Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01452g7.341ON86864422e-58
Kwal_YGOB_Anc_7.3417.341ON86863921e-50
SAKL0F10956g7.341ON86832818e-34
ACL158W7.341ON95842514e-29
Ecym_45207.341ON91832498e-29
TDEL0C020607.341ON88882488e-29
Kpol_530.377.341ON88822081e-22
NCAS0A140807.341ON78841974e-21
TPHA0F029107.341ON108991987e-21
TBLA0E004707.341ON1161011962e-20
ZYRO0F11528g7.341ON121821943e-20
KLLA0C16709g7.341ON79861844e-19
CAGL0I03432g7.341ON149821791e-17
KNAG0C038107.341ON82831421e-12
Skud_4.957.341ON79821341e-11
NDAI0A019507.341ON122891344e-11
Suva_4.847.341ON81831281e-10
Smik_4.767.341ON80611272e-10
YDL160C-A (MHF2)7.341ON80651237e-10
KAFR0B009007.341ON78841115e-08
CAGL0M11616g8.295ON488078640.94
Ecym_73288.91ON20560612.3
TDEL0H019707.247ON55547603.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01452g
         (86 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...   174   2e-58
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...   155   1e-50
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...   112   8e-34
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...   101   4e-29
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...   100   8e-29
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...   100   8e-29
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    85   1e-22
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               80   4e-21
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    81   7e-21
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    80   2e-20
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    79   3e-20
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    75   4e-19
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    74   1e-17
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    59   1e-12
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    56   1e-11
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    56   4e-11
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    54   1e-10
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    54   2e-10
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    52   7e-10
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    47   5e-08
CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 ...    29   0.94 
Ecym_7328 Chr7 (695873..696490) [618 bp, 205 aa] {ON} similar to...    28   2.3  
TDEL0H01970 Chr8 (338582..340249) [1668 bp, 555 aa] {ON} Anc_7.2...    28   3.4  

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score =  174 bits (442), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%)

Query: 1  MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH 60
          MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH
Sbjct: 1  MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH 60

Query: 61 QDQLGDQVVLTHKDLERVSGLLLLDM 86
          QDQLGDQVVLTHKDLERVSGLLLLDM
Sbjct: 61 QDQLGDQVVLTHKDLERVSGLLLLDM 86

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score =  155 bits (392), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 73/86 (84%), Positives = 82/86 (95%)

Query: 1  MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH 60
          MP+S+P DTIARIFQTCSF++DSTRITE+TL+LVD YLE+FVREA+LRSIENK+QVK EH
Sbjct: 1  MPDSVPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEH 60

Query: 61 QDQLGDQVVLTHKDLERVSGLLLLDM 86
          QDQLG QVVLTHKDLERVSGLLLLDM
Sbjct: 61 QDQLGSQVVLTHKDLERVSGLLLLDM 86

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score =  112 bits (281), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 1/83 (1%)

Query: 4  SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQ 63
          S+P DTIARIFQTCSF  DSTRITE T++L + Y+E+FVREA+LRS+ENKE+VK E +  
Sbjct: 5  SLPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETE-S 63

Query: 64 LGDQVVLTHKDLERVSGLLLLDM 86
          L +  VL+H+DLE +SGLLLLDM
Sbjct: 64 LDNGTVLSHEDLEEISGLLLLDM 86

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score =  101 bits (251), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 47/84 (55%), Positives = 65/84 (77%), Gaps = 1/84 (1%)

Query: 4  SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSE-HQD 62
          +IP+DTIAR+F TCSF  DST+ITE  ++LV+ Y+++F+REA+LRS+ENKE+VK E   D
Sbjct: 12 AIPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRAD 71

Query: 63 QLGDQVVLTHKDLERVSGLLLLDM 86
             +  VL H DLE +SG+L+LD 
Sbjct: 72 SFAEGPVLQHTDLEEISGVLILDF 95

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score =  100 bits (249), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 65/83 (78%), Gaps = 1/83 (1%)

Query: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSE-HQDQ 63
          +PSDTIARIFQ CSF  DSTRITE T++L + Y+++FVREA+LRS+ENK++VK E  +  
Sbjct: 9  VPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGS 68

Query: 64 LGDQVVLTHKDLERVSGLLLLDM 86
          L +  VL H DLE +SG+LLLD 
Sbjct: 69 LIEGPVLHHTDLEEISGILLLDF 91

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score =  100 bits (248), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 67/88 (76%), Gaps = 2/88 (2%)

Query: 1  MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH 60
          M + IP +TIAR FQ  +F+++ST IT+ T+ ++  Y+EVFVREA+LRS  NKEQ+K EH
Sbjct: 1  MVDKIPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEH 60

Query: 61 QD--QLGDQVVLTHKDLERVSGLLLLDM 86
              +  +++VLTH+DLE ++GLLLLDM
Sbjct: 61 SGAQRNSNEIVLTHEDLENITGLLLLDM 88

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 84.7 bits (208), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)

Query: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
          IP +TIAR+ +T SF+  STRITE  +  +  Y+E+FVREA++RSIE K +++ E+    
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFT- 65

Query: 65 GDQVVLTHKDLERVSGLLLLDM 86
          G +V LTH DLE ++GLLLLDM
Sbjct: 66 GVRVELTHTDLEEIAGLLLLDM 87

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 80.5 bits (197), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 41/84 (48%), Positives = 61/84 (72%), Gaps = 8/84 (9%)

Query: 4  SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQ 63
          +IP +TIA+I Q  +F++  T++TE TLS++  Y+E+F+REA+ RS++NKE+       +
Sbjct: 2  AIPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEK-------E 54

Query: 64 LGD-QVVLTHKDLERVSGLLLLDM 86
          LG   +V+  KDLERV GLLLLDM
Sbjct: 55 LGQTDIVIDEKDLERVVGLLLLDM 78

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 80.9 bits (198), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 64/99 (64%), Gaps = 18/99 (18%)

Query: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSE----- 59
           IP DTIARI Q  SF ++ TRI+  ++ ++  Y+E+FVREA+LRSIEN+EQ +S      
Sbjct: 10  IPKDTIARILQLESFGEE-TRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68

Query: 60  ------HQDQLG------DQVVLTHKDLERVSGLLLLDM 86
                 + DQL       + + LTH+DLE +SGLLLLDM
Sbjct: 69  KAPAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 64/101 (63%), Gaps = 19/101 (18%)

Query: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
           +P +TIARI QT SF D++TRIT++T++ +  Y+E+F+REA LRS+ENKE+  S  +  +
Sbjct: 16  LPENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAV 75

Query: 65  GDQ-------------------VVLTHKDLERVSGLLLLDM 86
            ++                   + L+H+ LE ++GLLLLDM
Sbjct: 76  KNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 79.3 bits (194), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 60/82 (73%), Gaps = 2/82 (2%)

Query: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
           +P +TI RI +  +F+ +ST ITE T++++  YLEVFVREA+ RS+ NK+  +  H D  
Sbjct: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDS-QGSHGDGD 100

Query: 65  GDQVVLTHKDLERVSGLLLLDM 86
           G+ + L H+DLE+++G+LLLDM
Sbjct: 101 GE-IQLNHEDLEKITGMLLLDM 121

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 75.5 bits (184), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 56/86 (65%), Gaps = 8/86 (9%)

Query: 1  MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEH 60
          M N+  S TIARI QT  F+D +TRITE  + L++ Y+E+FVRE +LRS+ENK       
Sbjct: 1  MSNNSFSTTIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENK------- 53

Query: 61 QDQLGDQVVLTHKDLERVSGLLLLDM 86
           D L D+ V    DLE V+GLLL+D 
Sbjct: 54 ADMLADKTV-DFVDLEAVAGLLLMDF 78

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 73.6 bits (179), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 54/82 (65%), Gaps = 2/82 (2%)

Query: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
           +P DTIAR+ Q  +FKD  TRI    +  +  Y++VF REA+LRSIE+ +    E  +Q 
Sbjct: 70  VPQDTIARVLQVAAFKDKKTRIESDVVDALQRYIDVFAREAVLRSIEHHD-ASQEGLEQE 128

Query: 65  GDQVVLTHKDLERVSGLLLLDM 86
            D+ + TH DLE ++GLLLLDM
Sbjct: 129 QDKEI-THTDLENIAGLLLLDM 149

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 59.3 bits (142), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 53/83 (63%), Gaps = 11/83 (13%)

Query: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
          I  +T++RI  T SFK+ ST I +  L+ V  Y+E +V+E +LRS+ENK+         L
Sbjct: 9  ISRETLSRIL-TQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKD---------L 58

Query: 65 G-DQVVLTHKDLERVSGLLLLDM 86
          G +   LT +D+ER+ GLLLLDM
Sbjct: 59 GVNPAELTERDIERILGLLLLDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score = 56.2 bits (134), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 50/82 (60%), Gaps = 4/82 (4%)

Query: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
          +  D + +I    +F+ D  +I +  L ++  YL++F+ EA LRS+++++     H+D  
Sbjct: 2  LSKDALIKILSQNNFRKD-IKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHRD-- 58

Query: 65 GDQVVLTHKDLERVSGLLLLDM 86
             + L+H DLER+ GLLL+DM
Sbjct: 59 -GPLELSHLDLERIVGLLLMDM 79

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 56.2 bits (134), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 57/89 (64%), Gaps = 6/89 (6%)

Query: 4   SIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVK------ 57
           +I  +TI +I ++ SF++  T IT+ T+ ++  Y+++F++EA++RS ENK   +      
Sbjct: 34  TILLETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFDD 93

Query: 58  SEHQDQLGDQVVLTHKDLERVSGLLLLDM 86
            E  D+    + LTH DLER+ GLLL+++
Sbjct: 94  EEDADEEDKTIELTHLDLERIVGLLLMEL 122

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score = 53.9 bits (128), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 49/83 (59%), Gaps = 5/83 (6%)

Query: 5  IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64
          +P + I +I    +  D + +I +  + ++  YLE+F+ EA LRS+++ +     H    
Sbjct: 3  LPKEAIIKILSQNN-SDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHD--- 58

Query: 65 GDQVV-LTHKDLERVSGLLLLDM 86
          GD  + L+H DLER+ GLLL+DM
Sbjct: 59 GDGPLELSHLDLERIVGLLLMDM 81

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score = 53.5 bits (127), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 43/61 (70%), Gaps = 2/61 (3%)

Query: 26 ITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGLLLLD 85
          I++  + ++  YL++F+ EA LRS+++ + +  EH  +  D + L+H+DLERV G+LL+D
Sbjct: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKK--DPLELSHQDLERVVGVLLMD 79

Query: 86 M 86
          M
Sbjct: 80 M 80

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score = 52.0 bits (123), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 44/65 (67%), Gaps = 2/65 (3%)

Query: 22 DSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGL 81
          +  +I +  + ++  YL++F+ EA+LRS+++ + +  E  D+    + L+H+DLER+ GL
Sbjct: 18 NDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDK--SPLELSHQDLERIVGL 75

Query: 82 LLLDM 86
          LL+DM
Sbjct: 76 LLMDM 80

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 47.4 bits (111), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 4  SIPSDTIARIF-QTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQD 62
          SIP +TI+RI     +   ++  I   T+  V  Y +V + E +LRS+ENKE +      
Sbjct: 2  SIPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENIAEATP- 60

Query: 63 QLGDQVVLTHKDLERVSGLLLLDM 86
                 L   DLE++ GLLLLDM
Sbjct: 61 ------TLDVDDLEKIIGLLLLDM 78

>CAGL0M11616g Chr13 complement(1143091..1157733) [14643 bp, 4880 aa]
           {ON} similar to uniprot|Q12019 Saccharomyces cerevisiae
           YLR106c
          Length = 4880

 Score = 29.3 bits (64), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 9/78 (11%)

Query: 7   SDTIARIFQTCS-FKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQLG 65
           S+  +++F+    FKDD  +    + SL ++++  FV  AL+++I+N E +       L 
Sbjct: 775 SNEKSQLFKKWQLFKDDVEKFEVQSSSLENSFVFNFVEGALVKAIKNGEWL-------LL 827

Query: 66  DQVVLTHKD-LERVSGLL 82
           D++ L   D LE +S LL
Sbjct: 828 DEINLASADTLESISDLL 845

>Ecym_7328 Chr7 (695873..696490) [618 bp, 205 aa] {ON} similar to
           Ashbya gossypii AGR001W
          Length = 205

 Score = 28.1 bits (61), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 9   TIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQLGDQV 68
           T+ R+ QT   K+D   +TES L  +    ++  RE   + I+ +EQ K E  D   D++
Sbjct: 112 TLNRLIQTIGDKNDE--VTESKLERIKRLEQI--RELRKQEIKRREQAKREQLDNKKDEI 167

>TDEL0H01970 Chr8 (338582..340249) [1668 bp, 555 aa] {ON} Anc_7.247
           YER065C
          Length = 555

 Score = 27.7 bits (60), Expect = 3.4,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 26/47 (55%)

Query: 37  YLEVFVREALLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGLLL 83
           + E F  E    ++ NKE+V +E Q ++G      H++ ++++  LL
Sbjct: 317 FHEAFAEELQKSNVSNKERVLAEFQRKVGPYTGTPHREAQKLAKKLL 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,187,925
Number of extensions: 258450
Number of successful extensions: 1140
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1121
Number of HSP's successfully gapped: 32
Length of query: 86
Length of database: 53,481,399
Length adjustment: 58
Effective length of query: 28
Effective length of database: 46,830,771
Effective search space: 1311261588
Effective search space used: 1311261588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)