Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H10692g1.319ON69169133270.0
Kwal_14.25801.319ON68769216880.0
SAKL0D06930g1.319ON69070010971e-140
TDEL0D018801.319ON6917178006e-96
Suva_6.1371.319ON7187267931e-94
Smik_10.1791.319ON7137187877e-94
YJL061W (NUP82)1.319ON7137247861e-93
NDAI0G057501.319ON7347327661e-90
ZYRO0G20680g1.319ON6927037472e-88
NCAS0A092101.319ON7107217311e-85
Skud_10.1581.319ON7167227204e-84
KAFR0A017201.319ON7167267125e-83
Ecym_62901.319ON6717086431e-73
TBLA0F013101.319ON7427416289e-71
AEL168C1.319ON6736996241e-70
Kpol_1035.241.319ON7177245873e-65
KNAG0C058401.319ON7476725832e-64
TPHA0O014601.319ON7217275523e-60
CAGL0J05214g1.319ON7167115382e-58
KLLA0F01661g1.319ON6876673845e-38
Ecym_46198.850ON48774820.25
Ecym_31521.515ON246097743.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H10692g
         (691 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...  1286   0.0  
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   654   0.0  
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   427   e-140
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   312   6e-96
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   310   1e-94
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   307   7e-94
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   307   1e-93
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   299   1e-90
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   292   2e-88
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   286   1e-85
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   281   4e-84
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   278   5e-83
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   252   1e-73
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   246   9e-71
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   244   1e-70
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   230   3e-65
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   229   2e-64
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   217   3e-60
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   211   2e-58
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   152   5e-38
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...    36   0.25 
Ecym_3152 Chr3 complement(280175..287557) [7383 bp, 2460 aa] {ON...    33   3.3  

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score = 1286 bits (3327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/691 (91%), Positives = 633/691 (91%)

Query: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISN 60
           MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISN
Sbjct: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISN 60

Query: 61  YTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCLT 120
           YTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCLT
Sbjct: 61  YTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCLT 120

Query: 121 VLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSE 180
           VLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSE
Sbjct: 121 VLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSE 180

Query: 181 GADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSSLYN 240
           GADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSSLYN
Sbjct: 181 GADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSSLYN 240

Query: 241 QPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAXXXXXXXX 300
           QPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIA        
Sbjct: 241 QPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIALEDETTEL 300

Query: 301 XXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSCFVLISAE 360
                       CFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSCFVLISAE
Sbjct: 301 LLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSCFVLISAE 360

Query: 361 KAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLLS 420
           KAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLLS
Sbjct: 361 KAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLLS 420

Query: 421 EKEITSIDISSMQTPASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVI 480
           EKEITSIDISSMQTPASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVI
Sbjct: 421 EKEITSIDISSMQTPASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVI 480

Query: 481 PAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDV 540
           PAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQT          GQQDELAQHLRDV
Sbjct: 481 PAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDV 540

Query: 541 SELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAE 600
           SELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAE
Sbjct: 541 SELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAE 600

Query: 601 MEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVP 660
           MEWFKELRNQVVRFNRLVHEQQD             YVRVD               GGVP
Sbjct: 601 MEWFKELRNQVVRFNRLVHEQQDLAEALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVP 660

Query: 661 WDELQAMLAKDSRIIKECQAELQCTTQELDS 691
           WDELQAMLAKDSRIIKECQAELQCTTQELDS
Sbjct: 661 WDELQAMLAKDSRIIKECQAELQCTTQELDS 691

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/692 (48%), Positives = 443/692 (64%), Gaps = 6/692 (0%)

Query: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISN 60
           M+PE+HPIF  ++    +S R   +    S+  +L+GN+L+WC      Y+Y+E     +
Sbjct: 1   MIPESHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHEYQYLEFEPRID 60

Query: 61  YTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCLT 120
           YTS V+N+SG+LLCL N  ++Q+LA+SWD+++ ++  I  PAG+KQ LWHPRGRL SCL 
Sbjct: 61  YTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILISPPAGIKQALWHPRGRLGSCLA 120

Query: 121 VLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSE 180
           VL  +DEI LYELL+ED++ PTT+LN  T ELGMGS VKDI S+ FS+DGLTLYL+S SE
Sbjct: 121 VLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSMSFSSDGLTLYLLSTSE 180

Query: 181 GADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSSLYN 240
           GAD++SIYPC+PSE+ I+   LK  FNKALLQYQ+L++ DSP+L+ K T+QL F+S L  
Sbjct: 181 GADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDLRRKVTKQLQFVSKL-Q 239

Query: 241 QPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAXXXXXXXX 300
           + +D  D++++++    I KA+R+ RAQGPFTI+PFP+ LYLAT +Q++ I         
Sbjct: 240 KKNDYKDTESHVVT---ISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIKLQGCAAEL 296

Query: 301 XXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSCFVLISAE 360
                       CFPD  PVMSWED G  E NSLI +GS+ + G I+L+ G  FV++S+ 
Sbjct: 297 LLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNIGGEIALVNGYTFVVLSSA 356

Query: 361 KAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLLS 420
           K   V+L +L + IE SL+DCD +   E DL+EE+ EK G F SA +   S    + LLS
Sbjct: 357 KVTFVSLRKLAQVIESSLNDCDISYFDEADLSEEVVEKNGRFCSAIICASSEKSCVALLS 416

Query: 421 EKEITSIDIS-SMQTPASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTV 479
           E   + IDI  S+  P   T     K++  + RPY QPL+EV  LN+KVQ+LLK PL T 
Sbjct: 417 ETTTSHIDIPFSLDAPKMRTALGTAKTDVEQYRPYGQPLNEVLALNEKVQALLKKPLQTG 476

Query: 480 IPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRD 539
           +  +LRQ  LNN  NEDQLSLLT ISKEV++R+  AQT           QQ EL QHL  
Sbjct: 477 VSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTLALSLYLRLSCQQGELTQHLET 536

Query: 540 VSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKA 599
           VS++   + +V   L  Q  RWEA Q KNKSI+ R E +   + Q+S S + QSQPI+  
Sbjct: 537 VSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQISSKLKQVSSSGKFQSQPISNH 596

Query: 600 EMEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGV 659
           E+EWFKE+R+QV+RFNRLVHEQQ              YV V                  V
Sbjct: 597 ELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKCELEYVHV-ESKEGKSGSSSADNKDEV 655

Query: 660 PWDELQAMLAKDSRIIKECQAELQCTTQELDS 691
           PWDEL+A+LAKD RII ECQ  LQ   ++LDS
Sbjct: 656 PWDELRALLAKDLRIIGECQDSLQGVAKQLDS 687

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  427 bits (1097), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 258/700 (36%), Positives = 377/700 (53%), Gaps = 23/700 (3%)

Query: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISN 60
           M  E HPIFQ  S+G+    +  L T+D  R ++++G++++ C      Y+ +E   I+ 
Sbjct: 1   MSAEDHPIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIEC-GINT 59

Query: 61  YTSAVLNDSGTLLCLNNVDEIQVLAL-------SWDQTRPESYRIKVPAGVKQVLWHPRG 113
              A LN+SGTLLC  N  E+QV+ L            +P +Y I V + +KQV WHPRG
Sbjct: 60  VAGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRG 119

Query: 114 RLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTL 173
           +LDS   VL+K D I +YEL +EDF  PT VLN   N+LG+ S + DIES+CFS DGL L
Sbjct: 120 KLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIESMCFSKDGLAL 179

Query: 174 YLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLH 233
           YL++ SEG DV+++YP +PS L I  + L+  F K+ + Y+ LS  DSP +K    +QL 
Sbjct: 180 YLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSPTVKRNVIKQLQ 239

Query: 234 FMSSLYNQ-PHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIA 292
           F+S L+ Q   +  D   N    F+I+++YRNA+ QGPFTI+PF EKLY ATA QI  + 
Sbjct: 240 FVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLYSATATQITTMP 299

Query: 293 XXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLK-LPGSISLIYG 351
                               CF DL   M WE+  SS  NSL+ + SL  L G I  +  
Sbjct: 300 -IDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLDILSGQIICLTP 358

Query: 352 SCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPES 411
             F ++   K+ VV+ S  T+++   ++  +   LS+ ++   IT   G F  AGLW  +
Sbjct: 359 HKFAVL-GPKSFVVDSSEWTKALSECINFSNLEVLSQINIKSTITPVNGAFTQAGLWESN 417

Query: 412 GMQKIVLLSEKEITSIDISSMQTPASSTTEKIEK-SETNRQRPYSQPLSEVQTLNQKVQS 470
           G ++++ +S+K + SI +        + ++ ++  +E   +  +SQP+ E+  LN+K QS
Sbjct: 418 GEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKYEPVFSQPIGEILLLNKKFQS 477

Query: 471 LLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQ 530
                  TVIP  L    L N  NEDQL+LLTDISKEV S++   QT           Q+
Sbjct: 478 ECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVFSKIIQGQTLGLLIHNRLFEQR 537

Query: 531 DELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQ 590
            EL + L   SE+  K + +      Q  RWE + +K ++I  RFE L   + +IS S +
Sbjct: 538 YELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQENIDSRFEKLQSRLNEISSSGK 597

Query: 591 LQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXX 650
           L+   I++ EMEWFKE+++QV  FN+ V +QQD             +V+ +         
Sbjct: 598 LKDLAISQREMEWFKEIKSQVSLFNKFVMQQQD-------VKEQLEFVQSELKTAGERRV 650

Query: 651 XXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQELD 690
                     W ELQ +L+ DS IIKEC   L    +ELD
Sbjct: 651 SKEDV---FDWAELQELLSVDSEIIKECNEGLVEAAKELD 687

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  312 bits (800), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 219/717 (30%), Positives = 345/717 (48%), Gaps = 58/717 (8%)

Query: 1   MLPEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMEL-NAIS 59
           M  E HPIF+     +S S+R  L T D  R ++++ + ++WC +  P Y  M L  A  
Sbjct: 1   MTVETHPIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFK 60

Query: 60  NYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPES-------YR-IKVPAGVKQVLWHP 111
           +    V+++SG  LCL N DE++++ + W  T   S       +R +   A +KQVL+HP
Sbjct: 61  DVKHVVMSNSGEFLCLYNDDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHP 120

Query: 112 RGRLDSCLTVLNKRDEILLYELLSEDFS-APTTVLNASTNELGMGSSVKDIESVCFSADG 170
                  + +L   D I +     +DF  +   VLN S     + SS+ D+E + FS DG
Sbjct: 121 LAYQQETVVILKDDDSITIMNW--QDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDG 178

Query: 171 LTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATR 230
           LTLY++SVSEGAD+++ YPC+   +   ++ L     K+L+QY  L+ G   E+K    +
Sbjct: 179 LTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEVKRNTIK 238

Query: 231 QLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKA 290
           QL F+S L+ Q         N  +   I +A R  R QGPFTI+PFP+++Y +T   I +
Sbjct: 239 QLKFVSGLHKQ--------QNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIAS 290

Query: 291 IAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNS-----LISVGSLKLPGS 345
           +                        DL   M+W+ +  +  NS     LI++GS ++   
Sbjct: 291 LPINDQNELLIMSLDDGNIAI-LLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQI 349

Query: 346 I--SLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEIT--EKKGT 401
           +     YG  F +++ E    ++ S+ +  +   L + D   L+E  L  E+T  E K +
Sbjct: 350 VVGDHKYGQ-FSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDS 408

Query: 402 FQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQRP------YS 455
            +S   W  +  Q +V +S +E+ S  +S      S   + I  S   RQ P      YS
Sbjct: 409 PKSVAWW-NTTPQSVVKVSNREVKSKQVSE---GVSKQDDDITGS---RQEPEKYNAHYS 461

Query: 456 QPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLA 515
           QP++E+  LNQK Q       S VIP   RQK L N  +E QL LLT+ SK+ +S++ + 
Sbjct: 462 QPIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVG 521

Query: 516 QTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRF 575
           QT           QQ +L   L+   EL  K++ +  H  SQ  R +A+  ++ ++  RF
Sbjct: 522 QTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRF 581

Query: 576 ESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQ---QDXXXXXXXXX 632
                N+ QI  S + +   I+K E+EWFKE+R QV+ FNR VH Q   QD         
Sbjct: 582 NKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEM 641

Query: 633 XXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQEL 689
                V  D                   W EL+ ML +D+ I+++C  +L+   +++
Sbjct: 642 NRIAQVTGDQNSQARDE-----------WHELRHMLEEDTIILQDCNNQLKSAARQV 687

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  310 bits (793), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 215/726 (29%), Positives = 362/726 (49%), Gaps = 62/726 (8%)

Query: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWC-LMDAPNYEYMELN---AISN 60
           A PIFQA SL  ++S R    + + +R ++++ + ++WC L+  P+Y  +  +    + +
Sbjct: 9   ALPIFQA-SLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVLDD 67

Query: 61  YTSAVLNDSGTLLCLNNVDEIQVLALSW------DQTRPESYRI------KVPAG----V 104
              A+ + SG LLC  +  EI V+ + W      D +  +++++      ++  G    +
Sbjct: 68  TFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNSPI 127

Query: 105 KQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESV 164
           K+VL+HP+   DSC+ VL   D I ++++L++   AP  +LN   +  G+ + V DI   
Sbjct: 128 KKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQ-EAPI-ILNKRNSSFGLDARVNDITDF 185

Query: 165 CFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPEL 224
            FS DGLTLY ++ +EG D+F+ YP +PS LS++ K L +  NK+L+ Y+ L+     ++
Sbjct: 186 AFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNATTDYKV 245

Query: 225 KLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLAT 284
           K   T+QL F+S L    H   DS+   L    I   YR  + QGPFTI+PFP +LY  T
Sbjct: 246 KRNITKQLQFVSKL----HKNWDSK---LAKVKIDDEYRLVKMQGPFTINPFPNELYDFT 298

Query: 285 AKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLP- 343
           A +I  I                      F DL   MSW+       NSLI +  +KL  
Sbjct: 299 ASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQ 358

Query: 344 ---GSISLI---YGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITE 397
               S++ +    G  +V + +     ++ +  T  + + +D+ D   L++     +  +
Sbjct: 359 KEMKSLTALPDQLGKLYVTLESS-VHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFED 417

Query: 398 KKGTFQSAGL----WPESGMQKIVLLSEKEITSIDIS------SMQTPAS-STTEKIEKS 446
                Q +      W +     + L+S++++T  +IS      S+  PA   T    +KS
Sbjct: 418 IATIHQLSNFAYINWNDKS--SLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKS 475

Query: 447 ETNRQR---PYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTD 503
           +T ++     ++QP++E+ +LN+  Q +  SP   +IP A RQ  L N  NE+QL + TD
Sbjct: 476 DTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTD 535

Query: 504 ISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEA 563
           ISKE L ++  AQ+           QQ EL + L+  S++  K E +   L +Q  +W +
Sbjct: 536 ISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNS 595

Query: 564 IQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQD 623
              +   +  RF  L  N++++++S + + Q I+  EMEWFKE+RNQ+++FN  VH Q+ 
Sbjct: 596 QSSRQAELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQK- 654

Query: 624 XXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQ 683
                         +R++                   WDEL+ ML  DS+IIKEC  EL 
Sbjct: 655 -SIQQDLSYLKRELIRIESETINADKKSQNE------WDELRKMLEVDSKIIKECNEELV 707

Query: 684 CTTQEL 689
             +Q+L
Sbjct: 708 HVSQQL 713

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  307 bits (787), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 216/718 (30%), Positives = 348/718 (48%), Gaps = 55/718 (7%)

Query: 7   PIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWC-LMDAPNYEYMELN---AISNYT 62
           PIFQA SL  S+S R    +++ +R + ++ N ++W  ++  P Y  + L+    + +  
Sbjct: 11  PIFQA-SLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69

Query: 63  SAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGV----------------KQ 106
             + + SG LLC  N  EI V+ + W  +  E+  I+    V                K+
Sbjct: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129

Query: 107 VLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCF 166
           VL+HP+   DSC+ VL + D I+++++L++       +LN   N  G+ + + DI  + F
Sbjct: 130 VLFHPKSYHDSCIVVLKENDTIIMFDILNQ--QEKPIILNKPNNSFGLDARLNDITDLVF 187

Query: 167 SADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKL 226
           S DGLTLY ++ +EG D+F+ YP +PS L +    L +  NK+L+ Y+ L       +K 
Sbjct: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247

Query: 227 KATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAK 286
              +QL F+S L    H+  DS+ N +    I   YR  + QGPFTI+PFP +LY  TAK
Sbjct: 248 NIIKQLQFVSKL----HENWDSKLNKVD---IDSEYRLVKVQGPFTINPFPNELYDYTAK 300

Query: 287 QIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSI 346
            I  I+                       DL   MSW+       +SL+ +  +K+   I
Sbjct: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI 360

Query: 347 -SLI-----YGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSE---EDLTEEITE 397
            SLI      G  +V  S      VN +  T +I + +++ D   L +   E   E I  
Sbjct: 361 ESLITLPEQMGKLYVF-SKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIAT 419

Query: 398 KKGTFQSAGLWPESGMQKIVLLSEKEIT----SID--ISSMQTPASSTTEKIEKSETNRQ 451
            +G    A ++  +    + L S KE+T    S+D  + S +T     TE+   ++   +
Sbjct: 420 VEGMPNLAHIY-WNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYE 478

Query: 452 RPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSR 511
             ++QPLSE+ TLN+  Q    SP   +IP+  RQ  L N  +E+QL + TD+SKE L +
Sbjct: 479 LRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQK 538

Query: 512 VTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSI 571
           +  AQ+           QQ EL + L+   ++ +K   +     +Q  +W+A   +   +
Sbjct: 539 IAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKL 598

Query: 572 ALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXXXXX 631
             RF  L  N+++ISKS++ + + I+ AEMEWFKE+RNQ+++FN  VH Q+         
Sbjct: 599 MERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYL 658

Query: 632 XXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQEL 689
                 +  +                   W+EL+ ML  DS+IIKEC  ELQ  +Q+L
Sbjct: 659 KRELTRIETETIQVDKKSQSE--------WNELRKMLEIDSKIIKECNEELQHASQQL 708

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  307 bits (786), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 220/724 (30%), Positives = 344/724 (47%), Gaps = 63/724 (8%)

Query: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKW--CLMDAPNYEYMELN-----A 57
           A PIFQA SL  S+S R    +++ +R + ++ N ++W   L D+    Y  LN      
Sbjct: 9   ALPIFQA-SLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSL---YHSLNFSRHLV 64

Query: 58  ISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIK----------------VP 101
           + +    + + SG LLCL N +EI V+ + W  +  E   I+                  
Sbjct: 65  LDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPK 124

Query: 102 AGVKQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDI 161
           + +K+VL+HP+   DSC+ VL + D I ++++L+        VLN   N  G+ + V DI
Sbjct: 125 SSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNS--QEKPIVLNKPNNSFGLDARVNDI 182

Query: 162 ESVCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDS 221
             + FS DGLTLY ++ +EG D+F+ YP +PS L +  K L    NK+L+ Y+ L     
Sbjct: 183 TDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTD 242

Query: 222 PELKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLY 281
             +K    +QL F+S L+       ++  +      I+K YR A+ QGPFTI+PFP +LY
Sbjct: 243 VIVKRNVIKQLQFVSKLH-------ENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELY 295

Query: 282 LATAKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLK 341
             TA  I  I                      F DL   MSW+       NSL+ +  +K
Sbjct: 296 DYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVK 355

Query: 342 LPGSI-SLI-----YGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELS----EEDL 391
           L   I SLI      G  +V IS      VN      ++ + +++ D   L+    E  L
Sbjct: 356 LQREIKSLITLPEQLGKLYV-ISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKL 414

Query: 392 TEEITEKKGTFQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTE---KIEKSET 448
            +  T ++    +   W +     + L+S K +T  +ISS   P S+  E     EKS+T
Sbjct: 415 EDIATIERIPNLAYINWNDQS--NLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDT 472

Query: 449 ---NRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDIS 505
                +  ++QP++E+  LN   Q    SP   +IP+A RQ  L N  +E+QL + TDIS
Sbjct: 473 VGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDIS 532

Query: 506 KEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQ 565
           KE L R+  AQT           QQ EL + L+   ++ +K + +     +Q  +W+A  
Sbjct: 533 KEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQL 592

Query: 566 EKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXX 625
            +   +  RF  L + ++QI++S++ + + I+  EM+WFKE+RNQ+++FN  VH Q+   
Sbjct: 593 SRQSELMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQ 652

Query: 626 XXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCT 685
                       +  +                   WDEL+ ML  DS+IIKEC  EL   
Sbjct: 653 QDLSYLKSELTRIEAETIKVDKKSQN--------EWDELRKMLEIDSKIIKECNEELLQV 704

Query: 686 TQEL 689
           +QE 
Sbjct: 705 SQEF 708

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  299 bits (766), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 215/732 (29%), Positives = 348/732 (47%), Gaps = 60/732 (8%)

Query: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISNYTSA 64
           +HPIF    +    S+R    +   +R +LL+G  LKWC +    Y  M++ +I N    
Sbjct: 10  SHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVIDTTYHSMKVKSIFNNKRK 69

Query: 65  V----LNDSGTLLCLNNVDEIQVLALSW----------DQTRPESYRIKVPA-------G 103
           +    L++SG  LC+     I +L + W           + +P  Y I            
Sbjct: 70  IIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPDELLSKFQPFHYDISSSTSALSSPSD 129

Query: 104 VKQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIES 163
           +KQVL+HP+   ++CL +L   D I+  +L+    S  T  +N  T  LG+ + V DIES
Sbjct: 130 IKQVLFHPKSYHETCLVIL-YEDSII--QLIDTTASTETITINQPTGTLGVETRVIDIES 186

Query: 164 VCFS-ADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSP 222
           +CF    GL LY +S+S+G D++++YPC+P+ L +++K +     K+++ Y  L E  S 
Sbjct: 187 ICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKENMSN 246

Query: 223 ELKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRK----------AYRNARAQGPFT 272
           ++K    +QL F + L  Q  +    + +  +T H +K           YR    QGPFT
Sbjct: 247 DVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILDVDLEYRLVNFQGPFT 306

Query: 273 ISPFPEKLYLATAKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKN 332
           ISPFP +LY ATAK+ + +                      F DL   MSW+ +     N
Sbjct: 307 ISPFPNELYSATAKESQCMKINENNELLIMTFDDGSVAL-LFRDLELTMSWDIANYIHDN 365

Query: 333 SLISVGSLKL-PGSIS--LIYGSCF---VLISAEKAAVVNLSRLTRSIERSLDDCDATEL 386
           S   V  +KL P  I   +IY   F    L+S +   +V+ +  +  + +++DD +   L
Sbjct: 366 SFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDSNLNIL 425

Query: 387 SEEDLTEEIT--EKKGTFQSAGLWPESGMQKIVLLSEKEITSIDIS---SMQTPASSTTE 441
           SE     EIT  +  G F +       G + I+ +S   +   +++   SM     S+T 
Sbjct: 426 SEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIKGSSTS 485

Query: 442 KI--EKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLS 499
               E +E+  +  + QP+ E+ TLN+  Q   + P S +I    RQ  L+N  NE QL 
Sbjct: 486 NSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNESNEIQLE 545

Query: 500 LLTDISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKP 559
           +LTD+SKE+++++   QT           QQ EL + L+    +  K++ +         
Sbjct: 546 ILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNKNKEILK 605

Query: 560 RWEAIQEKNKSIAL--RFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRL 617
           RW   ++ N+S+ L  R ++L+  +  I+ S  L S PI   E+EWFKE+RNQV +FN  
Sbjct: 606 RWN--EQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHKFNSF 663

Query: 618 VHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKE 677
           VH Q+D             +++ +                   W+EL+A+L +DS+IIKE
Sbjct: 664 VHTQRD-------ANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKE 716

Query: 678 CQAELQCTTQEL 689
           C  EL  TT+ +
Sbjct: 717 CNIELTKTTESM 728

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  292 bits (747), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 207/703 (29%), Positives = 340/703 (48%), Gaps = 37/703 (5%)

Query: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELN-AISNYTS 63
           +H IF+ R+ G S+  R    ++D S+ ++ + +S++WC      YE+M L   I +   
Sbjct: 5   SHSIFK-RASGSSK--RFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLEPTIEDVEH 61

Query: 64  AVLNDSGTLLCLNNVDEIQVLALSWDQTRP-----ESYRIKVPAG----VKQVLWHPRGR 114
            VL+ +GTLL L N  E++++ + W  ++      + +R  V +     +K+VL+HP   
Sbjct: 62  VVLSPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLAY 121

Query: 115 LDSCLTVLNKRDEI-LLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTL 173
            + C+ +L   + I LL      D      VLN      GM   V DIES+ FS DGLTL
Sbjct: 122 REHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDIESITFSQDGLTL 181

Query: 174 YLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLH 233
           Y +SV+EG D+++ YPC+P  + I    L    +K+L+QY+ LS       K    +Q  
Sbjct: 182 YALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETPDATKRNTIKQFQ 241

Query: 234 FMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAX 293
           F+S L       ++ QT +     I   +   R QGPFTI+PFP++ Y  TA Q+K I  
Sbjct: 242 FISKL---RQGLENDQTKI----DIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQLK-ILP 293

Query: 294 XXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLP-GSISLIYGS 352
                               + DL   M W+  G S  NSL+ V S++L  G + L  G+
Sbjct: 294 IGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERGELVLKQGT 353

Query: 353 C---FVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQ--SAGL 407
               FVL       +V+ S  ++ +   +D+ D   +++     EI++ +G  Q  S  +
Sbjct: 354 LSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVSQIDSYAM 413

Query: 408 WPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNR-QRPYSQPLSEVQTLNQ 466
           W +    K V +S+  +     +    P++   EK    +  R +   +QP+SE+ +LN 
Sbjct: 414 WKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANVDIPRYEVALNQPMSEILSLNA 473

Query: 467 KVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXX 526
             Q+  K PLS ++  + RQ  LNN  NE+QL +LT +SKE L ++  AQ          
Sbjct: 474 SFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVKAQALGFNLHNRC 533

Query: 527 XGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQIS 586
             QQ EL + L+  SE+ +K++++ +   SQ    E+  ++   +  RF SL   + +I+
Sbjct: 534 LEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQRFNSLSEKLGRIN 593

Query: 587 KSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXX 646
           +S + +   I   EM WFKE+RNQV+ FN+ VH Q++              + ++     
Sbjct: 594 ESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKELENISLEDKDVG 653

Query: 647 XXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQEL 689
                         W EL ++L  D++IIKEC  +L   + E+
Sbjct: 654 EKSKSE--------WTELLSILESDTKIIKECNNQLAHASSEV 688

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  286 bits (731), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 201/721 (27%), Positives = 332/721 (46%), Gaps = 55/721 (7%)

Query: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAISNYTSA 64
           +HPIFQ     +  + R    +   +R ++L+G  L+WC + A ++  M ++     ++A
Sbjct: 9   SHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSVTASSFNSMTIDFFQPESTA 68

Query: 65  ----VLNDSGTLLCLNNVDEIQVLALSWDQTRPE----------SYRIKVPAG---VKQV 107
               +L++SG  +C+     I+V+ + W    P           SY  K   G   +KQV
Sbjct: 69  PQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQV 128

Query: 108 LWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFS 167
           L+HP    DSCL VL     I L ++        T  LN      G+ + + DIES+CFS
Sbjct: 129 LFHPEAYKDSCLVVLYDNGTISLMDVTQ---ITKTITLNKRVATFGIDTQITDIESICFS 185

Query: 168 ADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLK 227
            DG TLY +S+S+G D+++ YPC+P +L + R+ +    ++++L Y+ L      ++K  
Sbjct: 186 KDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHESVLLYESLKLDTDRDVKRN 245

Query: 228 ATRQLHFMSSLYNQ-PHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAK 286
             RQ+ F++ L      +  +S  + ++   I + YR  R QGPFTI P+PE+LY ATA 
Sbjct: 246 VIRQVQFVNKLNGLLTENEKNSNEDFIE---IEQEYRLIRGQGPFTIDPYPERLYSATAL 302

Query: 287 QIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLPG-- 344
           +I  +                      F DL   MSW+       NS   V  ++L    
Sbjct: 303 EISTLPINSNNELMCMIFDDGSIAL-LFKDLPLTMSWDVDNYVHNNSFSLVELMQLKDTD 361

Query: 345 -----SISLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEI---- 395
                S    YG  F+        +V+    +  + +++D+ +  EL E + T ++    
Sbjct: 362 VKRIVSYPDTYGQFFIF-GDSSLFLVHTHIWSDLLAKAIDNSNLNELLEMNFTSKLDFFE 420

Query: 396 TEKKGTFQSAGLWPESGMQKIVLLSEK-------EITSIDISSMQTPASSTTEKIEKSET 448
           T    T  S   W   G   I+ ++++       E+    I     P     E+++  E 
Sbjct: 421 TTNGITKCSPCKW--RGRDVILFITKEDVYMHPVEMRKSGILGNNKPVLVNNEELKHQE- 477

Query: 449 NRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEV 508
             +  + QP+ E+  LN+  Q      +S +I    RQ  LNN +NE QL LL+D+SKEV
Sbjct: 478 -YKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEVQLELLSDVSKEV 536

Query: 509 LSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKN 568
           +S++   Q            QQ EL + L+ V  + +K+  +      Q  RW+    ++
Sbjct: 537 ISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEEQSRRWDDQTSRS 596

Query: 569 KSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXX 628
             +  R + L   + +I+ S +L+  PI   E+EWFKE+RNQV++FN  VH Q+D     
Sbjct: 597 SQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNSFVHNQRD----- 651

Query: 629 XXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQE 688
                   +++ D                   WDEL+ +L  D++II+EC  EL  TT+ 
Sbjct: 652 --AQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELLSTTEA 709

Query: 689 L 689
           L
Sbjct: 710 L 710

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  281 bits (720), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 214/722 (29%), Positives = 345/722 (47%), Gaps = 59/722 (8%)

Query: 5   AHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWC-LMDAPNYEYMEL--NAISNY 61
           A PIFQA SL  S+S      + + +R + ++ N ++WC  +   +Y+ ++   + I + 
Sbjct: 9   ALPIFQA-SLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDD 67

Query: 62  TSAVLND-SGTLLCLNNVDEIQVLALSWDQTRPESYRIK------------VPAG----V 104
           T  V++  SG LL   NV EI V+ + W     E   ++            V  G    +
Sbjct: 68  TFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLI 127

Query: 105 KQVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESV 164
           K+VL+HP+   DSC+ VL + D I ++++L++       VLN  +N  G+ + V DI  +
Sbjct: 128 KKVLFHPKSYHDSCIVVLKEDDTITMFDILNQ--QHKPIVLNKRSNSFGLDARVNDITDL 185

Query: 165 CFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPEL 224
            FS DGLTLY ++ +EG DVF+ YP +P  L +  K L +  NK+L+ Y+ L       +
Sbjct: 186 AFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDSTTDITV 245

Query: 225 KLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLAT 284
           K    +QL  +S L    H+  DSQ   L    I + YR  + QGPFTI+PFP++LY  T
Sbjct: 246 KRNIIKQLQLVSKL----HENLDSQ---LGKVEIDEEYRLVKMQGPFTINPFPDELYEYT 298

Query: 285 AKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLK--- 341
           A  I  I                      F DL   MSW+       NSL+ +  +K   
Sbjct: 299 AANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQE 358

Query: 342 --------LPGSISLIYGSCFVLISAEKAAVVNLSR-LTRSIERSLDDCDATELSEEDLT 392
                   LP  +  +Y   F   S  +    N S  L+R IE S  +       E  L 
Sbjct: 359 TDIKSLKTLPEELGKLY--VFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLE 416

Query: 393 EEITEKKGTFQSAGLWPESGMQKIVLLSEKEITSIDISS---MQTPASSTTEKIEKSETN 449
             +T +  +  +   W ++    +VL +  ++T  +IS+   +QT       K ++ +  
Sbjct: 417 NIVTIEHPSNLAYISWNDTS--NLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAG 474

Query: 450 R--QRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKE 507
           +  +  ++QP++E+ +LN+  Q    SP   +IP A RQ  L N  +E+QL + T ISKE
Sbjct: 475 KHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKE 534

Query: 508 VLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEK 567
            L ++  AQ+           QQ EL + L+  S++ +K   +   L +Q  +W+A   +
Sbjct: 535 FLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSR 594

Query: 568 NKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXX 627
              +  RF+ L  N++QI++S +L+ + I + EM+WFKE+RNQ+++FN  V  Q+     
Sbjct: 595 QVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQD 654

Query: 628 XXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQ 687
                     +  +                   WDEL+ ML +DS+IIKEC  EL   +Q
Sbjct: 655 LSYMKKELTRIEAETIKTDEKTQN--------EWDELRKMLEEDSKIIKECNEELMHVSQ 706

Query: 688 EL 689
           +L
Sbjct: 707 QL 708

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  278 bits (712), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 196/726 (26%), Positives = 349/726 (48%), Gaps = 62/726 (8%)

Query: 2   LPEAHPIFQARSLGES----RSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNA 57
           L E  PIF+           RS  L +  +D S   + + N L+W  + +  Y  + L  
Sbjct: 15  LLENRPIFKTSLSSSLLNSERSFSLPILAQDSS---IYKKNQLRWGSVASSQYHSLPLLF 71

Query: 58  I--SNYTSAVLNDSGTLLCLNNVDEIQVLALSWD---------QTRPESYR-IKVPAGVK 105
              S Y + ++++SG  LCL +   + ++ + W           +    +R +   + +K
Sbjct: 72  FDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYDGAVTSIKSSFQRVFRDVNKSSDIK 131

Query: 106 QVLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVC 165
           ++L+HP+   D C+ +L + D I L++L      +    LN + N+LG+ + V DIE + 
Sbjct: 132 KILFHPKAADDGCVVILFENDVICLFDLRK----SEKLFLNKTANKLGIETRVTDIEDME 187

Query: 166 FSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELK 225
           FS DGLTLY++SV++G D+++ YPC+P +LS+ +  L+  FNK+ + Y  L    S E++
Sbjct: 188 FSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSLKKSVLEDLFNKSRILYDSLDSTVSIEVR 247

Query: 226 LKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATA 285
               +Q+ F++SL  +   +D+++ + L+   I   +R  +AQGPFT++P+PEKLY ATA
Sbjct: 248 KNVLKQIKFIASL--RDSSSDETKNSCLE---ISNDFRQVKAQGPFTVAPYPEKLYEATA 302

Query: 286 KQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKL-PG 344
           K+I  +                        DL   MSW        NS + + S+++ P 
Sbjct: 303 KEIYTL-DIGNNNELFAITFDNGTVTLLLKDLELSMSWNADNYVYNNSFVLIESVEMGPE 361

Query: 345 SISLIYGSCF---VLISAEKAAV--VNLSRLTRSIERSLDDCDATELSEEDLTEEITE-- 397
           SI L+  S     + IS   ++V  ++ +  +  + + + + D T L + D   +I++  
Sbjct: 362 SIKLLKSSSLTGQMFISQNHSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLD 421

Query: 398 KKGTFQSAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQR----- 452
            K      G+W   G + I+ +S   + S  +     P S ++  I+  E +R +     
Sbjct: 422 IKENVDCYGVWSLRGERGILFVSNSSVISRTL-----PESDSSFVIKLDEMSRSKNIEDP 476

Query: 453 -------PYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDIS 505
                   ++QP+SE+  LN   Q + + P   +I    RQ  L+N  NE QL+ LT+IS
Sbjct: 477 VTKKYEVSFTQPISEIMNLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEIS 536

Query: 506 KEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQ 565
            +++S +   Q+           QQ EL + L++  +L  K+  + +    +  RW    
Sbjct: 537 NDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNL 596

Query: 566 EKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXX 625
           +K   +  RF +L+ N+ +I +S ++   PI++ E+EWFKE+RNQ+++FN  VH  ++  
Sbjct: 597 KKQDELIQRFNALNGNLAKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQ 656

Query: 626 XXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCT 685
                        R++                   W E + +L  D+ IIKEC  EL   
Sbjct: 657 EQINFLRKGLS--RIESKVGQRSSHLTS------EWAEFKKILETDTNIIKECNEELTKA 708

Query: 686 TQELDS 691
             +LD+
Sbjct: 709 HTQLDA 714

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  252 bits (643), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 190/708 (26%), Positives = 333/708 (47%), Gaps = 58/708 (8%)

Query: 1   MLPEAHPIFQA---RSLGESRSERLCLHT-KDLSRTILLEGNSLKWCLMDAPNYEYMELN 56
           M  + HPIFQ    R+L      +L +H  K+ ++ +     +L++  +    ++   L+
Sbjct: 1   MTGDPHPIFQVPPFRTLS-----KLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLD 55

Query: 57  AISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLD 116
            I +   ++LN+SGTL+     +++++  +   ++      ++V  G+KQVLWHP   LD
Sbjct: 56  -IKHSEHSILNNSGTLIAFYGSNDVELFDMDGKKSC-----LRVELGIKQVLWHPLAYLD 109

Query: 117 SCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLM 176
           SCL VL K + I LYEL   +F  PT VLN    +LG+ S V +I S+ FS DGLTLYL+
Sbjct: 110 SCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLL 169

Query: 177 SVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMS 236
           S+ EG DV++++P +PS L I R   +  + KA   Y+ + +    E K+       F+S
Sbjct: 170 SLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKKIAMIEHFDFVS 229

Query: 237 SLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAXXXX 296
            +Y    D D    ++    +I +  R    +GPF+I  FPE+LY  TA ++  +     
Sbjct: 230 KIYKMI-DKDSEFFDV----NIPEHKRMVTPRGPFSIYGFPEELYNTTATKLITLPVNDE 284

Query: 297 XXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSCFVL 356
                            FPD+  +MSW  S ++   S + +   +  G I  I  S   +
Sbjct: 285 GAYVLILSFDDGTILSLFPDIELLMSWSRSLNN-ACSFVLIEKFRAGGEIFAI-ESGVAI 342

Query: 357 ISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQKI 416
           +    A +V    L +++   + + D   + +  LT +IT   G++ +   W E   + I
Sbjct: 343 LEKNNAHIVRFPYL-KALGECIKEGDIAPMVDVKLTSDITPLAGSYHTVVTWNEPSTKGI 401

Query: 417 VLLSEKEITSI----DISSMQT---PASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQ 469
           + +    I SI     +SS +    PA S   K           +   + E+   N+ +Q
Sbjct: 402 LFIGNSVIRSIPDDVGLSSFKPRVDPAISQNGKYTVC-------FPSTMEELLKTNKALQ 454

Query: 470 SLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQ 529
             L+ PL  ++P   +   LN+  NE QL+ LT IS EV+ R+ LAQ+           Q
Sbjct: 455 HTLRQPLP-LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILAQSLGYLMYNRAATQ 513

Query: 530 QDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSS 589
           Q EL + L  VS+L  +   +  +  S   R +++ +K+ ++  R E L +++ ++++S 
Sbjct: 514 QFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRLEKLQQSLDKVNESP 573

Query: 590 QLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXX 649
           +    P++  E  WF+EL+N V+ FN  V +                 +  +        
Sbjct: 574 KFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKELELIESN-------- 625

Query: 650 XXXXXXXGGVP------WDELQAMLAKDSRIIKECQAELQCTTQELDS 691
                  G +P      +++LQ +L  DS++I +C  +L    ++L++
Sbjct: 626 ------HGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLEN 667

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  246 bits (628), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 193/741 (26%), Positives = 327/741 (44%), Gaps = 76/741 (10%)

Query: 3   PEAHPIFQARSLGESRSE---RLCLHTKDLSRTILLEGNSLKWCLMDAPNYEYMELNAIS 59
           P +HPIF+   L  S  E   R    T   +R ++++  S++WC   + NY    + A  
Sbjct: 15  PTSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTI-ASR 73

Query: 60  NY--TSAVLNDSGTLLCLNNVDEIQVLALSWDQTRP---------ESYRI---KVPAGVK 105
           N+    +++++SG+ +C  +  +I ++ + W  +           + YR    K    VK
Sbjct: 74  NFDIKDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLTVK 133

Query: 106 QVLWHPRGRLDSCLTVLNKRDEILL------YELLSEDFSAPTTVLNASTNELGMGSSVK 159
           QVL+HP   L+SCL VL   D I+       ++LLS D+     +LN  +  +G+ S + 
Sbjct: 134 QVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSDY-----ILNKKSKSIGLSSQIS 188

Query: 160 DIESVCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEG 219
           DI+S+ FS DGLTLY +S S   DV++ YPC+P     + + L+   NK+++QY+EL E 
Sbjct: 189 DIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEELRED 248

Query: 220 DSPELKLKATRQLHFMSSLYNQPHDA----DDSQTNLLQTFHIRKAYRNARAQGPFTISP 275
           D   LK+   +QL F S LY +   A     DS+T     + +   YR  R QGPFTISP
Sbjct: 249 DPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKT---WKYDVPLEYRLIRPQGPFTISP 305

Query: 276 FPEKLYLATAKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLI 335
           FP+ LY ++   I ++                      F DL   MSW+    +E NSL+
Sbjct: 306 FPDSLYYSSPTHIVSVP-IDTTNELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSLV 364

Query: 336 SVGSLKLP-------GSISLIYGSCFVLISAEKAAVVNLSRLTRSIERSLDDC------- 381
            +  +K          + +  YG+ ++L      +V N   LT     +L  C       
Sbjct: 365 LLELIKTKEQNIRKLTTYAHQYGTFYIL-----GSVKNFEVLTSHWSSTLAICIKSSDIR 419

Query: 382 DATELSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLLSE----------KEITSIDISS 431
           D + L  + + +          S G W    +  ++ +++          K + S D + 
Sbjct: 420 DLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTH 479

Query: 432 MQTP--ASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTL 489
           + T   A      +E      + P    +S++  +N   +      L+  IP+  R  TL
Sbjct: 480 LLTSELAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTL 539

Query: 490 NNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKER 549
            N  NE+QL  LT ISK +  ++++ Q+           QQ+ +   LR    L  K++ 
Sbjct: 540 FNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKI 599

Query: 550 VSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRN 609
           ++     Q  +  A  E+ + +  R   ++  + +    + L +  I+K E+E+FKE+R 
Sbjct: 600 LNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRK 659

Query: 610 QVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLA 669
           QV+ FN  VH+Q+D              ++ +                   WD L+ ML 
Sbjct: 660 QVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQ--------WDRLRDMLH 711

Query: 670 KDSRIIKECQAELQCTTQELD 690
            D+  I+ C   ++    +LD
Sbjct: 712 DDATTIETCTESIKNINFDLD 732

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  244 bits (624), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 192/699 (27%), Positives = 316/699 (45%), Gaps = 40/699 (5%)

Query: 1   MLPEAHPIFQARSLGESRSERLCLHTK-DLSRTILLEGNSLKWCLMDAPNYE--YMELNA 57
           M  E HPIF A +LG S   RL  HT  D ++ +      L+        Y+  + E++A
Sbjct: 1   MTGELHPIFNADALGASH--RLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVDA 58

Query: 58  ISNYTSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDS 117
            +   S++LN SG+LL       I+V+         +   + V  G+KQVLWHP   LDS
Sbjct: 59  KA---SSILNGSGSLLAFYGDHIIEVV-----DREGKKITLTVNGGIKQVLWHPLAYLDS 110

Query: 118 CLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMS 177
           CL VL  ++ I +YEL    +  PT VLN  T++LG+ S V DI ++ F+ DGL+LYL S
Sbjct: 111 CLVVLTGQETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDGLSLYLFS 170

Query: 178 VSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSS 237
            SEG DV  I P +PS +   R      +NKA   Y  L++    + K+     L F++ 
Sbjct: 171 TSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKVATIEYLEFVTQ 230

Query: 238 LYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAXXXXX 297
           L  Q  + + S   L+   H R+      +QGP+ I  FPEKLY A   ++  +      
Sbjct: 231 LL-QAIEKNGSDGELVIPEHRRRTI----SQGPYNIHGFPEKLYSAVGTKLTVVPLGESE 285

Query: 298 XXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSISLIYGSC--FV 355
                           FP    +MSW     +   +L+ V      G+    + +C    
Sbjct: 286 AHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAY-TLMLVEEFTATGT---AFATCDGVA 341

Query: 356 LISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDLTEEITEKKGTFQSAGLWPESGMQK 415
           ++  + A  V +  L +++E  + DC+   L + + T  I +  G F S   +   G + 
Sbjct: 342 VLGIDSAQRVEIPYL-QALEDCIRDCNLAALQDINFTSSICKIPGKFHSVARFNAPGNKG 400

Query: 416 IVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQRPYS----QPLSEVQTLNQKVQSL 471
           I+L+ +       I      A S TE    S+  ++  Y+      L E+   N+++Q  
Sbjct: 401 IILVGDHH---AKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNSLEEILNTNKELQRR 457

Query: 472 LKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQD 531
              PL  ++P AL+   LN+  NE  L+ LT+ISKEV+ R+ L+Q+           QQ 
Sbjct: 458 KHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAGLLMHNRLSLQQY 516

Query: 532 ELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQL 591
           EL + +  V+++ ++   +     +   R  ++ ++++ +  R   L   + +I+ S + 
Sbjct: 517 ELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQSTLNRINSSHKF 576

Query: 592 QSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXXX 651
              P++K E +WF+EL+NQ + FN       D             +++ +          
Sbjct: 577 SDLPLSKKEADWFRELKNQAISFN-------DYVLQSAQLRDELAFLKNELESLPEHRQH 629

Query: 652 XXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQELD 690
                    +  LQ +L  DS+II EC   L    +EL+
Sbjct: 630 DRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAARELE 668

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  230 bits (587), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 189/724 (26%), Positives = 339/724 (46%), Gaps = 53/724 (7%)

Query: 4   EAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLM-DAPNYEYMEL-NAISNY 61
           E +PIF+  S+    ++R      + +R IL + ++++W    D  +Y+ M L ++  + 
Sbjct: 4   ELNPIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDV 63

Query: 62  TSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAG--------------VKQV 107
           T A+++D G  LCL N  +I+V+ + W  T  +     + +               VKQV
Sbjct: 64  TGAIISDPGDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQV 123

Query: 108 LWHPRGRLDSCLTVLNKRDEILLYELL----SEDFSAPTTVLNASTNELGMGSSVKDIES 163
           L+HP  +    L VL    +I   +L     S D      +    +N +G+ + V++I+ 
Sbjct: 124 LFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQY 183

Query: 164 VCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPE 223
           V F+ D L+LY ++     DV+  YPC+P   S+++  +    NK+++ Y+ L       
Sbjct: 184 VVFADDCLSLYSLT---DTDVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDADDI 240

Query: 224 LKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLA 283
           ++    +QL   SSL  +  + +++   +     I   +R  +AQG F+ISP+PE LY  
Sbjct: 241 VRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESLYTC 300

Query: 284 TAKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKL- 342
           T KQI ++                      F D    MSW+ +  S  NS   V  +K  
Sbjct: 301 TGKQI-SVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFK 359

Query: 343 PGSIS---LIYGSC--FVLISAEKAAV-VNLSRLTRSIERSLDDCDATELSEEDLTEEIT 396
           P  +S   ++ G    FV +S EK+ + V+ ++ +  I + + D D   L   ++   IT
Sbjct: 360 PEELSNMVVLQGELGKFV-VSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTIT 418

Query: 397 EKKGTFQ--SAGLWPESGMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQR-- 452
                 Q  S G+W  SG  K +LL +  +  +     +       E  E+  T  +   
Sbjct: 419 HINSDMQINSCGIW-NSGEAKSLLLVDTNVV-VGYQLFKKEVEFKPESAEEISTELENFT 476

Query: 453 --PYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLS 510
              ++ P +E++  N K Q  +  P S VIPA ++Q    +   E+QL +L DIS++V S
Sbjct: 477 LDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDVGS 536

Query: 511 RVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWE---AIQEK 567
           ++   Q+           QQD+L++ L   +++  + ++V     +Q  + +     QE 
Sbjct: 537 KIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDEKLKKQEH 596

Query: 568 NKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXX 627
            + I L+ ES   N+  I +S +L+S P+++ E++ FKELR+Q++ FN  VH+Q+D    
Sbjct: 597 LEKILLKMES---NLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKD---- 649

Query: 628 XXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTTQ 687
                    +++ +                   W+EL+ +LA D++IIKEC  +L   ++
Sbjct: 650 ---QKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISK 706

Query: 688 ELDS 691
           ELD+
Sbjct: 707 ELDT 710

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  229 bits (583), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 189/672 (28%), Positives = 305/672 (45%), Gaps = 71/672 (10%)

Query: 6   HPIFQ-ARSLGESRSERLCLHTKDLSRTILLEGNS--LKWCLMDAPNYEYMELNAISNY- 61
            PI Q    L    S R    T   ++ + L+  +  L+W  +    Y  M L  ISN+ 
Sbjct: 23  RPILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLK-ISNFA 81

Query: 62  ---TSAVLNDSGTLLCLNNVDEIQVLALSWDQTRPE--SY-------RIKVPAGVKQVLW 109
               + +L+DSG  LC+ + D + V+ + W    PE  SY        I+  + +K+VL+
Sbjct: 82  DKSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFKEIRKDSFIKKVLF 141

Query: 110 HPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSAD 169
           HPR    +C+ +L + D I L+++  ED +     LN  +  +G+   +  I  + FS D
Sbjct: 142 HPRAIKKTCMVILFEDDTIYLFDV--EDNNK--IALNVPSGNIGIEDRITSIADIEFSQD 197

Query: 170 GLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKAT 229
           GLTLY++S  +  DV++IYPC+P  L++++K LK   N+++L Y  L+E     +K    
Sbjct: 198 GLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSLTETTPSAVKKGVI 257

Query: 230 RQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIK 289
           +Q+ F+S L N  H  ++  +N+L+   I   YR A+ QGPFTI+PFPEKLY ATA +I 
Sbjct: 258 KQVEFISQLQNISHGKEEI-SNVLE---IDTIYRLAKPQGPFTIAPFPEKLYSATATEIC 313

Query: 290 AIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSLI-------------- 335
            +                      F DL   M+W+  G    NSL+              
Sbjct: 314 PL-NIGGGNEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEFDLQTESAVS 372

Query: 336 SVGSLKLPGSISLIYGSCFVLISAEKAAV------VNLSRLTRSIERS-----LDDCDAT 384
            + S K+ G I          I   K+ +      V  S + R ++       + DC   
Sbjct: 373 ILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWSSVVSDC--- 429

Query: 385 ELSEEDLTEEIT---EKKG--------TFQSAGLWPESGMQKIVLLSEKEITSIDISSMQ 433
            +   D+   IT   + KG           S G W   G + +  ++ K +T  ++    
Sbjct: 430 -IDRHDINALITVSFKSKGHTWAIAGSDITSCGAWNHGGTEGVTWITNKSVTCKELKKQV 488

Query: 434 T--PASSTTEKIEKSETNRQRP-YSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLN 490
           +  P  ST+   EK +    +P +S P+SE+  LN   Q   +     +I    RQK L 
Sbjct: 489 SWKPEQSTSS--EKKKQAFPKPEFSVPISELNALNINYQDTCRIGFHDIISPLDRQKPLL 546

Query: 491 NTDNEDQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERV 550
           N  NE QL ++T +S  +L+ V   Q            QQ EL + L+  +++  K+  +
Sbjct: 547 NPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSNKILMKQPAI 606

Query: 551 SAHLASQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQ 610
           +  L  QK  W     K   +  RF SL + +  I K+ +     I   E  WFKE++ +
Sbjct: 607 AKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEESVWFKEVKKE 666

Query: 611 VVRFNRLVHEQQ 622
            + FN LV++Q+
Sbjct: 667 ALTFNDLVYKQE 678

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  217 bits (552), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 181/727 (24%), Positives = 323/727 (44%), Gaps = 63/727 (8%)

Query: 3   PEAHPIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWCLMDAPNYEY----MELNAI 58
           P+ H IF   S+G+  S+R  +   +  + IL + N++++  ++  +  +    +E   I
Sbjct: 4   PQLHTIFNRFSVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMI 63

Query: 59  SNYTSAVLNDSGTLLCLNNVDEIQVLALSW--------------DQTRPESYRIK-VPAG 103
            +  S + +  G  LCL N  EI+V+ L W              +  +  SY +K     
Sbjct: 64  GD-VSIIADQIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTT 122

Query: 104 VKQVLWHPRGRLDSCLTVLNKRDEILLYE----LLSEDFSAPTTVLNASTNELGMGSSVK 159
           ++++L+HP G    CL VL K   I   +    L  E+  +       +   +G+ S + 
Sbjct: 123 IQKILFHPLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCID 182

Query: 160 DIESVCFSADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEG 219
           DI  + FS+D L+LY ++     D++  YP +   +S+T+  +   F K+++ ++ L   
Sbjct: 183 DIIDISFSSDKLSLYALT---ETDIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLEND 239

Query: 220 DSPELKLKATRQLHFMSSL-------YNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFT 272
            S  ++    +QL  +S+L         Q  + D+++   +    I   YR+  AQG F+
Sbjct: 240 SSEAVRRNIIKQLQLLSTLSGDIKTQMKQVKNTDETK---IYNIDINTEYRSVNAQGSFS 296

Query: 273 ISPFPEKLYLATAKQIKAIAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKN 332
           I+PFPE+LY  +A  +  I                      + DL   MSW+ +  +  N
Sbjct: 297 IAPFPEELYKQSAVNLSVI-QIGHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNN 355

Query: 333 SLISVGSLKL-PGSISLIY-----GSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATEL 386
           S I +  LK  P     I         F +   +   +++ S  +  + + + D D   L
Sbjct: 356 SFILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNL 415

Query: 387 SEEDLTEEITEKKGTFQ---SAGLWPESGMQKIVLLSEKEITSIDI--------SSMQTP 435
           +   + E   +   T +   S  LW E   ++++ ++E ++ S DI          +  P
Sbjct: 416 AGLSI-ESHKQTINTLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAEKLPVP 474

Query: 436 ASSTTEKIEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNE 495
           A +  +KIEK +    + YSQP+ E+    Q+ +   K P S VIPA +RQK   N +NE
Sbjct: 475 AINDIKKIEKLQL---KNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENE 531

Query: 496 DQLSLLTDISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLA 555
           DQL+ +T+IS+E+ S++   QT           QQD  A+ L   ++     + +     
Sbjct: 532 DQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYD 591

Query: 556 SQKPRWEAIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFN 615
            Q  + + I E+N  +  R   L   M +I +S Q ++ PI  +E + FKE++ QV+ FN
Sbjct: 592 IQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFN 651

Query: 616 RLVHEQQDXXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRII 675
             V+ QQ+              +                      W+EL  +L +D++II
Sbjct: 652 DAVNRQQEQQEAIKFLQTELNNI----IEQPAQSHDAIIDSDEDEWNELCDLLNRDAKII 707

Query: 676 KECQAEL 682
           ++C AEL
Sbjct: 708 EDCNAEL 714

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  211 bits (538), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 173/711 (24%), Positives = 304/711 (42%), Gaps = 65/711 (9%)

Query: 19  SERLCLHTKDLSRTI-LLEGNSLKWCLMDAPNYEYME--LNAISNYTSAVLNDSGTLLCL 75
           ++R    + D ++ + + +   L+WC   +  Y+ ++  L        AV + +   +C+
Sbjct: 18  AQRFLFSSSDGTKIVSIADRGHLRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCI 77

Query: 76  NNVDEIQVLALSWDQTRPE----------SYRIKVPAGVKQVLWHPRGRLDSCLTVLNKR 125
            N DE+ VL + W  +  E          S++      +KQVL+HP+  LDS + VL   
Sbjct: 78  YNRDELHVLEVPWMYSGEENGLKHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTND 137

Query: 126 DEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSEGADVF 185
           D I +              LN+  + LG+   + DI+ + FS DGL+L ++S  EG D+F
Sbjct: 138 DSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIF 197

Query: 186 SIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKLKATRQLHFMSSLYNQPHDA 245
           +IYPC+P    I+   +   F K+LL Y  ++   +P+ K    +QL+FM  +  Q    
Sbjct: 198 TIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTAF 257

Query: 246 DDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAKQIKAIAXXXXXXXXXXXXX 305
            + +  L+    +  AY NA+ QGPF+++P+P +LY   A     I              
Sbjct: 258 RNDKKPLI----LEDAYLNAQPQGPFSMTPYPNELYDFMATD-INIIQITQNISLLAIAF 312

Query: 306 XXXXXXXCFPDLTPVMSWEDSGSSEKNSLISVGSLKL-----------PGSISLIYGSCF 354
                     DL P+MSW+ S     NSL  +  +KL           PG+    YG   
Sbjct: 313 SNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLSIPGT----YGKFV 368

Query: 355 VLISAEKAAVVNLSRLTRSIERSLDDCDATELSEEDL---TEEITEKKGTFQSAGLWPES 411
           V  + +    VN    +  + + +DD D   L+   +    E + +   TF+S   W   
Sbjct: 369 VTDNVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNE 428

Query: 412 GMQKIVLLSEKEITSIDISSMQTPASSTTEKIEKSETNRQ----------------RPYS 455
            +    ++S+K+I  +D   M    SSTT+     ++N Q                  ++
Sbjct: 429 NISCNYIISDKKIEELD---MLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFA 485

Query: 456 QPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSRVTLA 515
           +PL+E+Q   Q     L++   T IP  +R   L N+ NE+QL  LT IS+  +  +++A
Sbjct: 486 RPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMA 545

Query: 516 QTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSIALRF 575
           QT             +E ++ +    ++    +        Q  + + ++EK + +  R 
Sbjct: 546 QTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERL 605

Query: 576 ESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDXXXXXXXXXXXX 635
            SL+  +    +   + +  I+ AE EWF E++  V+ FN  V +               
Sbjct: 606 SSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRK-------ASTNHQEL 658

Query: 636 XYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAELQCTT 686
            +++ +                G  W++LQ +L  D +II E   E +C T
Sbjct: 659 EFIK-EQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISEF--EKKCDT 706

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  152 bits (384), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 166/667 (24%), Positives = 275/667 (41%), Gaps = 88/667 (13%)

Query: 65  VLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCLTVLNK 124
           V++ SG L+  +   E+ V+ ++ +Q+R   +      G+K++LWHP         +L+ 
Sbjct: 65  VISPSGGLVAFHANSELYVMEVN-EQSRLRKH-FNTSLGIKKLLWHPLATYGLSFVILHD 122

Query: 125 RDEILLYELLSEDFSAPT-TVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSEGAD 183
              I +Y+L  ED    + TV N  +   G+   V+ +  + F   GLTLYL+S     D
Sbjct: 123 DSTIRIYDL--EDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD 180

Query: 184 VFSIYPCMPSELSI-----------TRKA--LKYNFNKALLQYQELSE------GDSPE- 223
           +++I+PC+P   S+           T+      Y  +K+L  Y  L +      G  P+ 
Sbjct: 181 IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDV 240

Query: 224 ------LKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFP 277
                 LK    +Q+ F  +   + +D  D+ T+        KA RN+  QGPF I  FP
Sbjct: 241 ESDYLTLKHDLLKQIQFFDNY--KKNDGIDTFTS--------KAIRNSVPQGPFIIKKFP 290

Query: 278 EKLYLATAKQIKA--IAXXXXXXXXXXXXXXXXXXXXCFPDLTPVMSWEDSGSSEKNSL- 334
             L    AK++    I                      F D   VMSW    ++  N+L 
Sbjct: 291 TAL---NAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLS 347

Query: 335 -ISVGSLKLPGSISLIYGSCFVLISAEKAAVVNLSRLTRSIE----RSLDDC----DATE 385
            I++ + K         G C +L S+E   V      T  +E      L  C    D + 
Sbjct: 348 VITMFNAK---------GQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSI 398

Query: 386 LSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLL---SEKEITSIDISSMQTPASSTTEK 442
           + +     +I    GTF    L   S +   +L    S K I S D S+ Q P + T E 
Sbjct: 399 IDDVKFENKIRTVSGTF----LGVLSTLSGDILYNGNSFKVIESNDKSTTQKPINRTDEV 454

Query: 443 IEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLT 502
             K       P S    E+  L  K ++     +S  IP +L    L N  NE QL +++
Sbjct: 455 --KYTYKPSLPTSG--KELDMLLTKYKTEANGFISG-IPDSLAPLPLKNNSNERQLEVVS 509

Query: 503 DISKEVLSRVTLAQTXXXXXXXXXXGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWE 562
           ++ KE + RV L Q            +  EL + LR  +E+   + +++ +L   + R+ 
Sbjct: 510 ELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYS 569

Query: 563 AIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQ 622
             +EK+K++  R + L    + I  + +L++  I++AE+ WFK ++NQV++FN  VH   
Sbjct: 570 RYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTN 629

Query: 623 DXXXXXXXXXXXXXYVRVDXXXXXXXXXXXXXXXGGVPWDELQAMLAKDSRIIKECQAEL 682
                                               + +  LQ ML  D ++I  C  EL
Sbjct: 630 KLREELEF-----------LDTQLRSTTKGDDFFSELEFSSLQQMLLNDKKVINSCMNEL 678

Query: 683 QCTTQEL 689
             + ++L
Sbjct: 679 SASIEDL 685

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 10/74 (13%)

Query: 67  NDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRG---RLDSCLTVLN 123
           N+ G +L L   D+++       Q+ P + +  +  G   + WHP G   R   C  +LN
Sbjct: 208 NNVGMILALGFSDKVK-------QSFPGTVKSGIIVGTSHLFWHPFGTYERTRQCYVILN 260

Query: 124 KRDEILLYELLSED 137
           K  E +    LS++
Sbjct: 261 KMKEFIHRVHLSQN 274

>Ecym_3152 Chr3 complement(280175..287557) [7383 bp, 2460 aa] {ON}
           similar to Ashbya gossypii AFR420W
          Length = 2460

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 41/97 (42%), Gaps = 18/97 (18%)

Query: 63  SAVLNDSGTLLC--LNNV-DEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCL 119
           +A+ N+S  LL   LN++ D I      W   R     I+  A +          L  CL
Sbjct: 232 TAIANNSPYLLYPYLNSILDNI------WRALRDTKLVIRTDAAIT---------LSHCL 276

Query: 120 TVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGS 156
            ++N RD IL    +   F   T  LN STNE   G+
Sbjct: 277 AIINDRDSILTNRWVQRLFKGCTYGLNLSTNEAVHGT 313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,017,985
Number of extensions: 2340528
Number of successful extensions: 8074
Number of sequences better than 10.0: 101
Number of HSP's gapped: 8393
Number of HSP's successfully gapped: 111
Length of query: 691
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 574
Effective length of database: 40,065,477
Effective search space: 22997583798
Effective search space used: 22997583798
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)