Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H10714g1.318ON1061065512e-74
Kwal_14.25861.318ON1061064133e-53
SAKL0D06952g1.318ON1071023631e-45
KLLA0F01683g1.318ON98973445e-43
Ecym_62891.318ON1031013012e-36
ZYRO0G20702g1.318ON1401063042e-36
TDEL0D018701.318ON1001002917e-35
Kpol_1035.251.318ON1061062919e-35
AEL167C1.318ON101982901e-34
TPHA0O014701.318ON100902701e-31
YBR268W (MRPL37)1.318ON105992562e-29
NDAI0B047701.318ON1131102545e-29
CAGL0I09372g1.318ON1031062492e-28
Suva_4.5291.318ON1051022474e-28
Smik_2.4111.318ON105992459e-28
NCAS0B074401.318ON110792381e-26
Skud_2.4001.318ON1051022362e-26
KAFR0C042101.318ON1011022328e-26
KNAG0C017701.318ON101852265e-25
TBLA0F013201.318ON111771972e-20
Skud_15.551na 1ON69430690.34
TPHA0A002205.152ON58563670.67
ZYRO0E09768g3.576ON66357641.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H10714g
         (106 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...   216   2e-74
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...   163   3e-53
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...   144   1e-45
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...   137   5e-43
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...   120   2e-36
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   121   2e-36
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   116   7e-35
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   116   9e-35
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...   116   1e-34
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   108   1e-31
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...   103   2e-29
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...   102   5e-29
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...   100   2e-28
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...   100   4e-28
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    99   9e-28
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    96   1e-26
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    96   2e-26
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    94   8e-26
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    92   5e-25
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    80   2e-20
Skud_15.551 Chr15 (1000691..1002775) [2085 bp, 694 aa] {ON} YOR3...    31   0.34 
TPHA0A00220 Chr1 (25205..26962) [1758 bp, 585 aa] {ON} Anc_5.152...    30   0.67 
ZYRO0E09768g Chr5 complement(774077..776068) [1992 bp, 663 aa] {...    29   1.9  

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score =  216 bits (551), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 106/106 (100%), Positives = 106/106 (100%)

Query: 1   MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEY 60
           MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEY
Sbjct: 1   MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEY 60

Query: 61  PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI
Sbjct: 61  PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score =  163 bits (413), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 80/106 (75%), Positives = 85/106 (80%)

Query: 1   MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEY 60
           M   +  L  K+  S   A  Q QK S SG+ SSC AGTPLNLQIKKSGKEPVALEDHEY
Sbjct: 1   MLTQIHRLVVKKPFSTFSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEY 60

Query: 61  PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           PEWLW+VLD +AQLKKLQEDPLKLRKKQLRSANR KIKQNNFLSEI
Sbjct: 61  PEWLWSVLDDKAQLKKLQEDPLKLRKKQLRSANRQKIKQNNFLSEI 106

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score =  144 bits (363), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 72/102 (70%), Positives = 81/102 (79%), Gaps = 2/102 (1%)

Query: 7   NLTSKRALSVSRATFQGQKASP--SGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWL 64
           +L S+R LS +R T Q Q A+   S V SSCPAGTPLNLQIKKSGKE VALEDHEYPEWL
Sbjct: 6   HLASRRFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHEYPEWL 65

Query: 65  WTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           WTVLD +AQ  KL +DP KL+KKQLR  NR KIKQNNFL++I
Sbjct: 66  WTVLDEKAQSAKLAQDPAKLKKKQLRKMNREKIKQNNFLTKI 107

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score =  137 bits (344), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 4/97 (4%)

Query: 14  LSVSRATFQGQKASPSG----VVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLD 69
           L V+R  F   K+  SG    +VSSCPAGTPLNLQIKKSGKEPVALED EYPEWLWTVLD
Sbjct: 2   LRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLD 61

Query: 70  SRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           +  Q +KL  DP+KLRKKQLR ANR  IKQNNFL++I
Sbjct: 62  ANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score =  120 bits (301), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 73/101 (72%), Gaps = 6/101 (5%)

Query: 8   LTSKRALSVSR--ATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLW 65
           + +KR +S +   A  +G KA    ++SSCPAGTPLNLQIKK+GKEPVAL + EYPEWLW
Sbjct: 7   IINKRLISTTLRLAEQKGSKA----IISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLW 62

Query: 66  TVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
            VLD + +  KL EDP   RKKQLR  NR KIKQNNFLS I
Sbjct: 63  GVLDPQVEAAKLNEDPFAARKKQLRKMNREKIKQNNFLSRI 103

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score =  121 bits (304), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 75/106 (70%), Gaps = 8/106 (7%)

Query: 1   MFANLRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEY 60
           MF  LR L  +R +S S    Q  K       SSCPAGT +N+  KKSGK+PVALED+EY
Sbjct: 43  MFQLLR-LFPRRFVSTSPVLGQAVK-------SSCPAGTIINVNTKKSGKDPVALEDNEY 94

Query: 61  PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           P+WLW VLD  AQ+KKLQ DP+KLRKKQLR  NR KIKQNNFL +I
Sbjct: 95  PDWLWEVLDPEAQMKKLQADPMKLRKKQLRKDNREKIKQNNFLKQI 140

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  116 bits (291), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 4/100 (4%)

Query: 8   LTSKRALSVSRATFQGQKASPSGVV-SSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWT 66
              KR  S  R   Q    +PS +V SSCPAGT L++ +KKSGK+PVALED EYP WLW 
Sbjct: 4   FVPKRLFSNCRVFLQ---ETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWE 60

Query: 67  VLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           VLD  A+ +KL EDP+KLRKKQ+R ANR +IKQNNFL ++
Sbjct: 61  VLDPEARARKLAEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  116 bits (291), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 74/106 (69%), Gaps = 5/106 (4%)

Query: 5   LRNLTSKRALSVSRATFQGQKASPSG----VVSSCPAGTPLNLQIKKSGKEPVALEDHEY 60
           L+ +  KR LS SR  +Q +    SG    + SSCPAG+ L L IKK+GK+PVALED EY
Sbjct: 2   LKQIFQKRLLSSSRLLWQ-ETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEY 60

Query: 61  PEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           P WLWTVLD  AQ + L +DPL LRKK+LR ANR  IKQNNFL +I
Sbjct: 61  PTWLWTVLDKEAQAEALSKDPLALRKKKLRQANRKNIKQNNFLKQI 106

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score =  116 bits (290), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 69/98 (70%), Gaps = 7/98 (7%)

Query: 11  KRALSVSRATF--QGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVL 68
           +R  SVS   +  Q QKA     VSSCPAGTPLNL IKK GKEP+ALED +YPEWLW VL
Sbjct: 9   RRLFSVSCRVYDQQAQKA-----VSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVL 63

Query: 69  DSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           D  AQ  KL EDP+K RKK LR  NR  IKQ NFL+++
Sbjct: 64  DPEAQAAKLAEDPIKARKKALRRMNREHIKQQNFLAKM 101

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  108 bits (270), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 66/90 (73%)

Query: 17  SRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKK 76
           SR +   Q++  + + SSC AGTPL + + K+GK+P+ALED EYP WLWTVLD  AQ  +
Sbjct: 11  SRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAAR 70

Query: 77  LQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           L+ DPLKLR+K+LR  NR  IKQNNFL +I
Sbjct: 71  LENDPLKLRRKELRRKNRANIKQNNFLKQI 100

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score =  103 bits (256), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 67/99 (67%), Gaps = 6/99 (6%)

Query: 12  RALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSR 71
           R +S SR  +   K +   VVSSCPAGT LNL I KSGK+ VALED EYP WLW+VLDS 
Sbjct: 9   RLISTSRILYN--KPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWSVLDSD 66

Query: 72  AQLKKLQEDP----LKLRKKQLRSANRNKIKQNNFLSEI 106
             ++   EDP    L  R+K +R ANR +IKQNNFLS++
Sbjct: 67  HVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score =  102 bits (254), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 68/110 (61%), Gaps = 11/110 (10%)

Query: 8   LTSKRALSVSRATFQGQKASPSGVVS----SCPAGTPLNLQIKKSGKEPVALEDHEYPEW 63
           L  KR+ S S      +    S + S    SC AGTPLNL IKK+GKEP+ALED EYPEW
Sbjct: 4   LFVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEYPEW 63

Query: 64  LWTVLDSRAQLKKLQ-------EDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           LWTVLD++    + +       E+ L  RK+QLR   R KIKQNNFLS+I
Sbjct: 64  LWTVLDTKTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score =  100 bits (249), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 57/106 (53%), Positives = 71/106 (66%), Gaps = 8/106 (7%)

Query: 5   LRNLTSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWL 64
           LR L +KR LS S       K     + SSC AGTPL+L +KK+GK+PVALED EYPEWL
Sbjct: 2   LRLLFTKRLLSSSVVLRNEAKQ----IKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWL 57

Query: 65  WTVLD----SRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
           WTVLD    + A    + E+ LK RKKQ+R +NR KIKQ NFL+++
Sbjct: 58  WTVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 99.8 bits (247), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 54/102 (52%), Positives = 65/102 (63%), Gaps = 6/102 (5%)

Query: 9   TSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVL 68
            S R LS SR  +  Q      V SSCPAGT LNL I KSGK+  ALED EYP WLW+VL
Sbjct: 6   VSCRWLSTSRVFYNKQAVKV--VASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWSVL 63

Query: 69  DSRAQLKKLQEDP----LKLRKKQLRSANRNKIKQNNFLSEI 106
           D++  +    +DP    L  RKK +R ANR +IKQNNFLS++
Sbjct: 64  DAKQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 99.0 bits (245), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 66/99 (66%), Gaps = 6/99 (6%)

Query: 12  RALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSR 71
           R +S SR  F   K +   VVSSCPAGT LNL I KSGK+ VALED EYP WLW +L++ 
Sbjct: 9   RFISTSRVLFN--KPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNE 66

Query: 72  AQLKKLQEDP----LKLRKKQLRSANRNKIKQNNFLSEI 106
             ++   +DP    L  R+K +R ANR +IKQNNFLS++
Sbjct: 67  QTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 96.3 bits (238), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%), Gaps = 3/79 (3%)

Query: 31  VVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRA--QLKKLQE-DPLKLRKK 87
           + SSC AGT LNL IKK+GK+P+ALED+EYP WLW VL+S+A  +   L E + L +RKK
Sbjct: 31  IKSSCLAGTSLNLNIKKNGKDPIALEDNEYPAWLWKVLESKAPKEASDLSEQEVLAMRKK 90

Query: 88  QLRSANRNKIKQNNFLSEI 106
           QLR  NR KIKQNNFLS++
Sbjct: 91  QLRKENRKKIKQNNFLSQL 109

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 95.5 bits (236), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 67/102 (65%), Gaps = 6/102 (5%)

Query: 9   TSKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVL 68
            S R +S SR  +  Q      VVSSCPAGT LNL I KSGK+ +ALE+ EYP WLW+VL
Sbjct: 6   VSYRWISTSRVLYNKQAVKT--VVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVL 63

Query: 69  DSRAQLKKLQED----PLKLRKKQLRSANRNKIKQNNFLSEI 106
           D++  ++   +D     L  R+K +R ANR +IKQ+NFLS++
Sbjct: 64  DNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 94.0 bits (232), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 52/102 (50%), Positives = 69/102 (67%), Gaps = 10/102 (9%)

Query: 10  SKRALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVL- 68
           S+R  S SR+  Q  K     +VSSCP GTPL L ++K  K P+AL+D EYP WLW+VL 
Sbjct: 5   SRRFFSHSRSVLQSTKCL---LVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLN 61

Query: 69  ----DSRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106
               +++ +L  +QE  L+LR+KQLR  NR+KIKQ NFLSE+
Sbjct: 62  EESANTQKELSPIQE--LELRRKQLRKLNRDKIKQKNFLSEL 101

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 91.7 bits (226), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 44/85 (51%), Positives = 59/85 (69%), Gaps = 1/85 (1%)

Query: 23  GQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLD-SRAQLKKLQEDP 81
           GQ A    V SSC AGTPL L I+K G++PVA+ D EYPEWLW VL+ +       + DP
Sbjct: 17  GQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLEPATGGDASARADP 76

Query: 82  LKLRKKQLRSANRNKIKQNNFLSEI 106
           L  R+K+LR  +RN+IKQ+N+LS++
Sbjct: 77  LAARRKELRRKHRNEIKQSNYLSQL 101

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 50/77 (64%)

Query: 30  GVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDPLKLRKKQL 89
            + SSCPAGT L L + K GK+PVALED +YP WLW++L           + +  RKK L
Sbjct: 34  AIKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPMEAIAQRKKVL 93

Query: 90  RSANRNKIKQNNFLSEI 106
           R  NR++IKQNNFL ++
Sbjct: 94  RKNNRDRIKQNNFLKQL 110

>Skud_15.551 Chr15 (1000691..1002775) [2085 bp, 694 aa] {ON} YOR384W
           (REAL)
          Length = 694

 Score = 31.2 bits (69), Expect = 0.34,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 40  PLNLQIKKSGKEPVALEDHEYPEWLWTVLD 69
           PL++ IK +G+EP + EDH+  +++W++ D
Sbjct: 546 PLSMAIK-AGREPKSGEDHQIMKFVWSIRD 574

>TPHA0A00220 Chr1 (25205..26962) [1758 bp, 585 aa] {ON} Anc_5.152
           YGR194C
          Length = 585

 Score = 30.4 bits (67), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 35  CPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQ----LKKLQEDPLKLRKKQLR 90
           C   TPL  +    G     +E+H Y + L +++DS+ Q     KKL  DP+   KK L 
Sbjct: 200 CGKLTPLE-ESDACGMNLYDIENHCYDKQLISLIDSKNQGSDLTKKLLGDPISSTKKPLW 258

Query: 91  SAN 93
           +AN
Sbjct: 259 TAN 261

>ZYRO0E09768g Chr5 complement(774077..776068) [1992 bp, 663 aa] {ON}
           weakly similar to uniprot|P53061 Saccharomyces
           cerevisiae YGL249W ZIP2 Required for 'ZIPpering' up
           meiotic chromosomes during chromosome synapsis involved
           in meiotic recombination and disjunction
          Length = 663

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 42  NLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDPLKLRKKQLRSANRNKIK 98
           NLQ   S KE + LED     ++W    S++Q   +Q DP+  RK +L+     KIK
Sbjct: 94  NLQNFHSPKEKLKLEDESKRLFVWLTDLSKSQ---IQHDPIARRKNRLQGRESFKIK 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.127    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,795,469
Number of extensions: 425441
Number of successful extensions: 1298
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1288
Number of HSP's successfully gapped: 33
Length of query: 106
Length of database: 53,481,399
Length adjustment: 76
Effective length of query: 30
Effective length of database: 44,766,783
Effective search space: 1343003490
Effective search space used: 1343003490
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)