query: 179 EEVDLNVT----RHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVI 234
           + VD  V      HL ++  +Q  WDVLI H LG+DH+GHK G     M  K  ++D  I
Sbjct: 219 DTVDNGVISFFKEHLFEKTPAQREWDVLIGHMLGIDHVGHKYGPNHFTMREKQLQVDNFI 278

Query: 235 EQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI 294
            QI  ++ EDTL+ ++GDHGM+  GNHGG S  E  + L   SK     +  +     D 
Sbjct: 279 RQIMESIDEDTLLVILGDHGMDHTGNHGGDSRDELESTLWLHSK-----KHGMWDHYSDE 333

Query: 295 PVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTK-VID 353
              +S    NY  +VNQID VPT++ L  LP+P N++G  I +         AKTK  ++
Sbjct: 334 TYDTSELGKNY-RQVNQIDLVPTLSLLLGLPIPFNNLGWPIREI--------AKTKDELE 384

Query: 354 NYQQLLSISGGSTKKLGDPDAIIEEMREVQSDLAKTATNYNY 395
            Y QL      S K +       E+  +++S LA T  + +Y
Sbjct: 385 LYTQLTLEQLQSYKNISGVINTAEKNEKLESLLANTTFSLDY 426

>KNAG0J02820 Chr10 (539098..542151) [3054 bp, 1017 aa] {ON} Anc_4.28
           YLL031C
          Length = 1017

 Score =  181 bits (459), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 179/364 (49%), Gaps = 33/364 (9%)

Query: 12  EIVAILTFSAGFFPQKSVL----QGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVF 67
           + +AI  FS GF   + VL    + D+Q   +       +PKF++ V++IVDALR DFV 
Sbjct: 46  QFIAIAFFSRGFLLSRHVLDNISKADSQLTLQS------SPKFDRAVVLIVDALRFDFVI 99

Query: 68  --QKDMSEFGF-------LHKLLNKGHAWG---YTAYSNPPTVTLPRLKGITTGSTPNFL 115
             +K+ +   +         K ++   +         ++PPT TL RLKG+TTGS P F+
Sbjct: 100 PIEKEKANSNYHNNINIMYDKFMDNSESCSSLLLKFMADPPTTTLQRLKGLTTGSLPTFI 159

Query: 116 DAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFV 175
           DA  N   D +     E+D+ ++Q  +H K + F GDDTW  LF     + +    S  V
Sbjct: 160 DAGSNFNGDTI-----EEDNLIKQLYLHDKNVLFVGDDTWDALFNPFLSNNSAPFESLNV 214

Query: 176 SDFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIE 235
            D + VD  V       + S++ WDVL+ H LG+DH+GHK G     M  K  +++  I 
Sbjct: 215 WDLDTVDNGVISFFNDHIHSKE-WDVLVGHMLGVDHVGHKYGPDHFTMKEKQTQVNEFIH 273

Query: 236 QIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIP 295
            +  ++ +DTL+ VMGDHGM+  GNHGG S  E  + L   SK   K+            
Sbjct: 274 YVMQSLDDDTLLVVMGDHGMDRTGNHGGDSIDELESTLFLYSKTPGKFGAMTDGNQSIYN 333

Query: 296 VASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNY 355
           ++     Y     VNQID V T++ +   P+P N++G  I +     +P + K       
Sbjct: 334 ISDYGSSYR---SVNQIDLVSTLSLMLGTPIPFNNLGWPIEEMFN--TPEEGKRMTQITM 388

Query: 356 QQLL 359
            QLL
Sbjct: 389 DQLL 392

>KLLA0C17534g Chr3 (1540967..1543984) [3018 bp, 1005 aa] {ON}
           similar to uniprot|Q07830 Saccharomyces cerevisiae
           YLL031C,
          Length = 1005

 Score =  180 bits (457), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/335 (34%), Positives = 172/335 (51%), Gaps = 31/335 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + ++I  F+ GF   ++VL   A+     +       K++KMVL+IVDALR DFV   D 
Sbjct: 54  QFISIAFFAKGFLLTRTVLDNVAEL----DPQLPFEAKYDKMVLLIVDALRFDFVIPVDE 109

Query: 72  SEFGFLHKLLNKGHAWGYTAY-----------SNPPTVTLPRLKGITTGSTPNFLDAILN 120
           +   +     N       TA+           ++PPT TL RLKG+TTGS P F+DA  N
Sbjct: 110 NHAKYNPNYHNNLKVLYETAHNSTDSVLLKFLADPPTTTLQRLKGLTTGSLPTFIDAGSN 169

Query: 121 VAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEE 180
              D +     ++D+ ++Q  +H KKI F GDDTW  LF      E+    S  V D + 
Sbjct: 170 FNGDVI-----DEDNLIKQLYLHNKKIFFAGDDTWDALFNPYLAPESVPYESLNVWDLDT 224

Query: 181 VDLNVTRHLPQQL---QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQI 237
           VD  V  +L +     + +  +D+LI H LG+DH+GHK G     M  K  ++D ++ +I
Sbjct: 225 VDNGVISYLEEYYFNEEKRSEYDILIGHMLGVDHVGHKYGPNHFTMKEKQLQVDELLRKI 284

Query: 238 YNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVA 297
            +   ++TL  VMGDHGM+  GNHGG S  E  + L   +K         A   +D    
Sbjct: 285 ISTADDNTLYVVMGDHGMDHTGNHGGDSQDELESVLWLYAK--------NANWSKDYDSY 336

Query: 298 SSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           +++       ++NQID VPT++ L  +P+P N++G
Sbjct: 337 NTTDLGTSYKQMNQIDLVPTLSLLLGIPIPFNNLG 371

>TDEL0F01690 Chr6 (313714..316731) [3018 bp, 1005 aa] {ON} Anc_4.28
           YLL031C
          Length = 1005

 Score =  179 bits (453), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 117/335 (34%), Positives = 168/335 (50%), Gaps = 32/335 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + +AI  F+ GF   + VL   A    K   +     KF+K V++IVDALR DFV   D 
Sbjct: 46  QFIAIAFFTRGFLLTRQVLDDVA---IKTAEY----GKFDKAVVLIVDALRFDFVIPVDQ 98

Query: 72  SEFGFLHKLLN------------KGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAIL 119
              G+     N            +G +      ++ PTVTL RLKG+TTGS P F+DA  
Sbjct: 99  DHQGYSGNFHNNIDVLYESMFADQGSSLLLKFIADAPTVTLQRLKGLTTGSLPTFIDA-- 156

Query: 120 NVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFE 179
                +   ++ E+D+ ++Q     K+I F GDDTW  LF       +    SF V D +
Sbjct: 157 ---GSNFDGSVIEEDNLIKQMYEQGKQIYFAGDDTWESLFSPFLSPRSKYYESFNVWDLD 213

Query: 180 EVDLNVTRHLPQQL--QSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQI 237
            VD  V  +  + L   +   WDVLI H LG+DH+GHK G     M  K  +++  + +I
Sbjct: 214 TVDNGVISYFNEHLLETANRDWDVLIGHMLGVDHVGHKYGPNHFTMREKQLQVNDFLIKI 273

Query: 238 YNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVA 297
              + +DTL+ +MGDHGM+  GNHGG S  E  + L   SK      +P      D    
Sbjct: 274 KETIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSK------RPNMWGLNDPSQY 327

Query: 298 SSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           +++    Y  +VNQID VPT++ L  LP+P N++G
Sbjct: 328 NTTDLGAYYREVNQIDLVPTLSILMGLPIPFNNLG 362

>YLL031C Chr12 complement(77152..80205) [3054 bp, 1017 aa] {ON}
           GPI13ER membrane localized phosphoryltransferase that
           adds phosphoethanolamine onto the third mannose residue
           of the glycosylphosphatidylinositol (GPI) anchor
           precursor; similar to human PIG-O protein
          Length = 1017

 Score =  177 bits (449), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 106/334 (31%), Positives = 171/334 (51%), Gaps = 28/334 (8%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + ++I  F+ GF   + VL   +  N       ++ P+F K V++++DALR DF    + 
Sbjct: 46  QFISIAFFTRGFLLSRHVLDNISSQN----ETSKLPPRFNKAVILVIDALRFDFAIPVNE 101

Query: 72  SE----FGFLHKLLNKGHAWGYTA---------YSNPPTVTLPRLKGITTGSTPNFLDAI 118
           S       + + +L+   ++              ++PPT TL RLKG+TTGS P F+DA 
Sbjct: 102 SHSNYNLNYHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDA- 160

Query: 119 LNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDF 178
                 +    + E+D++L+Q  +  K +KF GDDTW+ LF     +++    S  V D 
Sbjct: 161 ----GSNFDGTVIEEDNFLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVWDL 216

Query: 179 EEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIY 238
           + VD  V  +    LQ    WDV+I H LG+DH+GHK G     M  K  ++D  I+ I 
Sbjct: 217 DTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWIL 276

Query: 239 NAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVAS 298
            ++ +DTL+ ++GDHGM+  GNHGG S  E  + L   SK  + +     ++  +  + +
Sbjct: 277 KSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWR---LKETSNYNIDN 333

Query: 299 SSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
              +Y     V QID V ++A L   P+P N++G
Sbjct: 334 LGHDYR---SVRQIDLVSSLALLMGQPIPFNNLG 364

>TPHA0K02180 Chr11 (466234..469320) [3087 bp, 1028 aa] {ON} Anc_4.28
           YLL031C
          Length = 1028

 Score =  177 bits (448), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 116/353 (32%), Positives = 178/353 (50%), Gaps = 52/353 (14%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVF---- 67
           ++++I  F+ GF   +S ++  AQ  Y PE       KF+K V+++VDALR DFV     
Sbjct: 53  QVISIAFFTKGFSFCRSPIRHTAQ--YSPEYSE--VKKFDKAVVLLVDALRFDFVVPINE 108

Query: 68  ------QKDMSEFGFLHKLLN----------------KGHAWGYTAYSNPPTVTLPRLKG 105
                 +   +    + +LLN                K  +  +   + PPT T  RLKG
Sbjct: 109 LDPIYNENYHNNIDIISELLNQNDNSTKNESKKDRVQKSSSLLFKFLAEPPTTTFHRLKG 168

Query: 106 ITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFD 165
           ITTG  P+FLD I+ + +  V     E DS ++Q  +  K I F GDDTW ++F      
Sbjct: 169 ITTGLLPSFLDGIMKLNDRVV-----EDDSIIKQLFLRNKTIYFSGDDTWSRMFEPYLSP 223

Query: 166 ETDGTNSFFVSDFEEVDLNVTRHLPQQLQSQDS----WDVLILHYLGLDHIGHKGGAFSS 221
           ++    S+ + D   VD  V +   + L S+++    WD+LI H +G+DH   K G    
Sbjct: 224 KSVPLESYNIWDLNTVDDGVFKFFNEHLTSKNTSNREWDILIGHIVGIDHAATKYGPNHI 283

Query: 222 FMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKL-- 279
            +  K  +++  I+QI  ++ + TL+ VMGDHGM+  GNHGG S+GE  ++L   SK   
Sbjct: 284 TVKQKQIQINEFIKQIVKSLDDQTLLIVMGDHGMDITGNHGGKSSGELESSLFLYSKKSS 343

Query: 280 LEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           + K E  L +   D           +  K+NQID VPT + LF +P+P N++G
Sbjct: 344 VWKQEHSLHENNND-----------FYKKINQIDIVPTFSLLFGIPIPYNNLG 385

>Kpol_478.1 s478 complement(442..3471) [3030 bp, 1009 aa] {ON}
           complement(442..3471) [3030 nt, 1010 aa]
          Length = 1009

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 180/352 (51%), Gaps = 35/352 (9%)

Query: 41  EAHRRMAPKFEKMVLVIVDALRSDFVFQKDMSE---------------FGFLHKLLNKGH 85
           + ++    KF+K V++I+DALR DFV   + ++                 F+ +  NK H
Sbjct: 64  DLNQDYTKKFDKAVILIIDALRFDFVIPVNSTDPLHNQNYHNNIITLYDQFISQNNNKDH 123

Query: 86  AWGYTAY-SNPPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQ 144
           +     + ++PPT TL RLKG+TTGS P F+DA  N        ++ E+D+ ++Q  +  
Sbjct: 124 SSILLKFIADPPTTTLQRLKGLTTGSLPTFIDAGTNF-----DGSVIEEDNLIKQLYLKN 178

Query: 145 KKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNV----TRHLPQQLQSQDSWD 200
           ++I F GDDTW  LF     + +    S  V D + VD  V      HL  Q  +   WD
Sbjct: 179 EEIYFVGDDTWDSLFNPFLSNHSKPFESLNVWDLDTVDNGVISYFNDHLINQKTNDKKWD 238

Query: 201 VLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGN 260
           +LI H LG+DH+GHK G     M  K  +++  I  I  ++ +DTL+ +MGDHGM+  GN
Sbjct: 239 ILIGHMLGVDHVGHKYGPNHFTMREKQLQVNNFINDIIESIDDDTLLVIMGDHGMDHTGN 298

Query: 261 HGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIAT 320
           HGG S  E  + L   SK  + +E        +  + +S   Y     VNQID VPT++ 
Sbjct: 299 HGGDSKDELESTLFMYSKKTDVWE---LGDPNNYNIENSGDNYR---SVNQIDLVPTLSL 352

Query: 321 LFNLPVPKNSIGVLIPDFLKLLSPADA----KTKVIDNYQQLLSISGGSTKK 368
           L ++P+P N++G  I +  K  +  +       K + NYQ++  +   +T+K
Sbjct: 353 LLDVPIPFNNLGWPINEISKNQNERNIFEQLTLKQLKNYQEVSGLVVNNTEK 404

>Smik_12.25 Chr12 complement(61505..64558) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 113/335 (33%), Positives = 170/335 (50%), Gaps = 30/335 (8%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + ++I  F+ GF   + VL   +  N   +    + P+F K V++++DALR DF    + 
Sbjct: 46  QFISIAFFTRGFLLSRHVLDNISSRNETSD----LPPRFNKAVVLVIDALRFDFAIPVNE 101

Query: 72  SE-----------FGFLHKLLNKGHAWGYTA--YSNPPTVTLPRLKGITTGSTPNFLDAI 118
           S+                   N  ++        ++PPT TL RLKG+TTGS P F+DA 
Sbjct: 102 SDPDHNPNYHNNILSLYDSFTNDKNSSSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDA- 160

Query: 119 LNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDF 178
                 +    + E+D+ L+QF +  K +KF GDDTW  LF     +++    S  V D 
Sbjct: 161 ----GSNFDGTIIEEDNLLKQFFLANKTVKFAGDDTWTALFYPFLSNDSFPLESLNVWDL 216

Query: 179 EEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIY 238
           + VD  V  +    LQ    WDV+I H LG+DH+GHK G     M  K  ++D  I+ I 
Sbjct: 217 DTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDRFIDWIL 276

Query: 239 NAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQD-IPVA 297
           N++ +DTL+ ++GDHGM+  GNHGG S  E  + L   SK      KP   + +D     
Sbjct: 277 NSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSK------KPEMWRLKDAFNYN 330

Query: 298 SSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           +S   YNY   V QID V +++ L + P+P N++G
Sbjct: 331 TSDSGYNY-RSVRQIDLVSSLSLLLDQPIPFNNLG 364

>Suva_10.41 Chr10 complement(81579..84632) [3054 bp, 1017 aa] {ON}
           YLL031C (REAL)
          Length = 1017

 Score =  173 bits (439), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 166/336 (49%), Gaps = 32/336 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + ++I  F+ GF   + VL   +  N     H    P+F K V++++DALR DFV   D 
Sbjct: 46  QFISIAFFTRGFLLSRHVLDNISTQNETTTLH----PRFNKTVVLVIDALRFDFVIPVD- 100

Query: 72  SEFGFLHKLLNKGHAWG-YTAYSN--------------PPTVTLPRLKGITTGSTPNFLD 116
            E G  H L    +    Y +++N              PPT TL RLKG+TTGS P F+D
Sbjct: 101 -ESGSNHNLNYHNNILSLYDSFANDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFID 159

Query: 117 AILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVS 176
           A       +    + E+D+ L+Q  +  K +KF GDDTW+ LF     +++    S  V 
Sbjct: 160 A-----GSNFDGTVIEEDNLLKQLHLANKTVKFAGDDTWMALFHPFLSNDSFPLESLNVW 214

Query: 177 DFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQ 236
           D + VD  V  +    LQ    WDV+I H LG+DH+GHK G     M  K  ++D  I  
Sbjct: 215 DLDSVDKGVMDYFHDHLQQDQEWDVMIGHMLGIDHVGHKYGPDHFTMREKQVQVDEFINW 274

Query: 237 IYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV 296
           I  ++ E+TL+ ++GDHGM+  GNHGG S  E  + L   SK      KP   + +D   
Sbjct: 275 ILKSIDENTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSK------KPNLWKLKDSSN 328

Query: 297 ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
              S        V QID V +++ L   P+P N++G
Sbjct: 329 YDISALGRDYRSVRQIDLVSSLSLLLGQPIPFNNLG 364

>TPHA0F00310 Chr6 complement(59665..62745) [3081 bp, 1026 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1026

 Score =  172 bits (437), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 171/353 (48%), Gaps = 44/353 (12%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAP--------KFEKMVLVIVDALRS 63
           + +AI  F+ GF   ++VL    +   KP  +   +         KFEK V++++DALR 
Sbjct: 37  QFIAIAFFTKGFLLSRNVLDDINEL--KPSMYAANSSNNGFVHQQKFEKTVILVIDALRF 94

Query: 64  DFVFQKDMSEFGFLHKLLNK-----------------GHAWGYTAYSNPPTVTLPRLKGI 106
           DFV   + +   +     NK                  ++      ++PPT TL RLKG+
Sbjct: 95  DFVIPVNTNNSAYNSNHHNKITTLYDQFCKESVGKKQNNSLLLKFLADPPTTTLQRLKGL 154

Query: 107 TTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDE 166
           TTGS P F+DA       +    + E+D+ ++Q  ++ K++ F GDDTW  LF     + 
Sbjct: 155 TTGSLPTFIDA-----GSNFDGTVIEEDNLIKQMYLNNKEVFFVGDDTWDALFSPFLSNH 209

Query: 167 TDGTNSFFVSDFEEVDLNVTRHLPQQL-------QSQDSWDVLILHYLGLDHIGHKGGAF 219
           +    S  V D + VD  V  +    L       +    W+VLI H LG+DH+GHK G  
Sbjct: 210 SIPYESLNVWDLDTVDNGVISYFNDNLIRSEEYKKKNSQWNVLIGHMLGVDHVGHKYGPN 269

Query: 220 SSFMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKL 279
              M  K  +++  I  I N + +DTL+ +MGDHGM+  GNHGG S  E  + L   SK 
Sbjct: 270 HFTMKEKQLQVNNFINDIINVIDDDTLLVIMGDHGMDHTGNHGGDSIDELESTLFLYSKR 329

Query: 280 LEKYEKPLAQQGQDIPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
              ++        +I    S    NY   +NQID VPT+A L ++P+P N++G
Sbjct: 330 QNVWKLEDDHSVYNIDDLGS----NY-KSINQIDLVPTLALLLDIPIPFNNLG 377

>NCAS0C05800 Chr3 (1193195..1196230) [3036 bp, 1011 aa] {ON}
           Anc_4.28
          Length = 1011

 Score =  171 bits (434), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/339 (34%), Positives = 172/339 (50%), Gaps = 33/339 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQF-NYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKD 70
           + +AI  F  GF   ++VL   A   +Y+   +     KF K V+++VDALR DFV   +
Sbjct: 46  QFIAIAFFLKGFLLTRNVLDNVATLADYQSIENY---GKFNKSVILVVDALRFDFVIPVN 102

Query: 71  MSEFGF-------LHKLLNKGHAWGYTA------YSNPPTVTLPRLKGITTGSTPNFLDA 117
            S   +       L  L  K      ++       ++PPT TL RLKG+TTGS P F+DA
Sbjct: 103 QSNPDYNDYYHNNLKVLYEKFEDQSSSSSLLLKFMADPPTTTLQRLKGLTTGSLPTFIDA 162

Query: 118 ILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSD 177
                  +   ++ E+D+ ++Q  ++ K++ F GDDTW  LF       +    S  V D
Sbjct: 163 -----GSNFDGSVIEEDNIIKQMFLNDKQVLFVGDDTWDALFNPFLSPMSQPFESLNVWD 217

Query: 178 FEEVDLNVTR----HLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAV 233
            + VD  V      HL +    Q SW+VLI H LG+DH+GHK G     M  K  ++D  
Sbjct: 218 LDTVDNGVISFFNDHLLENTNDQ-SWNVLIGHMLGMDHVGHKFGPNHFTMKQKQLQIDKF 276

Query: 234 IEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQD 293
           I +I +++ +DTL+ +MGDHGM+  GNHGG S  E  + L   SK      +  A   QD
Sbjct: 277 IREIMDSIDDDTLLVIMGDHGMDHTGNHGGDSKDELESTLFLYSK------RNNAWNLQD 330

Query: 294 IPVASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
                +  + +    VNQID V T++ L  LP+P N++G
Sbjct: 331 TSNYDTRNQGDRYRSVNQIDLVSTLSFLLGLPIPFNNLG 369

>AGR126C Chr7 complement(989235..992276) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL031C
           (GPI13)
          Length = 1013

 Score =  170 bits (431), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 123/335 (36%), Positives = 173/335 (51%), Gaps = 32/335 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAP-KFEKMVLVIVDALRSDFVFQKD 70
           + +AI  F+ GF   + VL   A  +         AP KF+++VL++VDALR DFV   D
Sbjct: 54  QFIAIAFFTRGFLLSRKVLDDVANRD------ESTAPAKFDRLVLLVVDALRFDFVIPVD 107

Query: 71  MSEFGFLHKLLNKGHA----WGYTAY----SNPPTVTLPRLKGITTGSTPNFLDAILNVA 122
           ++  G+     N   A    W  +      ++PPT TL RLKG+TTGS P F+DA     
Sbjct: 108 VAAEGYNSHYHNHLRALYERWDESILLKFLADPPTTTLQRLKGLTTGSLPTFIDA----- 162

Query: 123 EDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVD 182
             + +  + ++   ++Q  +  K I F GDDTW  LF     + +    S  V D + VD
Sbjct: 163 GSNFNGIVIDEGYIIKQMCLINKTIYFAGDDTWDALFHPYLSNVSMPYESLNVWDLDTVD 222

Query: 183 LNVTR----HLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIY 238
             V      HL      +  WDVL+ H LG+DH+GHK G     M  K  ++D  I QI 
Sbjct: 223 NGVISFFEDHLLNNPTEKKEWDVLVGHMLGIDHVGHKYGPSHFSMAEKQSQVDGFIRQII 282

Query: 239 NAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVAS 298
           +AV EDTL+ VMGDHGM+  GNHGG S  E  + L   +K      +P   + Q  P A 
Sbjct: 283 DAVDEDTLLVVMGDHGMDHTGNHGGDSPAELESTLWLYTK------RPGTWRRQ-APAAY 335

Query: 299 SSPEYN-YLTKVNQIDFVPTIATLFNLPVPKNSIG 332
           ++ E   Y   VNQID VP+++ L  LP+P N++G
Sbjct: 336 NTTELGRYYRAVNQIDLVPSLSLLLGLPIPFNNLG 370

>Skud_12.36 Chr12 complement(68300..71350) [3051 bp, 1016 aa] {ON}
           YLL031C (REAL)
          Length = 1016

 Score =  169 bits (427), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 110/336 (32%), Positives = 166/336 (49%), Gaps = 33/336 (9%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + ++I  F+ GF   + VL   +  N        + P+F K V+++VDALR DFV   + 
Sbjct: 46  QFISIAFFTRGFLLSRHVLDNISALN-----ETSIPPRFNKAVVLVVDALRFDFVIPVNE 100

Query: 72  SEFGFLHKLLNKGHAWG-YTAYSN--------------PPTVTLPRLKGITTGSTPNFLD 116
           S     H L    +    Y +++N              PPT TL RLKG+TTGS P F+D
Sbjct: 101 SSSN--HNLNYHNNILSLYDSFANDEDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFID 158

Query: 117 AILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVS 176
           A       +    + E+D+ L+Q  +  K +KF GDDTW+ LF     +++    S  V 
Sbjct: 159 A-----GSNFDGTVIEEDNLLKQLHLVNKTVKFAGDDTWMALFHPFLSNDSFPLESLNVW 213

Query: 177 DFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQ 236
           D + VD  V  +    LQ    WDV+I H LG+DH+GHK G     M  K  ++D  I  
Sbjct: 214 DLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPNHFTMKEKQFQVDQFIAW 273

Query: 237 IYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPV 296
           I  ++ +DTL+ ++GDHGM+  GNHGG S  E  + L   SK    +     +   +  +
Sbjct: 274 ILKSIDDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPNMWN---FKDASNYNI 330

Query: 297 ASSSPEYNYLTKVNQIDFVPTIATLFNLPVPKNSIG 332
            +   +Y     V QID V +++ L   P+P N++G
Sbjct: 331 TNLGCDYR---SVRQIDLVSSLSLLLGQPIPFNNLG 363

>TBLA0A08500 Chr1 complement(2089018..2092215) [3198 bp, 1065 aa]
           {ON} Anc_4.28 YLL031C
          Length = 1065

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 172/347 (49%), Gaps = 41/347 (11%)

Query: 12  EIVAILTFSAGFFPQKSVLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQKDM 71
           + ++I  FS GF   ++VL   +  N  P +     P+F+K V++IVDALR +FV   D+
Sbjct: 65  QFISIAFFSRGFLLTRNVLDNISTDN-NPNSILNDKPQFDKTVILIVDALRFNFVIPVDV 123

Query: 72  SEFGFLHKLLNKGHAWGYTAYSN--------------PPTVTLPRLKGITTGSTPNFLDA 117
               +     N      Y  + N              PPT T+ RLKG+TTG+ P F+DA
Sbjct: 124 DSMDYNPNYHNNIDVL-YDTFKNSQDSSSVLLKFIADPPTTTMQRLKGLTTGTLPTFIDA 182

Query: 118 ILNVAEDDVSSNLKEQDSWLRQFRMHQ--KKIKFFGDDTWLKLFP----SEFFDETDGTN 171
                  +   ++  +D+ ++Q  +++    I F GDDTW  LF      +F    D  N
Sbjct: 183 -----GSNFDGSVILEDNLIKQLYLNKFWNDIYFVGDDTWDALFKPYLNQQFSRPFDSLN 237

Query: 172 SFFVSDFEEVDLNVTRHLPQQLQSQDSWD-----VLILHYLGLDHIGHKGGAFSSFMPPK 226
              V D + VD  V  +  + L  Q S D      LI H LG+DH+GHK G     M  K
Sbjct: 238 ---VWDLDTVDNGVISYFHEYLIDQSSKDQMTYKTLIGHMLGVDHVGHKYGPNHFTMKEK 294

Query: 227 HREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKP 286
             +++  +++I N++ ++TL+ VMGDHGM+  GNHGG S  E  + L   +K     +K 
Sbjct: 295 QLQINQFLKEIINSIDDNTLLVVMGDHGMDHTGNHGGDSVDELESTLFMYAK-----KKN 349

Query: 287 LAQQGQDIPVASSSPEYNYLTK-VNQIDFVPTIATLFNLPVPKNSIG 332
                +D   + +   +    K VNQID VPT++ L +L +P NS+G
Sbjct: 350 SFTLDKDYETSYNISNFGESYKQVNQIDLVPTLSLLLDLQIPFNSLG 396

>SAKL0C05434g Chr3 complement(516536..519643) [3108 bp, 1035 aa]
           {ON} similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 1035

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 121/351 (34%), Gaps = 70/351 (19%)

Query: 48  PKFEKMVLVIVDALRSDFVFQKDMSEFG--------FLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F K              F+  L+     +G +    P    
Sbjct: 157 PPAKRLFLIVGDGLRADTTFDKITHPVSGETTYLAPFIRSLVKNNATYGISHTRMP---- 212

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLK 157
                   T S P  +  I    ED   V+   +E       F         FG    L 
Sbjct: 213 --------TESRPGHVAMIAGFYEDVSAVTKGWQENPVDFDSFFNQSAHTYSFGSPDILP 264

Query: 158 LFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQSQ-----------DSW 199
           +F     D        +  +FE       E+D  V RHL Q   +               
Sbjct: 265 MFKEGASDPHRVDAWMYGHEFEDFTQSSIELDAYVFRHLDQLFHNSTVDTALREEIMQHG 324

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMD----AVIEQIYNAVGED-TLICVMGDHG 254
           +V  LH LG D  GH    +S+      R +D     ++E++ +  G+D T      DHG
Sbjct: 325 NVFFLHLLGCDTAGHSYRPYSAEYYDNVRYIDEQVAVLVEKVRDFFGDDDTAFIFTADHG 384

Query: 255 MNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLT------- 307
           M+  G+HG      T   LV                G + PV +  PEY+  T       
Sbjct: 385 MSAFGSHGDGHPNNTRTPLVAWGA------------GLNTPVRNEKPEYDNYTATWDLAE 432

Query: 308 ----KVNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDN 354
                VNQ D    +A L     P NS+G L   +L      +AK K + N
Sbjct: 433 VRRNDVNQADIASLMAYLIGTNYPANSVGELPLAYLA--GTEEAKLKALYN 481

>AEL113C Chr5 complement(409096..411873) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL165C
           (MCD4)
          Length = 925

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/378 (24%), Positives = 136/378 (35%), Gaps = 80/378 (21%)

Query: 29  VLQGDAQFNYKPEAHRRMAPKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKL 80
           ++ G  QF    E      P  +++ L++ D LR+D  F K        +EF   +L  L
Sbjct: 33  LVHGMRQFKSNEE------PPAKRLFLIVGDGLRADTSFDKVKHPVTGKTEFLAPYLRSL 86

Query: 81  LNKGHAWGYTAYSNPPTVTLPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLR 138
           +     +G +    P            T S P  +  I    ED   V+   KE      
Sbjct: 87  VEHNATYGISHTRMP------------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFD 134

Query: 139 QFRMHQKKIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQ 191
                      FG    L +F S   D T      +  +FE       E+D  V RH+  
Sbjct: 135 SVFNQSTHTYSFGSPDILPMFKSGASDPTKVDAWMYGHEFEDFTQSSIELDAYVFRHMDA 194

Query: 192 QLQS------------QDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYN 239
             ++            QD  +V  LH LG D  GH    +S+      + +D+ +E++  
Sbjct: 195 LFRNATVDSKLRHEMMQDG-NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDSQLERLVP 253

Query: 240 AVGE-----DTLICVMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI 294
            V E     DT      DHGM+  G+HG      T   LV                G + 
Sbjct: 254 KVREFFGDDDTAFVFTADHGMSAFGSHGDGHPNNTRTPLVAWGA------------GLNR 301

Query: 295 PVASSSPEYNYLTK-----------VNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLS 343
           PV +  P Y+  T+           VNQ D    ++ L  L  P NS+G L   ++    
Sbjct: 302 PVLNDVPVYDNYTENWDLAHVRRNDVNQADIASLMSYLIGLNYPTNSVGELPLAYVN--- 358

Query: 344 PADAKTKVIDNYQQLLSI 361
               +TK+   Y+  LSI
Sbjct: 359 -GSERTKLNALYKNALSI 375

>Ecym_8094 Chr8 (200835..203615) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AEL113C
          Length = 926

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 116/332 (34%), Gaps = 70/332 (21%)

Query: 48  PKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F K        +EF   F+  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITYPSAGEAEFLAPFIRSLVMNNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLK 157
                   T S P  +  I    ED   V+   KE                 FG    L 
Sbjct: 102 --------TESRPGHVSMIAGFYEDVSAVTKGWKENPVNFDSVFNQSAHTYSFGSPDILP 153

Query: 158 LFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQS------------QDS 198
           +F     D    +   +  +FE       E+D  V RHL Q  ++            QD 
Sbjct: 154 MFKDGASDPNKVSAWMYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTVNATLNEEIFQDG 213

Query: 199 WDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV-----GEDTLICVMGDH 253
            +V  LH LG D  GH    +S+      + +D  I  + + V      +DT      DH
Sbjct: 214 -NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKQISLLVDKVRDFFGDDDTAFLFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK----- 308
           GM+  G+HG      T   LV     L K            PV +  P ++  TK     
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVRNKHPIHDNYTKNWELS 320

Query: 309 ------VNQIDFVPTIATLFNLPVPKNSIGVL 334
                 VNQ D    ++ L     P NS+G L
Sbjct: 321 DIKRNDVNQADIASLMSYLIGANYPANSVGEL 352

>Skud_11.60 Chr11 complement(124115..126874) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/337 (23%), Positives = 124/337 (36%), Gaps = 78/337 (23%)

Query: 47  APKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ L++ D LR+D  F K        +EF   F+  L+     +G  +++  PT 
Sbjct: 45  TPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYG-ISHTRMPTE 103

Query: 99  TLP-----------RLKGITTG--STPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQK 145
           + P            +  +T G  S P   D+  N +    S    +     R       
Sbjct: 104 SRPGHVAMIAGFYEDVSAVTKGWKSNPVDFDSFFNQSAHTYSFGSPDILPMFRDGASDPN 163

Query: 146 KIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQLQS---------- 195
           K+     DTW+           D T   F     E+D  V RHL Q  ++          
Sbjct: 164 KV-----DTWMY----------DHTFEDFTQSSIELDAYVFRHLDQLFRNSTLNSTLDYE 208

Query: 196 --QDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMD----AVIEQIYNAVGED-TLIC 248
             QD  +V  LH LG D  GH    +S+      + +D     +IE++     +D T   
Sbjct: 209 IRQDG-NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIEKVNRFFADDKTAFV 267

Query: 249 VMGDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK 308
              DHGM+  G+HG      T   L+     L K            PV +S P ++  T+
Sbjct: 268 FTADHGMSAFGSHGDGHPNNTRTPLIAWGAGLNK------------PVHNSYPVFDNYTE 315

Query: 309 -----------VNQIDFVPTIATLFNLPVPKNSIGVL 334
                      + Q D    ++ L  +  PKNS+G L
Sbjct: 316 NWELSNIKRNDIKQADIASLMSYLIGVNYPKNSVGEL 352

>NDAI0A00980 Chr1 complement(201468..204245) [2778 bp, 925 aa] {ON}
           Anc_1.184 YKL165C
          Length = 925

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 117/332 (35%), Gaps = 68/332 (20%)

Query: 47  APKFEKMVLVIVDALRSDFVFQ------KDMSEF--GFLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ L++ D LR+D  F          +EF   F+  L+     +G +    P   
Sbjct: 44  TPPAKRLFLIVGDGLRADTTFDLITHPTTGKTEFLAPFIRSLVKTNATYGISHTRMP--- 100

Query: 99  TLPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWL 156
                    T S P  +  I    ED   V+   KE       F         FG    L
Sbjct: 101 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDIL 151

Query: 157 KLFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQSQDS----------- 198
            +F     D        +  ++E       E+D  V RHL    ++  S           
Sbjct: 152 PMFKDGASDPNKVDAWMYGHEYEDFTQSSIELDAYVFRHLDSLFKNSTSNVTLDHEIRQE 211

Query: 199 WDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDA----VIEQIYNAVG-EDTLICVMGDH 253
            +V  LH LG D  GH    +S+      + +D     +++++++  G EDT      DH
Sbjct: 212 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSLLVDKVHDFFGDEDTAFIFTADH 271

Query: 254 GMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK----- 308
           GM+  G+HG      T   LV     L K            PV +  P Y+  T+     
Sbjct: 272 GMSAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVKNEVPIYDNYTESWGLA 319

Query: 309 ------VNQIDFVPTIATLFNLPVPKNSIGVL 334
                 + Q D  P ++ L     P NS+G L
Sbjct: 320 DIKRNDIKQADITPLMSYLIGANYPANSVGEL 351

>Suva_11.58 Chr11 complement(123117..125876) [2760 bp, 919 aa] {ON}
           YKL165C (REAL)
          Length = 919

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 126/331 (38%), Gaps = 66/331 (19%)

Query: 47  APKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ L++ D LR+D  F K        +EF   F+  L+     +G  +++  PT 
Sbjct: 45  TPPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPFIRSLVMNNATYG-ISHTRMPTE 103

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKL 158
           + P    +  G    F + +  V +    SN  + DS+  Q   H      FG    L +
Sbjct: 104 SRPGHVAMIAG----FYEDVSAVTKG-WKSNPVDFDSFFNQ-STHTYS---FGSPDILPM 154

Query: 159 FPSEFFDET-------DGTNSFFVSDFEEVDLNVTRHLPQQLQS------------QDSW 199
           F     D         D T   F     E+D  V +HL Q  ++            QD  
Sbjct: 155 FKDGASDPNKVDAWMYDHTFEDFTQSSIELDAYVFKHLDQLFRNSTLNSTLDYEIRQDG- 213

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMD----AVIEQIYNAVGED-TLICVMGDHG 254
           +V  LH LG D  GH    +S+      + +D     +IE++     +D T      DHG
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPTLIEKVNKFFDDDKTAFVFTADHG 273

Query: 255 MNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK------ 308
           M+  G+HG      T   LV     L K            PV +S P ++  T+      
Sbjct: 274 MSAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVHTSYPVFDNYTENWELSS 321

Query: 309 -----VNQIDFVPTIATLFNLPVPKNSIGVL 334
                V Q D    ++ L  +  PKNS+G L
Sbjct: 322 IKRNDVKQADIASLMSYLIGVNYPKNSVGEL 352

>CAGL0M08448g Chr13 complement(841439..844204) [2766 bp, 921 aa]
           {ON} highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165c sporulation protein
          Length = 921

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 110/331 (33%), Gaps = 68/331 (20%)

Query: 48  PKFEKMVLVIVDALRSDFVFQKDMSEFG--------FLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F K              F+  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLK 157
                   T S P  +  I    ED   V+   KE       F         FG    L 
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDILP 153

Query: 158 LFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQL-----------QSQDSW 199
           +F     D        +  ++E       E+D  V RHL Q             Q +   
Sbjct: 154 MFKDGASDPNKVDAWMYGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQDG 213

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGE-----DTLICVMGDHG 254
           +   LH LG D  GH    +S+        +D  +E++   V E     DT      DHG
Sbjct: 214 NAFFLHLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTADHG 273

Query: 255 MNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK------ 308
           M+  G+HG      T   LV                G + PV   +PE++  T+      
Sbjct: 274 MSAFGSHGDGHPNNTRTPLV------------AWGAGLNRPVRLDTPEFDEYTENWNLAN 321

Query: 309 -----VNQIDFVPTIATLFNLPVPKNSIGVL 334
                V Q D    ++ L     P NS+G L
Sbjct: 322 IKRNDVKQADIAALMSYLIGTNYPANSVGEL 352

>KLLA0B07249g Chr2 complement(630336..633095) [2760 bp, 919 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 919

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 78/341 (22%), Positives = 127/341 (37%), Gaps = 57/341 (16%)

Query: 51  EKMVLVIVDALRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLPRLKGITTGS 110
           +++ L++ D LR+D  F K +      H  L     +      N  T  +   + + T S
Sbjct: 49  KRLFLIVGDGLRADTTFDKILHPVTGEHDYLA---PYIRDLVRNEATYGVSHTR-MPTES 104

Query: 111 TPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLFPS------- 161
            P  +  I    ED   V+   +E       F    K    FG    L +F         
Sbjct: 105 RPGHVAMIAGFYEDVSAVTKGWQENPVDFDSFFNQSKHTYSFGSPDILPMFKDGATPNKV 164

Query: 162 -------EFFDETDGT---NSFFVSDFEEVDLNVTRHLPQQLQSQDSWDVLILHYLGLDH 211
                  EF D T  +   ++F      E+  N   +   + + +   +V  LH LG D 
Sbjct: 165 DAWMYGHEFEDFTQSSIELDAFVFRHIYELFNNTKSNKTLETEIKQDGNVFFLHLLGCDT 224

Query: 212 IGHKGGAFSS--FMPPKH--REMDAVIEQIYNAV-GEDTLICVMGDHGMNDLGNHGGSSA 266
            GH    +S+  +   K+  +E+  ++E+++     EDT      DHGM+  G+HG    
Sbjct: 225 AGHSYRPYSAEYYDNVKYIDKEVKLLVEKVHEFFDDEDTAFIFTADHGMSAFGSHGDGHP 284

Query: 267 GETSAALVFISKLLEKYEKPLAQQGQDI--PVASSSPEYNYLTK-----------VNQID 313
             T                PL   G  I  PV + +P ++  T+           VNQ D
Sbjct: 285 NNT--------------RTPLVAWGAGINKPVKNQAPIFDNYTENWNLADIKRNDVNQAD 330

Query: 314 FVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDN 354
               ++ L     P NS+G L  +F+   +P D K   + N
Sbjct: 331 IASLMSYLIGANYPVNSVGELPLNFID--APEDKKLNALFN 369

>KLTH0F04884g Chr6 complement(431251..434019) [2769 bp, 922 aa] {ON}
           highly similar to uniprot|P36051 Saccharomyces
           cerevisiae YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 922

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 113/332 (34%), Gaps = 68/332 (20%)

Query: 47  APKFEKMVLVIVDALRSDFVFQK-------DMSEFG-FLHKLLNKGHAWGYTAYSNPPTV 98
           AP  +++ L++ D LR+D  F K       + +    FL  L+     +G +    P   
Sbjct: 45  APPAKRLFLIVGDGLRADTTFDKITHPTTGETAHLAPFLRSLVLNNATYGVSHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWL 156
                    T S P  +  I    ED   V+   KE       F         FG    L
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDIL 152

Query: 157 KLFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLP---------QQLQSQ--DS 198
            +F     D        +  +FE       E+D  V RHL          ++L  Q    
Sbjct: 153 PMFKDGASDPNKVDAWMYGHEFEDFTQSSIELDAYVFRHLDNLFYNSTMDRELHEQIMQP 212

Query: 199 WDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV-----GEDTLICVMGDH 253
            +V  LH LG D  GH    +S       + +D  + ++   V      +DT      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSPEYYDNVKYIDDEVSKLVPKVRDFFGDDDTAFVFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK----- 308
           GM+  G+HG      T   L+                G + PV + +P Y+  T+     
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLI------------AWGAGLNRPVLNKAPIYDNYTEGWDLA 320

Query: 309 ------VNQIDFVPTIATLFNLPVPKNSIGVL 334
                 V Q D    +  L     P NS+G L
Sbjct: 321 NIQRNDVKQADIASLMTYLIGADYPANSVGEL 352

>TPHA0A02800 Chr1 complement(603610..606372) [2763 bp, 920 aa] {ON}
           Anc_1.184 YKL165C
          Length = 920

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/328 (23%), Positives = 124/328 (37%), Gaps = 50/328 (15%)

Query: 47  APKFEKMVLVIVDALRSDFVF----QKDMSEFGFLHK-----LLNKGHAWGYTAYSNPPT 97
           AP  +++ L++ D LR+D  F         E  +L       +LN G  +G  +++  PT
Sbjct: 45  APPAKRLFLIVGDGLRADTTFDLITHPVSGETAYLAPYIRSIVLNNG-TYG-ISHTRMPT 102

Query: 98  VTLP-----------RLKGITTG--STPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQ 144
            + P            +  +T G    P   D+  N      S    +     +Q     
Sbjct: 103 ESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQTNHTYSFGSPDILPMFKQGASDP 162

Query: 145 KKIKFFGDDTWLKLFPSEFFDETDGT---NSFFVSDFEEVDLNVTRHLPQQLQSQDSWDV 201
            KI     D W+  +  EF D +  +   ++F      E+  N T       Q +   + 
Sbjct: 163 NKI-----DAWM--YGHEFEDFSQSSLELDAFVFDHVNELFKNATLDSDLNEQIKQDGNC 215

Query: 202 LILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV----GED-TLICVMGDHGMN 256
             LH LG D  GH    +S+      + +D  I Q+   V    G+D T      DHGM+
Sbjct: 216 FFLHLLGCDTAGHSYRPYSAEYYDNVKYIDMQISQLVEKVNDFFGDDQTAFVFTADHGMS 275

Query: 257 DLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPE---YNYLTK--VNQ 311
             G+HG      T   LV     + K EK         P+ ++  E   ++Y+ +  V Q
Sbjct: 276 AFGSHGDGHPNNTRTPLVAWGAGINKPEK------HQYPIVNNYTESWGFDYIKRNDVKQ 329

Query: 312 IDFVPTIATLFNLPVPKNSIGVLIPDFL 339
            D    ++ L     P NS+G L   F+
Sbjct: 330 ADIASLMSYLIGTNYPANSVGELPISFI 357

>Kwal_33.13856 s33 complement(424296..427064) [2769 bp, 922 aa] {ON}
           YKL165C (MCD4) - (putative) involved in cell polarity
           [contig 108] FULL
          Length = 922

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 82/359 (22%), Positives = 125/359 (34%), Gaps = 72/359 (20%)

Query: 47  APKFEKMVLVIVDALRSDFVFQKDMSEFG--------FLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ L++ D LR+D  F+K              F+  L+     +G +    P   
Sbjct: 45  VPPAKRLFLIVGDGLRADTTFEKITHPVSGETAHLAPFIRSLVLNNATYGVSHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWL 156
                    T S P  +  I    ED   V+   KE       F         FG    L
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDIL 152

Query: 157 KLFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQSQ-----------DS 198
            +F     D        +  +FE       E+D  V RHL     +             S
Sbjct: 153 PMFKDGATDPHKVDAWMYGHEFEDFTQSSIELDAFVFRHLDNLFNTSTTNETLRQEITQS 212

Query: 199 WDVLILHYLGLDHIGHKGGAFSS--FMPPKH--REMDAVIEQIYNAVGED-TLICVMGDH 253
            +V  LH LG D  GH    +S+  +   K+  +E+  ++ ++ +  G+D T      DH
Sbjct: 213 GNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDQELSKLVVKVRDYFGDDDTAFIFTADH 272

Query: 254 GMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK----- 308
           GM+  G+HG      T   LV     L K            PV +  P Y+  T+     
Sbjct: 273 GMSAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVKNPVPIYDNYTEGWDLA 320

Query: 309 ------VNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLLSI 361
                 V Q D    ++ L     P NS+G L   ++     A  +TK+   Y    SI
Sbjct: 321 TIQRNDVKQADIASLMSYLIGANYPANSVGELPLSYIN----ASEETKLKALYSNARSI 375

>TBLA0C05840 Chr3 complement(1411740..1414583) [2844 bp, 947 aa]
           {ON} Anc_1.184 YKL165C
          Length = 947

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 80/362 (22%), Positives = 126/362 (34%), Gaps = 80/362 (22%)

Query: 48  PKFEKMVLVIVDALRSDFVFQKDMSEFG--------FLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F K              FL  ++ +   +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDKINHPITGETDYLAPFLRSIVLEEGTYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGD----- 152
                   T S P  +  I    ED   V+   KE       F    K    FG      
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVNFDSFFNQSKHTYSFGSPDILP 153

Query: 153 ------------DTWLKLFPSEFFDETDGT---NSFFVSDFEEVDLNVTRHLPQQLQSQD 197
                       DTW  ++  EF D T  +   +++      E+  N T +     + + 
Sbjct: 154 MFKDGASDINRIDTW--MYGHEFEDFTQSSIELDAYVFRHMNELFFNSTVNETLNYEIRQ 211

Query: 198 SWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV-----GEDTLICVMGD 252
             +V  LH LG D  GH    +S+      + +D ++ ++ + V       DT      D
Sbjct: 212 DGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDKMVSKLVDDVTTFFNDNDTAFIFTAD 271

Query: 253 HGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDI--PVASSSPEYNYLTK-- 308
           HGM+  G+HG      T                PL   G  I  PV +  P ++  T+  
Sbjct: 272 HGMSAFGSHGDGHPNNT--------------RTPLIAWGAGINKPVKNEVPIFDNYTEGW 317

Query: 309 ---------VNQIDFVPTIATLFNLPVPKNSIGVLIPDFLKLLSPADAKTKVIDNYQQLL 359
                    V Q D    ++ L     P NS+G L  +++K    AD   K+   Y    
Sbjct: 318 NLGSIKRNDVKQADIASLMSYLIGANYPANSVGELPMNYIK----ADESVKLHALYNNAK 373

Query: 360 SI 361
           SI
Sbjct: 374 SI 375

>TBLA0E01480 Chr5 complement(337267..340389) [3123 bp, 1040 aa] {ON}
           Anc_4.28 YLL031C
          Length = 1040

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 80/190 (42%), Gaps = 47/190 (24%)

Query: 95  PPTVTLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDT 154
           PPT TL R+K IT GS P+F+D  +         ++ E+D+ L+Q  ++ + I F GD  
Sbjct: 151 PPTDTLQRVKCITGGSVPSFIDTGITFY-----GSMIEEDNILKQMYLNNRSIYFTGDKF 205

Query: 155 WLKLFPSEFFDETDGTNSF--FVSDFEEVDLNVTRHLPQQLQSQD--------------- 197
           W  L+ S++F      N+    +  F+++  +      +  +S D               
Sbjct: 206 WNSLY-SKYFQNFKLANNIDDIIDYFQKITTSTNHSYGESNRSSDKPISLDTNLLQNISS 264

Query: 198 --------------SWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGE 243
                          WD+LI H +  D +  K             ++++ +    N++  
Sbjct: 265 IPTISNATVTTPSKDWDILIGHIME-DTMNEK---------VTQLKVNSFLNDTINSIDN 314

Query: 244 DTLICVMGDH 253
           DTL+ V+GD+
Sbjct: 315 DTLLLVLGDY 324

>Smik_11.64 Chr11 complement(123662..126499) [2838 bp, 945 aa] {ON}
           YKL165C (REAL)
          Length = 945

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 121/330 (36%), Gaps = 66/330 (20%)

Query: 48  PKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F K        +EF   ++  L+     +G  +++  PT +
Sbjct: 72  PPAKRLFLIVGDGLRADTTFDKVTHPVTGKTEFLAPYIRSLVMNNATYG-ISHTRMPTES 130

Query: 100 LPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKLF 159
            P    +  G    F + +  V +    SN    DS+  Q   H      FG    L +F
Sbjct: 131 RPGHVAMIAG----FYEDVSAVTKG-WKSNPVNFDSFFNQ-STHTYS---FGSPDILPMF 181

Query: 160 PSEFFDET-------DGTNSFFVSDFEEVDLNVTRHLPQQLQS------------QDSWD 200
                D         D T   F     E+D  V RHL +   +            QD  +
Sbjct: 182 KDGASDPNRVDTWMYDHTFEDFTQSSIELDAYVFRHLNELFHNSTLNSTLDYEIRQDG-N 240

Query: 201 VLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVG-----EDTLICVMGDHGM 255
           V  LH LG D  GH    +S+      + +D  I  + + V      + T      DHGM
Sbjct: 241 VFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTADHGM 300

Query: 256 NDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLT-------- 307
           +  G+HG      T   LV     L K            PV +S P ++  T        
Sbjct: 301 SAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVQNSFPVFDNYTDNWELSNI 348

Query: 308 ---KVNQIDFVPTIATLFNLPVPKNSIGVL 334
               V Q D    ++ L  +  PKNS+G L
Sbjct: 349 KRNDVKQADIASLMSYLIGVNYPKNSVGEL 378

>YKL165C Chr11 complement(137932..140691) [2760 bp, 919 aa] {ON}
           MCD4Protein involved in glycosylphosphatidylinositol
           (GPI) anchor synthesis; multimembrane-spanning protein
           that localizes to the endoplasmic reticulum; highly
           conserved among eukaryotes
          Length = 919

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 122/325 (37%), Gaps = 54/325 (16%)

Query: 47  APKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ L++ D LR+D  F K        +EF   F+  L+     +G  +++  PT 
Sbjct: 45  TPPAKRLFLIVGDGLRADTTFDKVTHPVSGKTEFLAPFIRSLVMNNATYG-ISHTRMPTE 103

Query: 99  TLPRLKGITTGSTPNFLDAILNVAEDDVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLKL 158
           + P    +  G    F + +  V +    SN    DS+  Q   H      FG    L +
Sbjct: 104 SRPGHVAMIAG----FYEDVSAVTKG-WKSNPVNFDSFFNQ-STHTYS---FGSPDILPM 154

Query: 159 FPSEFFDET-------DGTNSFFVSDFEEVDLNVTRHLPQQLQS------------QDSW 199
           F     D         D T   F     E+D  V RHL Q   +            QD  
Sbjct: 155 FKDGASDPNKVDTWMYDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNSTLDYEIRQDG- 213

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVG-----EDTLICVMGDHG 254
           +V  LH LG D  GH    +S+      + +D  I  + + V      + T      DHG
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTADHG 273

Query: 255 MNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK-----V 309
           M+  G+HG      T   LV     L    KP+       PV+ +  E   L+      V
Sbjct: 274 MSAFGSHGDGHPNNTRTPLVAWGAGL---NKPVHNP---FPVSDNYTENWELSSIKRNDV 327

Query: 310 NQIDFVPTIATLFNLPVPKNSIGVL 334
            Q D    ++ L  +  PKNS+G L
Sbjct: 328 KQADIASLMSYLIGVNYPKNSVGEL 352

>ZYRO0G18458g Chr7 (1522413..1525178) [2766 bp, 921 aa] {ON} highly
           similar to uniprot|P36051 Saccharomyces cerevisiae
           YKL165C MCD4 Protein involved in
           glycosylphosphatidylinositol (GPI) anchor synthesis
           multimembrane-spanning protein that localizes to the
           endoplasmic reticulum highly conserved among eukaryotes
          Length = 921

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 118/340 (34%), Gaps = 76/340 (22%)

Query: 48  PKFEKMVLVIVDALRSDFVFQ------KDMSEF--GFLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F           EF   F+  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDYVRHPATGKKEFLAPFIRSLVLNNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQ----DSWLRQFRMHQKKIKFFGDD 153
                   T S P  +  I    ED   V+   KE     DS   Q          FG  
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSCFNQ----STHTYSFGSP 149

Query: 154 TWLKLFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQS----------- 195
             L +F     D        +  +FE       E+D  V +HL     +           
Sbjct: 150 DILPMFKDGASDPNRVDAWMYGHEFEDFTQSSIEMDAFVFKHLDDLFHNSTINNTLNNEI 209

Query: 196 QDSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDA----VIEQIYNAVGED-TLICVM 250
           +   +V  LH LG D  GH    +S+      + +D     ++EQ+ +  G+D T     
Sbjct: 210 RHDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDGKVETLVEQVRDFFGDDETAFVFT 269

Query: 251 GDHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK-- 308
            DHGM+  G+HG      T   LV     L K            PV +  P Y+  T+  
Sbjct: 270 ADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVHNLKPVYDNYTQGW 317

Query: 309 ---------VNQIDFVPTIATLFNLPVPKNSIGVLIPDFL 339
                    V Q D    ++ L     P NS+G L  D++
Sbjct: 318 DLSHIKRHDVKQADIASLMSYLIGANYPANSVGELPLDYI 357

>KAFR0G00500 Chr7 complement(134741..137509) [2769 bp, 922 aa] {ON}
           Anc_1.184 YKL165C
          Length = 922

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/328 (22%), Positives = 123/328 (37%), Gaps = 60/328 (18%)

Query: 47  APKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ L++ D LR+D  F+K        +E+   F+  L+     +G +    P   
Sbjct: 45  TPPAKRLFLIVGDGLRADTTFEKVTHPVTGKTEYLAPFIRSLVLNNATYGVSHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQ----DSWLRQFRM-----HQKKI 147
                    T S P  +  I    ED   V+   KE     DS+  Q R          +
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSRHTYSFGSPDIL 152

Query: 148 KFFGD--------DTWLKLFPSEFFDETDGT---NSFFVSDFEEVDLNVTRHLPQQLQSQ 196
             F D        D W+  +  EF D T  +   +++   + +E+  N T       + +
Sbjct: 153 PMFKDGASDPNKVDAWM--YGHEFEDFTQSSIELDAYVFRNLDELFYNSTIDATLDFEIK 210

Query: 197 DSWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMDA----VIEQIYNAVGED-TLICVMG 251
              +V  LH LG D  GH    +S+      + +D     +I ++++   +D T      
Sbjct: 211 QEGNVFFLHLLGCDTAGHSYRPYSAEYYDNIKYIDEQLSILIPKVHDFFNDDDTAFIFTA 270

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLT---- 307
           DHGM+  G+HG      T   LV     L K       Q   +P+  +  E   L+    
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLVAWGAGLNK------PQINKVPIYDNYTESWNLSHIKR 324

Query: 308 -KVNQIDFVPTIATLFNLPVPKNSIGVL 334
             V Q D    ++ L     P NS+G L
Sbjct: 325 NDVKQADIASLMSYLIGTNYPVNSVGEL 352

>Kpol_2001.28 s2001 (81621..83408,83411..84382) [2760 bp, 919 aa]
           {ON} (81621..83408,83411..84382) [2760 nt, 920 aa]
          Length = 919

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 117/333 (35%), Gaps = 70/333 (21%)

Query: 47  APKFEKMVLVIVDALRSDFVFQK------DMSEF--GFLHKLLNKGHAWGYTAYSNPPTV 98
            P  +++ LV+ D LR+D  F K        +E+   F+  L+     +G +    P   
Sbjct: 45  TPPAKRLFLVVGDGLRADTTFDKITHPVTGKTEYLAPFIRSLVLNNGTYGISHTRMP--- 101

Query: 99  TLPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWL 156
                    T S P  +  I    ED   V+   KE       F         FG    L
Sbjct: 102 ---------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSVHTYSFGSPDIL 152

Query: 157 KLFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQS------------QD 197
            +F     D +      +  +FE       E+D  V  HL    ++            QD
Sbjct: 153 PMFKDGASDPSRVDAWMYGHEFEDFTQSSIELDAFVFNHLDTLFKNSTTNNTLNAEIRQD 212

Query: 198 SWDVLILHYLGLDHIGHKGGAFSSFMPPKHREMD----AVIEQIYNAVGED-TLICVMGD 252
             +V  LH LG D  GH    +S+      + +D     +++++    G+D T      D
Sbjct: 213 G-NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDNQVSVLVDKVREFFGDDETAFVFTAD 271

Query: 253 HGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK---- 308
           HGM+  G+HG      T   LV                G + PV +  P Y+  T+    
Sbjct: 272 HGMSAFGSHGDGHPNNTRTPLV------------AWGAGVNKPVRNEYPIYDNYTEGWNL 319

Query: 309 -------VNQIDFVPTIATLFNLPVPKNSIGVL 334
                  V Q D    ++ L  +  P NS+G L
Sbjct: 320 ADIKRNDVKQADIASLMSYLIGVNYPSNSVGEL 352

>KNAG0C01080 Chr3 complement(209716..212511) [2796 bp, 931 aa] {ON}
           Anc_1.184 YKL165C
          Length = 931

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/334 (21%), Positives = 117/334 (35%), Gaps = 74/334 (22%)

Query: 48  PKFEKMVLVIVDALRSDFVFQ------KDMSEF--GFLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F          +E+   ++  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDMITHPVTGKTEYLAPYIRSLVENNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLK 157
                   T S P  +  I    ED   V+   KE       F         FG    L 
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILP 153

Query: 158 LFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQL-----------QSQDSW 199
           +F     D        +  +FE       E+D  V  H+ Q             + + + 
Sbjct: 154 MFKDGASDHNKVDAWMYGHEFEDFTQSSIELDAYVFNHMDQLFYNSTVNRTLDNEIRQNG 213

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKH-------REMDAVIEQIYNAVGED-TLICVMG 251
           +V  LH LG D  GH   ++  + P  +       RE++ ++++++N   +D T      
Sbjct: 214 NVFFLHLLGCDTAGH---SYRPYSPEYYDNVKYIDREVEKLMDKVHNFFDDDDTAFIFTA 270

Query: 252 DHGMNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK--- 308
           DHGM+  G+HG      T   LV                G + P  +  P Y+  TK   
Sbjct: 271 DHGMSAFGSHGDGHPNNTRTPLV------------AWGAGLNRPKLNDVPIYDNYTKPWN 318

Query: 309 --------VNQIDFVPTIATLFNLPVPKNSIGVL 334
                   V Q D    ++ L     P NS+G L
Sbjct: 319 LSHIQRNDVKQADIASLMSYLIGANYPVNSVGEL 352

>NCAS0B08260 Chr2 (1574633..1577407) [2775 bp, 924 aa] {ON}
           Anc_1.184 YKL165C
          Length = 924

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 114/331 (34%), Gaps = 68/331 (20%)

Query: 48  PKFEKMVLVIVDALRSDFVFQ------KDMSEF--GFLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F          +EF   ++  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDMITHPVTGKTEFLAPYIRSLVLNNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLK 157
                   T S P  +  I    ED   V+   KE       F         FG    L 
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSSHTYSFGSPDILP 153

Query: 158 LFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQS-----------QDSW 199
           +F     D        +  ++E       E+D  V RHL     +           +   
Sbjct: 154 MFKEGATDPHKVDAWMYGHEYEDFTQSSIELDAYVFRHLDSLFHNSTLDSTLDHEIRQEG 213

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMDA----VIEQIYNAVGED-TLICVMGDHG 254
           +V  LH LG D  GH    +S+      + +D     ++++++   G+D T      DHG
Sbjct: 214 NVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDEQVSILVDKVHTFFGDDDTAFIFTADHG 273

Query: 255 MNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASSSPEYNYLTK------ 308
           M+  G+HG      T   LV     L K            PV +  P Y+  T+      
Sbjct: 274 MSAFGSHGDGHPNNTRTPLVAWGAGLNK------------PVKNEVPIYDNYTESWKLAD 321

Query: 309 -----VNQIDFVPTIATLFNLPVPKNSIGVL 334
                V Q D    ++ L     P NS+G L
Sbjct: 322 IKRNDVKQADITSLMSYLIGTNYPANSVGEL 352

>TDEL0C03690 Chr3 (648638..651400) [2763 bp, 920 aa] {ON} Anc_1.184
           YKL165C
          Length = 920

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 115/325 (35%), Gaps = 56/325 (17%)

Query: 48  PKFEKMVLVIVDALRSDFVFQ------KDMSEF--GFLHKLLNKGHAWGYTAYSNPPTVT 99
           P  +++ L++ D LR+D  F          +E+   ++  L+     +G +    P    
Sbjct: 46  PPAKRLFLIVGDGLRADTTFDLITHPTSGKTEYLAPYIRSLVLNNATYGISHTRMP---- 101

Query: 100 LPRLKGITTGSTPNFLDAILNVAED--DVSSNLKEQDSWLRQFRMHQKKIKFFGDDTWLK 157
                   T S P  +  I    ED   V+   KE       F         FG    L 
Sbjct: 102 --------TESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSAHTYSFGSPDILP 153

Query: 158 LFPSEFFDETDGTNSFFVSDFE-------EVDLNVTRHLPQQLQ--SQDS---------W 199
           +F     D +      +  +FE       E+D  V RHL       ++DS          
Sbjct: 154 MFKEGASDPSRVDTWTYGHEFEDFTQSSIELDAYVFRHLDDLFHNSTRDSTLNDEIRGDG 213

Query: 200 DVLILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAV-----GEDTLICVMGDHG 254
           +V+ LH LG D  GH    +S+      + +D  +  + + V      +DT      DHG
Sbjct: 214 NVVFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQVSMLSDKVRSFFGDDDTAFIFTADHG 273

Query: 255 MNDLGNHGGSSAGETSAALVFISKLLEKYEKPLAQQGQDIPVASS-----SPEYNYLTKV 309
           M+  G+HG      T   LV     L    KPL     D PV  +       E      V
Sbjct: 274 MSAFGSHGDGHPNNTRTPLVAWGAGL---NKPLK---NDYPVFDNYTFTWGLEDVQRHDV 327

Query: 310 NQIDFVPTIATLFNLPVPKNSIGVL 334
            Q D    ++ L  +  P NS+G L
Sbjct: 328 KQADIASLMSYLIGVNYPANSVGEL 352

>KLLA0F21714g Chr6 (2020262..2022271) [2010 bp, 669 aa] {ON}
           conserved hypothetical protein
          Length = 669

 Score = 38.1 bits (87), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 12/83 (14%)

Query: 204 LHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGMNDLGNHGG 263
           L +L +  +GH    F SF+    + ++++I Q    +GED  + +MG       G  G 
Sbjct: 210 LRHLPIARLGHYKVFFDSFL----KSIESLILQTDTTIGEDNAMDLMGK------GQKGE 259

Query: 264 SSAGETSAALVFISKLLEKYEKP 286
           +  G  SAAL  +S L E+Y  P
Sbjct: 260 TKCG--SAALKILSALKEEYAVP 280

>KLLA0A11374g Chr1 complement(985471..987336) [1866 bp, 621 aa] {ON}
           some similarities with uniprot|P25353 Saccharomyces
           cerevisiae YCR026C NPP1
          Length = 621

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 73/175 (41%), Gaps = 20/175 (11%)

Query: 96  PTVTLPRLKGITTGSTPNFLDAILNV---AEDDVSSNLKEQDSWLRQFRMHQKKIKFFGD 152
           P+ T P    + TG  P+    I N    +++DV   + +  S +  F      + FF +
Sbjct: 181 PSQTFPNHWTMITGQFPHHHGIIANRFWDSKNDVEFQINDISSRMNTFWNQSYPLWFFTN 240

Query: 153 D----TWLKLFP-SEFFDETDGTNSFFVSDFEEVDLNVTRHLPQQLQS-----QDSWDVL 202
           +    T   ++P SE        N   V  F     N+   L  +L +     Q+    L
Sbjct: 241 EIHLNTHTHMWPGSEQIHSDPLRNPTIVDSF-----NIDEPLNDKLNTIRTALQNESTTL 295

Query: 203 ILHYLGL-DHIGHK-GGAFSSFMPPKHREMDAVIEQIYNAVGEDTLICVMGDHGM 255
              Y+ + D +GHK G    S      +E+D  +EQ++  V E+  I V+ DHGM
Sbjct: 296 TFAYVPVVDTMGHKYGNLIDSGHSKVLKEVDDFLEQLFADVDENVNILVISDHGM 350

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 4/88 (4%)

Query: 42  AHRRMAPKFEKMVLVIVDALRSDFVFQKDMSEFGFLHKLLNKGHAWGYTAYSNPPTVTLP 101
           +H +    F +M+LV      SD+  +KD   F    +   + +    T  + P  V L 
Sbjct: 179 SHLQQTGLFGQMLLVNQKNCSSDY-LKKDDQVFALRERKTLRNNTTVSTTANTPDVVDL- 236

Query: 102 RLKGITTGSTPNFLDAILNVAEDDVSSN 129
             K +  GS+ + +D +LN  +DD+  N
Sbjct: 237 --KALNNGSSASLVDEVLNKNDDDIDFN 262

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,886,472
Number of extensions: 3540639
Number of successful extensions: 9286
Number of sequences better than 10.0: 70
Number of HSP's gapped: 9245
Number of HSP's successfully gapped: 79
Length of query: 810
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 692
Effective length of database: 39,950,811
Effective search space: 27645961212
Effective search space used: 27645961212
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 70 (31.6 bits)