Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01430g7.342ON5022539721e-126
Kwal_56.246107.342ON5082558771e-112
SAKL0F10934g7.342ON4982576261e-74
KLLA0C16731g7.342ON4782566214e-74
NCAS0H006707.342ON4832656206e-74
TDEL0C020507.342ON5012595991e-70
Smik_12.2647.342ON6122666033e-70
Skud_4.947.342ON4472585844e-69
Smik_4.757.342ON4602595846e-69
Skud_12.2707.342ON6262735948e-69
YLR206W (ENT2)7.342ON6132685939e-69
YDL161W (ENT1)7.342ON4542585793e-68
Ecym_47317.342ON5142575824e-68
KAFR0L014607.342ON5502635821e-67
TPHA0D045607.342ON4872575762e-67
Suva_10.3007.342ON6182705816e-67
Suva_4.837.342ON4622585672e-66
ZYRO0F11550g7.342ON5382565662e-65
NDAI0D006107.342ON4862655464e-63
CAGL0A03872g7.342ON5102645466e-63
Kpol_2001.707.342ON5332535442e-62
KNAG0C038007.342ON4472655331e-61
ACL157C7.342ON5152595267e-60
TBLA0E004807.342ON5991965151e-57
KAFR0B008907.342ON4141274891e-55
KNAG0B026507.342ON6461314531e-48
TBLA0E020407.342ON7012004102e-42
Kwal_47.168574.346ON3821292422e-21
KLTH0D16896g4.346ON4011292379e-21
SAKL0G17952g4.346ON4151292371e-20
Suva_12.2164.346ON4101292371e-20
TBLA0E047604.346ON4261312371e-20
KNAG0M003804.346ON4031292352e-20
TDEL0D007104.346ON3751292342e-20
NDAI0D032004.346ON4351302344e-20
Skud_10.3494.346ON4101292334e-20
Smik_10.4184.346ON4091292325e-20
KLLA0B04587g4.346ON4001302316e-20
KAFR0B067404.346ON3991292316e-20
YJR125C (ENT3)4.346ON4081292317e-20
Kpol_1001.24.346ON4181312309e-20
ZYRO0B14784g4.346ON4241302254e-19
NCAS0A062104.346ON4231292237e-19
CAGL0H04323g4.346ON4121232238e-19
TPHA0B004004.346ON3991312228e-19
AER155C4.346ON3641302182e-18
Ecym_11334.346ON3921301943e-15
SAKL0H25762g4.17ON2621351629e-12
TBLA0B062204.346ON3391191641e-11
Kwal_55.206114.17ON2541341611e-11
Kpol_388.54.17ON2681051532e-10
KLTH0E05874g4.17ON2551121487e-10
TDEL0G017404.17ON2571191442e-09
Ecym_84074.17ON2541241423e-09
ZYRO0G07876g4.17ON2591001372e-08
TPHA0F002304.17ON280981301e-07
KLLA0D03949g4.17ON2251201263e-07
Suva_10.354.17ON2471211254e-07
TBLA0G006504.17ON4231151276e-07
CAGL0E03806g4.17ON2601301221e-06
ACL061C4.17ON2341051212e-06
Skud_12.304.17ON2471201202e-06
YLL038C (ENT4)4.17ON2471031184e-06
Smik_12.194.17ON2471031184e-06
NCAS0C058404.17ON2671151061e-04
NDAI0H002804.17ON3101401043e-04
TBLA0H012108.335ON491971000.001
SAKL0H02530g5.84ON66966960.005
KLLA0D16654g8.335ON39997940.007
KAFR0B058008.335ON38297930.007
AGR046C8.335ON38797930.008
KAFR0I014604.17ON275139910.011
NCAS0B036608.335ON416102920.012
YHR161C (YAP1801)5.84ON63768920.013
NDAI0J009308.335ON418116900.020
KNAG0A051008.335ON421101900.021
CAGL0E01199g8.335ON41297890.024
ZYRO0F13684g8.335ON40797870.040
KLTH0G11902g8.335ON39999850.078
Skud_8.2255.84ON62168850.082
KNAG0J028704.17ON329140840.094
TBLA0A040408.335ON41596840.11
Kwal_YGOB_27.112618.335ON404105840.12
Kwal_27.11263singletonOFF275104810.18
Smik_8.2455.84ON62768820.21
Kpol_344.88.335ON384102810.24
Suva_2.3158.335ON40397790.47
TDEL0F045908.335ON36197780.58
SAKL0H15290g8.335ON39397770.64
Skud_4.4128.335ON40697770.68
YDR153C (ENT5)8.335ON41197770.72
Smik_4.3988.335ON41697770.74
TPHA0C007408.335ON38597760.88
Kpol_1036.768.335ON36897760.99
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01430g
         (502 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   379   e-126
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   342   e-112
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   245   1e-74
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   243   4e-74
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    243   6e-74
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   235   1e-70
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   236   3e-70
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   229   4e-69
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   229   6e-69
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   233   8e-69
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   233   9e-69
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   227   3e-68
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   228   4e-68
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   228   1e-67
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   226   2e-67
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   228   6e-67
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   223   2e-66
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   222   2e-65
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   214   4e-63
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   214   6e-63
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   214   2e-62
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   209   1e-61
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   207   7e-60
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   202   1e-57
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   192   1e-55
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   179   1e-48
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   162   2e-42
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    98   2e-21
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    96   9e-21
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    96   1e-20
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    96   1e-20
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    96   1e-20
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    95   2e-20
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    95   2e-20
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    95   4e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    94   4e-20
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    94   5e-20
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    94   6e-20
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    94   6e-20
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    94   7e-20
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    93   9e-20
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    91   4e-19
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    91   7e-19
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    91   8e-19
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    90   8e-19
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    89   2e-18
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    79   3e-15
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    67   9e-12
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    68   1e-11
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    67   1e-11
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    64   2e-10
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    62   7e-10
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    60   2e-09
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    59   3e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    57   2e-08
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    55   1e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    53   3e-07
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    53   4e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    54   6e-07
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    52   1e-06
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    51   2e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    51   2e-06
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    50   4e-06
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    50   4e-06
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    45   1e-04
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    45   3e-04
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    43   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    42   0.005
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    41   0.007
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    40   0.007
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    40   0.008
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    40   0.011
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    40   0.012
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    40   0.013
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    39   0.020
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    39   0.021
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    39   0.024
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    38   0.040
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    37   0.078
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    37   0.082
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    37   0.094
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    37   0.11 
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    37   0.12 
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    36   0.18 
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    36   0.21 
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    36   0.24 
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    35   0.47 
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    35   0.58 
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    34   0.64 
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    34   0.68 
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    34   0.72 
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    34   0.74 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    34   0.88 
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    34   0.99 

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  379 bits (972), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 190/253 (75%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRALEESRMTAEQEE 180
           IVRVKARELTA                        KNSDSYDDDMQRALEESRMTAEQEE
Sbjct: 121 IVRVKARELTALLQDEERLREERELKGRNRRPRRRKNSDSYDDDMQRALEESRMTAEQEE 180

Query: 181 AERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXP 240
           AERRRKLEMYDNSADDLQTA                                       P
Sbjct: 181 AERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQQQTQQP 240

Query: 241 MYYDVFGNPISAE 253
           MYYDVFGNPISAE
Sbjct: 241 MYYDVFGNPISAE 253

 Score =  291 bits (746), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 146/178 (82%)

Query: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           PLETGSNNPFAKNAQQPSAEDPSKYAAASS                              
Sbjct: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPL 384

Query: 385 XXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS 444
             TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS
Sbjct: 385 KQTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS 444

Query: 445 NMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
           NMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL
Sbjct: 445 NMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  342 bits (877), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 171/255 (67%), Positives = 184/255 (72%), Gaps = 2/255 (0%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSKSL+R+AKNVVNGYSTTQVLLREATSNDP+GPSLD+MDEIAERSWDSVSFFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLY+IKTLREF HEDE G+DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRALEESRMTAEQEE 180
           IVRVKARELTA                          + S D+D+QRA+EESR+TAEQEE
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRPTAGSEDEDLQRAMEESRLTAEQEE 180

Query: 181 AERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXX 238
           AERRRKLE+YDNS+DDLQTA                                        
Sbjct: 181 AERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQTQAQ 240

Query: 239 XPMYYDVFGNPISAE 253
            PMYYDVFGNPISAE
Sbjct: 241 QPMYYDVFGNPISAE 255

 Score =  203 bits (517), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 117/186 (62%), Positives = 130/186 (69%), Gaps = 10/186 (5%)

Query: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAAS--------SXXXXXXXXXXXXXXXXXXXXXX 376
           PLETGSNNPFA+++ Q + ED SKYA  +                               
Sbjct: 325 PLETGSNNPFARHSNQNANEDASKYANVAPSPPQDNQLLSQQQQLQQEQQQQQQQQQQPQ 384

Query: 377 XXXXXXXXXXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQ 436
                     TRTGNQS+T+K S+LNNLLASGTGLDTFGNTGQTRIPAQHTKTG FINSQ
Sbjct: 385 PQPQPQPLKQTRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQ 444

Query: 437 GTGYKQVSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQG 496
           GTGYKQVS+ P  KHNPFLGQQYTGLPST+VVPSYTGYGFGNQ  Q Q NQN++NGADQG
Sbjct: 445 GTGYKQVSSTP--KHNPFLGQQYTGLPSTNVVPSYTGYGFGNQPNQNQQNQNQSNGADQG 502

Query: 497 VSLIDL 502
           +SLIDL
Sbjct: 503 MSLIDL 508

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  245 bits (626), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 136/257 (52%), Positives = 163/257 (63%), Gaps = 13/257 (5%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK+L+R AKNVVNGYS+ QVL+R ATSN+P GP++D +DE+AE+++D+V FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGKNWRHVAKSLTVLDYLVR GSE+CV W++ENLYIIKTLREF HEDE GVD GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXX----XXXKNSDSYDDDMQRALEESRMTA 176
           I+RVKA+ELT+                            +  + YDDD+QRALEESR+TA
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSRGGEEYDDDLQRALEESRLTA 180

Query: 177 EQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
           E+EE    R+ +   N  DD QTA                                    
Sbjct: 181 EEEERR--RRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQP--- 235

Query: 237 XXXPMYYDVFGNPISAE 253
               MYYDVFGNPI+ E
Sbjct: 236 ----MYYDVFGNPITPE 248

 Score =  173 bits (438), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/186 (55%), Positives = 116/186 (62%), Gaps = 25/186 (13%)

Query: 328 TGSNNPFAKNAQQPSAEDPSKYAAASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 387
           TGSNNPFA   Q+P  E  +   + S                                 T
Sbjct: 327 TGSNNPFALGRQEPDEEQITPKVSES------------VATTAGTTTATTTTQQQALNPT 374

Query: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447
           RTGNQS++ K++DLNNLLASGTGLDTFGNTGQTRIPAQHT+TG FINSQGTGYKQV+N  
Sbjct: 375 RTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTN-D 433

Query: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN-----------QNVQKQTNQNRANGADQG 496
           Q K+NPFL  QYTGLPSTSVVPSYTGYGFGN           Q  Q+Q  Q R N  DQG
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGNQQLSSQQGQQLQQQQQQQQQQRGN-PDQG 492

Query: 497 VSLIDL 502
           +SLIDL
Sbjct: 493 ISLIDL 498

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  243 bits (621), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/256 (53%), Positives = 160/256 (62%), Gaps = 13/256 (5%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK+ +R AKN+VNGYS  QVL+R ATSND DGPS+D ++E+AER++D+V FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119
           KRLNDKG+NWRHVAKSLT LD+LVRCGSE+CV W KENLYIIKTLREFTH DE T +D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIVRVKARELTAX---XXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRALEESRMTA 176
           +IVRVKA+ELTA                           ++ +  DDD+QRALEESR+TA
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDDDDLQRALEESRITA 180

Query: 177 EQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
           E+E  ERRRK  M       LQ A                                    
Sbjct: 181 EEE--ERRRKQLMMQGDDSSLQAA-------LELSKEEEELRRLQQLQAQQQAALWQQQQ 231

Query: 237 XXXPMYYDVFGNPISA 252
              PMYYD+FGNPISA
Sbjct: 232 QQQPMYYDIFGNPISA 247

 Score =  163 bits (413), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 85/92 (92%), Gaps = 1/92 (1%)

Query: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447
           RTGNQS++DKFS+LNNLLASGTG+DTFGNTG+TR+PAQHTKTGTFINSQGTGYKQ++N  
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITN-D 418

Query: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479
             KHNPFL  QYTG+PS+++ PSYTGYGFGNQ
Sbjct: 419 APKHNPFLTSQYTGIPSSAIAPSYTGYGFGNQ 450

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  243 bits (620), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 159/265 (60%), Gaps = 23/265 (8%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYSTTQVL+R+ATSND   PS +L+ E+A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLYIIKTLREF HED+ G DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXK------------NSDSYDDDMQRA 168
           I+RVKA+ELT+                        K             +D   D++QRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 169 LEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           LEESR+TAE++E  RRR++  YD+   DLQTA                            
Sbjct: 181 LEESRLTAEEDE-RRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQ 239

Query: 229 XXXXXXXXXXXPMYYDVFGNPISAE 253
                        Y+D+FGNPIS +
Sbjct: 240 PQG----------YFDIFGNPISPD 254

 Score =  166 bits (421), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 116/181 (64%), Gaps = 19/181 (10%)

Query: 325 PLETGSNNPFAKNA--QQPSAEDPSKYAAASSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 382
           PL+TGSNNPFA N    +P+ E    Y A++                             
Sbjct: 319 PLQTGSNNPFAMNNFNNKPAVESTQAYTASAPQLNQQPAQQQPQQQPLKQ---------- 368

Query: 383 XXXXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQ 442
               TRTGNQS+TDK+S LN LLA+GTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 369 ----TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 424

Query: 443 VSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ-NVQKQTNQNRANGADQGVSLID 501
           V+N P  K+NPFL  QYTGLPST++V + TGYGFGN  + Q+Q  Q +    DQG SLID
Sbjct: 425 VTNDP--KNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQGFSLID 482

Query: 502 L 502
           L
Sbjct: 483 L 483

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  235 bits (599), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 128/259 (49%), Positives = 156/259 (60%), Gaps = 21/259 (8%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKNVV GYS+ QVL+R AT+N+ +GPS+D +DE+AE+++DSV FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRH+AKSLTVLDYLVR GSE+CV W +ENLY+IKTL EF ++D+ GVDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IVRVKARELT------AXXXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRALEESRM 174
           I+RVKA+ELT                                  D +DDD+QRAL+ESR+
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 175 TAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           TA  EE ERRRK  M  +  DDLQ A                                  
Sbjct: 181 TA--EEDERRRK--MLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS----- 231

Query: 235 XXXXXPMYYDVFGNPISAE 253
                  YYD+FGNPIS E
Sbjct: 232 ------QYYDIFGNPISPE 244

 Score =  156 bits (395), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/180 (48%), Positives = 110/180 (61%), Gaps = 5/180 (2%)

Query: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAAS--SXXXXXXXXXXXXXXXXXXXXXXXXXXXX 382
           P+ TGSNNPFA N  Q     P++ +     +                            
Sbjct: 325 PMATGSNNPFALNNLQLQQARPAQSSPVPNFTSTQAQSPPKPQPQAQPQKQAPLPQQPQQ 384

Query: 383 XXXXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQ 442
                RTG+ ++T+K+ +LN LLA+GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGY+Q
Sbjct: 385 ALKPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQ 444

Query: 443 VSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
           V+  P  K NPFL  QYTG+PS+++VP++TGYGFGNQ  Q+   Q     ADQGVSLIDL
Sbjct: 445 VTGEP--KKNPFLQSQYTGIPSSNIVPAHTGYGFGNQPSQQNQAQQHQT-ADQGVSLIDL 501

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  236 bits (603), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 125/266 (46%), Positives = 158/266 (59%), Gaps = 16/266 (6%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXX---------------XXXXKNSDSYDDDM 165
           I+RVKA+EL +                                        +S SY +D+
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 166 QRALEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXX 225
           ++ALEESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQS 239

Query: 226 XXXXXXXXXXXXXXPMYYDVFGNPIS 251
                         P YYD+FGNPIS
Sbjct: 240 LSQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  157 bits (396), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 83/93 (89%), Gaps = 2/93 (2%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK++DLN LLA+GTG DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV N 
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479
           P  K+NPFL  QYTGLPST++VP+ TGYGFGNQ
Sbjct: 489 P--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 519

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  229 bits (584), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 129/258 (50%), Positives = 153/258 (59%), Gaps = 22/258 (8%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLYIIKTL+EF HED+ GVDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXK-----NSDSYDDDMQRALEESRMT 175
           IVRVKA+ELT                         K      +D  DDD+QRA++ SRMT
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMT 180

Query: 176 AEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  EE ERRRK +      +D +TA                                   
Sbjct: 181 A--EEDERRRKQD------EDYETA---------LQLSKEEEELKRLQDLQRMQQVHAQQ 223

Query: 236 XXXXPMYYDVFGNPISAE 253
               PMYYD+FGNPI+ E
Sbjct: 224 QQQQPMYYDIFGNPITPE 241

 Score =  155 bits (393), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/173 (53%), Positives = 112/173 (64%), Gaps = 24/173 (13%)

Query: 330 SNNPFAKNAQQPSAEDPSKYAAASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTRT 389
           SNNPFAK  Q+ +++   +   ASS                                TRT
Sbjct: 299 SNNPFAKPNQEVTSQKQDQSFMASSSMQQQQQQQPLTQ-------------------TRT 339

Query: 390 GNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQG 449
           GNQS+TDK+  LN LLA+GTG+DTFGN G +R+PAQHTKTGTFINSQGTGY+QVSN P  
Sbjct: 340 GNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDP-- 397

Query: 450 KHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
           K NPFL  QYTGLPST++VP+ TGYGFGNQ  Q+Q+  NR+N   QG +LIDL
Sbjct: 398 KQNPFLNSQYTGLPSTNIVPTQTGYGFGNQP-QQQSQNNRSNS--QGYTLIDL 447

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  229 bits (584), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 126/259 (48%), Positives = 156/259 (60%), Gaps = 24/259 (9%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLYIIKTL+EF HED+ G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXX------XXXXXXXKNSDSYDDDMQRALEESRM 174
           IVRVK++ELTA                              ++S+  D+D+QRAL+ SRM
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 175 TAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           TA  EE E+RRK++      +D +TA                                  
Sbjct: 181 TA--EEDEKRRKMD------EDYETA----------LQLSKEEEELKRLQDLQRMQQLQT 222

Query: 235 XXXXXPMYYDVFGNPISAE 253
                PMYYD+FGNPI+ E
Sbjct: 223 QQQQQPMYYDIFGNPITPE 241

 Score =  155 bits (393), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/116 (70%), Positives = 94/116 (81%), Gaps = 5/116 (4%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS+TDK++ LN LLA+GTG+DTFGN G  R+PAQHTKTGTFINSQGTGYKQVSN 
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
           P  K+NPFL  QYTGLPST+VVP+ TGYGFGNQ  Q+  N +  N   QG +LIDL
Sbjct: 410 P--KYNPFLSGQYTGLPSTNVVPTQTGYGFGNQPQQQSQNNHLNN---QGYALIDL 460

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  233 bits (594), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 157/273 (57%), Gaps = 21/273 (7%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           M K  +R AKN+V GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXK---------------NSDSYDDDM 165
           I+RVKA+EL +                                        +S SY D++
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 166 QRALEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXX 225
           ++ LEESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 181 EKVLEESRITA-QEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQP 239

Query: 226 XXXX-----XXXXXXXXXXPMYYDVFGNPISAE 253
                              P YYD+FGNPIS +
Sbjct: 240 LSQMPVPVQQQQQQQQQQLPAYYDIFGNPISQD 272

 Score =  157 bits (397), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 85/93 (91%), Gaps = 2/93 (2%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK++DLN LLA+GTGLDTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV++ 
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479
           P  K+NPFL  QYTGLPST++VP+ TGYGFGNQ
Sbjct: 514 P--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQ 544

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  233 bits (593), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 125/268 (46%), Positives = 157/268 (58%), Gaps = 18/268 (6%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXK---------------NSDSYDDDM 165
           I+RVKA+EL +                                        +S SY DD+
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 166 QRALEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXX 225
           ++ALEESR+TA QE+ +RRR+L  YD+   D Q A                         
Sbjct: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQS 239

Query: 226 XXXXXXXXXXXXXXPM--YYDVFGNPIS 251
                             YYD+FGNPIS
Sbjct: 240 LSQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  161 bits (408), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 89/105 (84%), Gaps = 2/105 (1%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK+SDLN LLA+GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV+N 
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRAN 491
           P  K+NPFL  QYTGLPST++VP+ TGYGFGNQ     TN  + N
Sbjct: 488 P--KNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPTNSPQQN 530

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  227 bits (579), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 126/258 (48%), Positives = 152/258 (58%), Gaps = 22/258 (8%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRH+AK+LTV+DYL+R GSE+CV W +ENLYIIKTL+EF HED+ G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKARELTA-----XXXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRALEESRMT 175
           IVRVKA+ELTA                               SD  DDD+QRA+  SR+T
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRLT 180

Query: 176 AEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  EE ERRRK +      +D +TA                                   
Sbjct: 181 A--EEDERRRKQD------EDYETA---------LQLSKEEEELKRLQDLQRMQQQQGQQ 223

Query: 236 XXXXPMYYDVFGNPISAE 253
               PMYYD+FGNPI+ E
Sbjct: 224 QLQQPMYYDIFGNPITPE 241

 Score =  150 bits (380), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 93/115 (80%), Gaps = 5/115 (4%)

Query: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447
           RTGNQS+TDK+S LN LLA+GTG+DTFGN G+ RIPAQHTKTGTFINSQGTGY+QVS+ P
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
              HNPFL  QYTGLPSTSVVP+ TGYGFGNQ+ Q+  N    N   +G +LIDL
Sbjct: 405 N--HNPFLNSQYTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNN---RGYTLIDL 454

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 240 PMYYDVFGNPIS 251
           PMYYDVFGNPI+
Sbjct: 263 PMYYDVFGNPIT 274

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  228 bits (582), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/257 (48%), Positives = 151/257 (58%), Gaps = 8/257 (3%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK L+R AKNV+NGYS  QVL+R ATSND  GPSLD M+E+AER++ +V FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119
           +RLNDK KNWRHVAKSLTV DYLVR G+E CV WA+EN++II+ L EF H DE +G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIVRVKARELTAXXXXXXXXXXXXXXX----XXXXXXXXXKNSDSYDDDMQRALEESRMT 175
           Q++RVKA+EL A                             N D  D D++RALEESR+T
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPDLKRALEESRIT 180

Query: 176 AEQEEAERRRKLEMYDNSADDLQTA-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           AE+E  ERRRKL      A++LQ A                                   
Sbjct: 181 AEEE--ERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQV 238

Query: 235 XXXXXPMYYDVFGNPIS 251
                PMYYD+FGNPI+
Sbjct: 239 QYQQQPMYYDIFGNPIT 255

 Score =  162 bits (411), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 81/116 (69%), Positives = 97/116 (83%), Gaps = 4/116 (3%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK+ +LN LLA+GTG+DTFGNTGQ RI +QHTKT TFINS GTG+KQVSN 
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
           P  KHNPFL  QYTGLPST++VPS+TGYGFGN +  +QT  ++ N  DQG+SLIDL
Sbjct: 463 PP-KHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQT-ASKPN--DQGMSLIDL 514

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  228 bits (582), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 153/263 (58%), Gaps = 19/263 (7%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKNV+ GYS+TQVL+R+ATSND    ++D +D+IA RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK W+H+ KSLTVLDYLVR GSE+CV W KENLY+IKTLREF +ED+TG+DQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IVRVKARELTA------------XXXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRA 168
           I+RVKA+ELT+                                     N    DDD+QR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 169 LEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           +EES+ TAE++E  RR++L  YD    + Q A                            
Sbjct: 181 IEESKKTAEEDE-RRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQ 239

Query: 229 XXXXXXXXXXXPMYYDVFGNPIS 251
                       +YYDVFGNPIS
Sbjct: 240 QQTSAN------VYYDVFGNPIS 256

 Score =  154 bits (390), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 83/92 (90%), Gaps = 1/92 (1%)

Query: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447
           RTGN+ +T+K+S+LNNLLA GTG+DTFGNTGQ RIPAQHTKTGTFINSQGTGYKQV+N  
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTN-E 447

Query: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479
           + K+NPFL  QYTGLPS+++VPS TGYGFGNQ
Sbjct: 448 RSKNNPFLNTQYTGLPSSNIVPSSTGYGFGNQ 479

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  226 bits (576), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/257 (49%), Positives = 154/257 (59%), Gaps = 22/257 (8%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MS   +R  KNVV GYS+TQVL+R AT+N+  GP++DL+ +IAE+++DS  FFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDET--GVDQ 118
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLY+IKTL EF +EDE   GVDQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXKNSDSY--DDDMQRALEESRMTA 176
           GQI+RVKA+ELTA                        +       D+D+QRALEESR TA
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGSDEDLQRALEESRRTA 180

Query: 177 EQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 236
             EE ER+R+L   D+   DLQ A                                    
Sbjct: 181 --EEDERKRRLNQDDS---DLQAA-------------LQLSKEEEELKRLQELQSSMHMQ 222

Query: 237 XXXPMYYDVFGNPISAE 253
              P+YYDVFGNPIS E
Sbjct: 223 QQQPVYYDVFGNPISYE 239

 Score =  146 bits (368), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 95/115 (82%), Gaps = 2/115 (1%)

Query: 388 RTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMP 447
           RTGN+ +T+K+++LN LLASGTG+DTFGNTG+TRIPAQHT+TGTFINSQGTGY+Q S   
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSG-- 432

Query: 448 QGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
           + K NPFL  QYTGLPS++++P+ TGYGFGNQ  Q+Q  Q +    +QGVSLIDL
Sbjct: 433 ESKVNPFLSNQYTGLPSSNIIPTQTGYGFGNQPQQQQYQQQQQQNNNQGVSLIDL 487

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  228 bits (581), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 121/270 (44%), Positives = 156/270 (57%), Gaps = 26/270 (9%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R+AT+NDP  PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXK-------------------NSDSY 161
           I+RVKA+EL +                                            +  +Y
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 162 DDDMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXX 221
            +D+++ALEESR+TA+++E  RR ++  YD+   D Q A                     
Sbjct: 181 QNDLEKALEESRITAQEDEL-RRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQ 239

Query: 222 XXXXXXXXXXXXXXXXXXPMYYDVFGNPIS 251
                               YYD+FGNPIS
Sbjct: 240 LQSQLQMPPQQQAA------YYDIFGNPIS 263

 Score =  157 bits (396), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 84/93 (90%), Gaps = 2/93 (2%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK++DLN LLA+GTG DTFGNTG++RIPAQHTKTGTFINSQGTGYKQV N 
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479
           P  K+NPFL  QYTGLPSTS+VP+ TGYGFGNQ
Sbjct: 497 P--KNNPFLNSQYTGLPSTSIVPTQTGYGFGNQ 527

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  223 bits (567), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 152/258 (58%), Gaps = 22/258 (8%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK L+R AKN+V GYS+TQVL+R ATSND +  S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLYIIKTL+EF H+D+ G DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXX-----XXXXXXXXXXXXXKNSDSYDDDMQRALEESRMT 175
           IVRVKA+ELT+                               S   DDD+QRA++ SRMT
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 176 AEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  +E ERRRK +      +D +TA                                   
Sbjct: 181 A--DEDERRRKQD------EDYETA---------LQLSKEEEELKRLQDLQRIQAQQQQQ 223

Query: 236 XXXXPMYYDVFGNPISAE 253
               PMY D+FGNPI+ E
Sbjct: 224 QQQQPMYCDIFGNPITPE 241

 Score =  167 bits (422), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/117 (71%), Positives = 96/117 (82%), Gaps = 7/117 (5%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS+TDK+S LN LL +GTG+DTFGN G TR+PAQHTKTGTFINSQGTGY+QVSN 
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGAD-QGVSLIDL 502
           P  KHNPFL  QYTGLPST+VVP+ TGYGFGNQ  Q    Q++ NG + QG +LIDL
Sbjct: 412 P--KHNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQ----QSQTNGTNSQGYALIDL 462

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 240 PMYYDVFGNPIS 251
           PMYYD+FGNPIS
Sbjct: 267 PMYYDMFGNPIS 278

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  222 bits (566), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 122/256 (47%), Positives = 150/256 (58%), Gaps = 17/256 (6%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           M    +R AKN + GY++ QVL+R+AT+N+ +GPS+D++DE+A RS+DSV FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +ENLYIIKTLREF H+D+   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IVRVKARELTA-----XXXXXXXXXXXXXXXXXXXXXXXXKNSDSYDDDMQRALEESRMT 175
           I+RVKA+ELT                                 +SYD +MQRAL+ SR+T
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLT 180

Query: 176 AEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 235
           A  EE ERRRK    +N   DL+TA                                   
Sbjct: 181 A--EEDERRRK--TLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQG-- 234

Query: 236 XXXXPMYYDVFGNPIS 251
                 YYD+FGNPIS
Sbjct: 235 ------YYDIFGNPIS 244

 Score =  149 bits (375), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 109/188 (57%), Gaps = 14/188 (7%)

Query: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAASSXX--------XXXXXXXXXXXXXXXXXXXX 376
           P+ TGSNNPFA N      +  SK  AAS                               
Sbjct: 355 PVSTGSNNPFALNGM--PLQSNSKPQAASDLAGLNNWGNNSTGQLEMPKYQPRPQQPQHN 412

Query: 377 XXXXXXXXXXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQ 436
                      RTGNQS++DK++DLN LLA  TG+DTFGN G  RIPAQHTKTGTFINSQ
Sbjct: 413 TAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQ 472

Query: 437 GTGYKQVSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN--QNVQKQTNQNRANGAD 494
           GTG+KQ SN P  K NPFL  Q+TG+P++SVVPS+TGYGFGN     Q+ +   +   AD
Sbjct: 473 GTGFKQYSNEP--KKNPFLPTQFTGIPTSSVVPSHTGYGFGNQQAQNQQISQPPQQQQAD 530

Query: 495 QGVSLIDL 502
           QGVSLIDL
Sbjct: 531 QGVSLIDL 538

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  214 bits (546), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 126/265 (47%), Positives = 155/265 (58%), Gaps = 14/265 (5%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R AKN++ GYSTTQVL+R+ATSND   PS +++ EI++RS+DSV FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W K+NLYIIKTL+EF  ED+  VD+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXKNSD-----------SYDDDMQRAL 169
           I+RVKA+ELTA                        KN               D+D+Q+AL
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 170 EESRMTAEQEEAERRRKLEMYDNSADDLQTA-XXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
           EESR+TAE++E   RR+L  YDN   D QTA                             
Sbjct: 180 EESRITAEEDERR-RRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQ 238

Query: 229 XXXXXXXXXXXPMYYDVFGNPISAE 253
                       +YYD+FGNPIS E
Sbjct: 239 MQFQQQPQQQEQVYYDIFGNPISPE 263

 Score =  151 bits (382), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/90 (76%), Positives = 81/90 (90%), Gaps = 1/90 (1%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK+++LNNLLASGTG+DTFGNTG  RIPAQHT+TGTFINSQGTGYKQ+ N 
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGF 476
           P  K NPFL  QYTGLPS+++VPS+TGYGF
Sbjct: 428 PV-KKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  214 bits (546), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 126/264 (47%), Positives = 159/264 (60%), Gaps = 24/264 (9%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           M   L+R AKN+V GYS+TQV++R+AT+ND   PS+ +++++A++++D+V FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLYIIKTLREF HEDE +G D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXK------------NSDSYDDDMQR 167
           QI+RVKA+ELT+                        K              ++YDDD+Q+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 168 ALEESRMTAEQEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXX 227
           ALEESRMTAE+EEA RR +   Y+N   DL  A                           
Sbjct: 181 ALEESRMTAEEEEARRREQ-AQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQ 239

Query: 228 XXXXXXXXXXXXPMYYDVFGNPIS 251
                        +YYD+FGNPIS
Sbjct: 240 QQN----------VYYDIFGNPIS 253

 Score =  161 bits (408), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 85/91 (93%), Gaps = 2/91 (2%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS++DK+S+LNNLLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV+N 
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFG 477
           P  K+NPFL  QYTGLPST++VPS+TGYGFG
Sbjct: 421 P--KNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  214 bits (544), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 120/253 (47%), Positives = 152/253 (60%), Gaps = 14/253 (5%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           M K  +R AKNVV GYS+TQV++R ATSND  GP +D +D +AE+++DSV FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLYII+TL+EF++ D++  DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXKNSD--SYDDDMQRALEESRMTAEQ 178
           I+RVKA+ELT+                        +     S DD++QRA+EES+ TAE 
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPSDDDELQRAIEESKRTAED 180

Query: 179 EEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           ++  RR + +       DLQTA                                      
Sbjct: 181 DDRRRRMRDD----EEADLQTA--------LQLSKEEEELKRLQELQRLQQQQQQQQQQQ 228

Query: 239 XPMYYDVFGNPIS 251
            PMYYD+FGNPIS
Sbjct: 229 QPMYYDIFGNPIS 241

 Score =  158 bits (400), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 83/92 (90%), Gaps = 2/92 (2%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQ +TDKF +LN LLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGY+QV+N 
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN 478
           P  K+NPFL  QYTGLPST++VPS+TGYGFGN
Sbjct: 443 P--KNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  209 bits (533), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 155/265 (58%), Gaps = 39/265 (14%)

Query: 5   LMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLN 64
           ++R AKN+V GYS T+VL+R+AT+N+   PS +L+D++A++S++SV FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRV 124
           DKGK WRHVAK+LTVLDYLVR GSE+CV W +ENLYIIKTLREF+HED  G D+G+I+RV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KARELTAXXXXXXXXXXXXXXXXXXXXXXXXKNSDSY------DDDMQRALEESRMTAE- 177
           KA+ELT+                        ++  S       D+D+QRA+EES+ TAE 
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 178 ---------QEEAERRRKLEMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 228
                      EA+R+  L++     +DL+                              
Sbjct: 181 EERRRRNGASSEADRQAALQL-SREEEDLR----------------------RLQEQARL 217

Query: 229 XXXXXXXXXXXPMYYDVFGNPISAE 253
                      PMYYDVFGNPI+ E
Sbjct: 218 AQQQQQQQQQQPMYYDVFGNPITPE 242

 Score =  158 bits (400), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 102/155 (65%), Gaps = 22/155 (14%)

Query: 326 LETGSNNPFA-KNAQQPSAEDPSKYAAASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           L TGSNNPFA  NA QPSA  P+   AA                                
Sbjct: 295 LPTGSNNPFALNNATQPSA--PASTTAARPAAIETPATQTKPLTQ--------------- 337

Query: 385 XXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS 444
             TR+GNQ+++DK+S LNNLLASGTG+DTFGNTG+ RIPAQHT+TGTFINSQGTGY+QV+
Sbjct: 338 --TRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVN 395

Query: 445 NMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQ 479
           N    K NPFL  QYTGLPST++VP+ TG+GFGNQ
Sbjct: 396 N--DDKPNPFLNGQYTGLPSTNIVPTQTGFGFGNQ 428

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  207 bits (526), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 152/259 (58%), Gaps = 11/259 (4%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK L+R AKNVVNGYS  Q+L+R ATSN+  GPS+D M+E+AERS+ +V FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV WA+ENLY+ + L EF H DE TGVD G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIVRVKARELTAXXXXXXXXXXXXXXXXXXXXXXXXKN----SDSYDDDMQRALEESRMT 175
           QI+RVKAREL A                         +    ++  D D+QRALEESR+T
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPAEDLDPDLQRALEESRIT 180

Query: 176 AEQEEAERRRKL-EMYDNSADDLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 234
           AE+EE  RR K  +  DN  ++L+ A                                  
Sbjct: 181 AEEEERRRREKTNQQQDN--EELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQ 238

Query: 235 XXXXXPMYYDVFGNPISAE 253
                 MYYD+FGNPIS E
Sbjct: 239 PQA---MYYDIFGNPISLE 254

 Score =  174 bits (442), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 87/118 (73%), Positives = 99/118 (83%), Gaps = 5/118 (4%)

Query: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446
           TRTGNQS+TDK+S+LN LLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV N 
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN--QNVQKQTNQNRANGADQGVSLIDL 502
           P  KHNPF+  QYTGLPST++VPS+TGYGFGN     Q+  N N+ N  +Q +SLID+
Sbjct: 461 PP-KHNPFIATQYTGLPSTNMVPSHTGYGFGNAGNGFQQSGNSNKPN--EQNISLIDI 515

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  202 bits (515), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/196 (51%), Positives = 129/196 (65%), Gaps = 23/196 (11%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MSK  +R  KN+V GYS+TQ+L+R+AT+ND + PS+D++D+IAE+++DSV FFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED----ETGV 116
           KRLNDKGK W+HVAKSLTVLDYL+R GSE+CV W KENLY+IKTL+EF  +D     TG 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIVRVKARELTA-------------------XXXXXXXXXXXXXXXXXXXXXXXXKN 157
           DQGQIVRV+A ELT+                                           + 
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 158 SDSYDDDMQRALEESR 173
            D YDDD+Q+A+EES+
Sbjct: 181 DDHYDDDLQKAIEESK 196

 Score =  155 bits (391), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 86/174 (49%), Positives = 105/174 (60%), Gaps = 10/174 (5%)

Query: 325 PLETGSNNPFA-KNAQQPSAEDPSKYAAAS------SXXXXXXXXXXXXXXXXXXXXXXX 377
           P+ TG+NNPF+  N   P  + P   +++S      S                       
Sbjct: 401 PMVTGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPATQSSYTTKTNAS 460

Query: 378 XXXXXXXXXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQG 437
                     RTGNQ ++DK+++LN LLA+GTG+DTFGNTG  RIPAQHT TGTFINSQG
Sbjct: 461 SLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQG 520

Query: 438 TGYKQVSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRAN 491
           TGYKQ  N P  K+NPF+  QYTGLPST+VVPSYTGYGFGNQ  Q QT  ++ N
Sbjct: 521 TGYKQYINDP--KNNPFMSNQYTGLPSTNVVPSYTGYGFGNQ-PQPQTTASQPN 571

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  192 bits (489), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 109/127 (85%)

Query: 5   LMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLN 64
           ++R AKN+V GYS+TQ L+R+ATSN  D P +D + E+AE +++++ FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRV 124
            KGK W+HV KSL VLDYLVR GSE+CV W KENLYIIKTLREFT+EDE+G+DQGQ+VRV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KARELTA 131
           +A+ELT+
Sbjct: 121 RAKELTS 127

 Score =  150 bits (380), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 96/157 (61%), Gaps = 25/157 (15%)

Query: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 384
           PL TGSNNPFA N ++     P      ++                              
Sbjct: 275 PLATGSNNPFALNNKKLQQHTPEPSVIDTTLNTQAPLKQ--------------------- 313

Query: 385 XXTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVS 444
             TRTG+QS++DK+S LN LLA+GTG+DTFGNTG  RIPAQHTKTGTFINSQGTGYKQVS
Sbjct: 314 --TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVS 371

Query: 445 NMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNV 481
               G +N FL  QYTGLPS+++VPS TGYGFGN  V
Sbjct: 372 T--NGFNNVFLNSQYTGLPSSNIVPSQTGYGFGNSTV 406

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 13/14 (92%)

Query: 240 PMYYDVFGNPISAE 253
           PMYYD+FGNPI+ E
Sbjct: 217 PMYYDIFGNPITPE 230

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 82/131 (62%), Positives = 104/131 (79%), Gaps = 1/131 (0%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MS+  +R AKNV+ GYS+TQVL+R+AT+ND   P LD +++IA  S+DSV FFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTH-EDETGVDQG 119
           KRLND GK WRH+ KSLTVLDYLVR GSEHC  WA+++L+++K LR F   +D  G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIVRVKARELT 130
           QIVRVKAR+L 
Sbjct: 121 QIVRVKARDLV 131

 Score =  143 bits (360), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (84%), Gaps = 5/98 (5%)

Query: 389 TGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQ 448
           TGNQ VT+K+S+LNNLLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQV++  +
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNS--E 553

Query: 449 GK---HNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQK 483
           GK    NPFL  QYTGLPST +VP+YTGYGFGNQ+ Q+
Sbjct: 554 GKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFGNQSDQQ 591

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (71%), Gaps = 1/39 (2%)

Query: 162 DDDMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTA 200
           DDD+QRA+EES+ T  QE+ ERRR+L MYD    + Q A
Sbjct: 205 DDDLQRAIEESKRTV-QEDEERRRQLSMYDEEDPEFQAA 242

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  162 bits (410), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 119/200 (59%), Gaps = 12/200 (6%)

Query: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60
           MS   +R  KN+  GYS TQVL+R+AT+N+  G S+D++D++ E S+D+  F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           +R++DK K WRHVAKSLTV+DYLVR GSE CV WA++N   ++ LR+F + D  G+DQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IVRVKARELTAXXXXXXXXXXXXXXXXXXXXXX------------XXKNSDSYDDDMQRA 168
           ++RVKA EL                                            ++D+ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 169 LEESRMTAEQEEAERRRKLE 188
           LEES+ TAE++EA RR+  E
Sbjct: 181 LEESKKTAEEDEARRRKDQE 200

 Score =  111 bits (278), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 73/114 (64%), Gaps = 8/114 (7%)

Query: 389 TGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQ 448
           TGN  ++ K+S+LN LLA GTG+DTFGN G TRIPAQHTKTGTFINSQGTGYKQV++   
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTS--S 653

Query: 449 GKHNPFLGQQYTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL 502
               P L  QYTGLP+ + V   +         + QT Q       QG +L+DL
Sbjct: 654 SSPIPLLPTQYTGLPAQTAVHVPSPSPLQPSEKEHQTQQT------QGFTLVDL 701

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR +A EL
Sbjct: 135 NVRNRAHEL 143

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 95.9 bits (237), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+N+V  Y+  +  +REAT+N+P G S  LM++I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR +A EL
Sbjct: 135 NVRNRAHEL 143

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 80/129 (62%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++I+  +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +  ++ NL +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR +A+EL
Sbjct: 135 NVRNRAQEL 143

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LMD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR + + L
Sbjct: 135 NVRTRVKAL 143

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 82/131 (62%), Gaps = 1/131 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K  N WR + K+L +L+YL+  G+E  +  A+ +L +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IVRVKARELTA 131
            VR +A+ +T+
Sbjct: 135 NVRSRAQAMTS 145

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 80/129 (62%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  ++  +  +REAT+N+P G S  LM++IA+ +++     E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   +  L I++ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKAREL 129
            VR +A+++
Sbjct: 135 NVRNRAKQI 143

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 94.7 bits (234), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 80/129 (62%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   RRA+NVV  Y+  +  +REAT+N+P G S  LM++I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           RL +K  N WR + K+L +LDYL+R  SE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR +A+ L
Sbjct: 135 NVRNRAKAL 143

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 81/130 (62%), Gaps = 1/130 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++IA+ +++    +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + +L +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IVRVKARELT 130
            VR +A+ L 
Sbjct: 135 NVRNRAKLLV 144

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LMD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR + + L
Sbjct: 135 NVRTRVKTL 143

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LMD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR + + L
Sbjct: 135 NVRTRVKAL 143

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 78/130 (60%), Gaps = 1/130 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM+ IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + K+L +L+YLV+ GSE  +   + NL ++K L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKARELT 130
            VR +A +L 
Sbjct: 135 NVRNRASQLV 144

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 93.6 bits (231), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/129 (38%), Positives = 80/129 (62%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR +A+ L
Sbjct: 135 NVRNRAKAL 143

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LMD+I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D  G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKAREL 129
            VR + + L
Sbjct: 135 NVRTRVKAL 143

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 93.2 bits (230), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 81/131 (61%), Gaps = 1/131 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NV+  Y+  +  +REAT+N+P G S  LM++I++ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   + +L +IK L  F + D  G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKARELTA 131
            VR KA+ LTA
Sbjct: 135 NVRNKAQSLTA 145

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 80/130 (61%), Gaps = 1/130 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM+ IA+ +++     EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K  N WR + K+L +L+YL++ GSE  +   + ++ ++K L  F + D  G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IVRVKARELT 130
            VR +A+ LT
Sbjct: 170 NVRTRAKALT 179

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 79/129 (61%), Gaps = 1/129 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   + ++ ++K L+ F + D  G DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IVRVKAREL 129
            VR +   L
Sbjct: 135 NVRNRVTTL 143

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+P G S  LM++IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K G  WR + K+L +L+YL++ GSE  +   + ++ I+K L  F + D  G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IVR 123
            VR
Sbjct: 135 NVR 137

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 78/131 (59%), Gaps = 1/131 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NV+  Y+  +  +REAT+N+P G S  LM +IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + KSL + DYL++ GSE  +   + ++ +IK L  F + D  G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKARELTA 131
            VR KA+ L A
Sbjct: 135 NVRNKAQSLVA 145

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 78/130 (60%), Gaps = 1/130 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NV+  Y+  +  +REAT+N+P G S  LM +IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDKGKN-WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K  N WR + KS+ +L+YLV+ GSE  +   + NL +I+ L  F + D  G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IVRVKARELT 130
            VR + + L 
Sbjct: 135 NVRNRTKALV 144

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 73/130 (56%), Gaps = 1/130 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R+A+NVV  Y+  +  +REAT+N+  G    LM +IA+ +++     EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120
           R  +K    WR + KS+ +L+YL+  GSE  +   +  L +IK L  F + D  G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKARELT 130
            VR + + L 
Sbjct: 135 NVRNRTQALV 144

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 77/135 (57%), Gaps = 11/135 (8%)

Query: 4   SLMRRAKNVVNGYSTTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           S +R  +N+  G STT+V +++AT +D   G +  LM+EI+  ++ + +  EI  ++ +R
Sbjct: 2   SFIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREF---THEDET 114
           L+        +N  H+ K+LT++ YL+  GS   V W ++  Y++ TLREF     +D  
Sbjct: 60  LSGNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDRK 119

Query: 115 GVDQGQIVRVKAREL 129
             +Q +++ +K  +L
Sbjct: 120 MAEQVRMLSIKLSKL 134

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 2   SKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDK 61
           +K   R A+N +   +  +  +REAT+NDP G S+ LM +I   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQG 119
           R  +K G  WR + KS+ +L YL+  GS   V   K NL +IK L  F   D+ G +Q 
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQS 133

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 73/134 (54%), Gaps = 8/134 (5%)

Query: 4   SLMRRAKNVVNGYSTTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           SL++  +N+  G S+T+V  R AT++D  +G +  LM+E++  ++   +  EI  ++ KR
Sbjct: 2   SLLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKR 59

Query: 63  LN-----DKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVD 117
           L+        KN  H+ K+LT++ YL+  GS+  V W +  LY+I TL+EF     T   
Sbjct: 60  LSGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKER 119

Query: 118 QGQIVRVKARELTA 131
               +R  A  L A
Sbjct: 120 MASQIRNLASSLAA 133

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 60/105 (57%), Gaps = 8/105 (7%)

Query: 17  STTQVLLREATS-NDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGK-----NW 70
           S T+  ++EAT  N+  G +  LM+EI+  ++   +  EI+ +L KRL    K     N 
Sbjct: 13  SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGSSKKSSHRNC 72

Query: 71  RHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREF--THEDE 113
            H+ K++T++ YL+  GS   + WA+ N+ I + L++F   HED+
Sbjct: 73  VHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDD 117

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 65/112 (58%), Gaps = 8/112 (7%)

Query: 4   SLMRRAKNVVNGYSTTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           SL+R  ++   G S T++  + AT++D   G +  LM+EI+  ++ S +  EI  ++ KR
Sbjct: 2   SLLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKR 59

Query: 63  L---NDKG--KNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFT 109
           L   N K   KN  H+ K+LT+  YL+  GS   V W +  +Y+I +L+EFT
Sbjct: 60  LSGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFT 111

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 67/119 (56%), Gaps = 6/119 (5%)

Query: 17  STTQVLLREAT-SNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKG-----KNW 70
           STT++ +++AT  N+  G +  LM+EI+  ++   +  EI+ ++ KRL   G     K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRVKAREL 129
            H+ K+LT++ YL+  GS   + W + N+ ++  L+EF  +D      GQ +R  +++L
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIRAMSQDL 131

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 70/124 (56%), Gaps = 9/124 (7%)

Query: 15  GYSTTQVLLREATSN-DPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRL-----NDKGK 68
           G S+T V +++AT + + +G    LM+EIA  ++   +  EI  +L KRL         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 69  NWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED---ETGVDQGQIVRVK 125
              ++ K+LT++ +LV  GSE C+ W + +L +I++ ++FT  D   +  V+Q Q++  K
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQMVNQIQLLSCK 130

Query: 126 AREL 129
             +L
Sbjct: 131 LCQL 134

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 6/100 (6%)

Query: 13  VNGYSTTQVLLREATSNDPD-GPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKG---- 67
           V G S+T++ +R+AT+ D   G +  LM+EI+  ++   +  EI  +L +RL+  G    
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 68  -KNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLR 106
            KN  H+ K+LT++ YL+  GSE  V W + NL   + L+
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 55/98 (56%), Gaps = 6/98 (6%)

Query: 17  STTQVLLREATSND-PDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRL-----NDKGKNW 70
           S T+  +R+AT +D   G +  LM+EI+  ++   +  EI+ +L KRL      +  KN 
Sbjct: 13  SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGYSKKNSHKNC 72

Query: 71  RHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREF 108
            H+ K+LT++ YL+  GS   + W + N+ + + L+ F
Sbjct: 73  VHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNF 110

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 70/120 (58%), Gaps = 10/120 (8%)

Query: 15  GYSTTQVLLREAT-SNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWR-- 71
           G STTQ+ +++AT SN+  G +  LM+E++  ++   S  EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRVKA 126
                 V K+LT+++YL+  GSE  V W + +L  I+ L+++   ++   D+ ++ ++K+
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDK--DKSKVKQIKS 128

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (53%), Gaps = 9/121 (7%)

Query: 17  STTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWR---- 71
           S T+  +++ATS D   G +  LM+EI+  ++   +  EI+ ++ KRL   G+N R    
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLL-LGQNRRNSHR 71

Query: 72  ---HVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRVKARE 128
               V K+LT++ YL+  GS   + W K N+ +I+ L +F  +D      G+ +R  +R 
Sbjct: 72  SCIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRN 131

Query: 129 L 129
           L
Sbjct: 132 L 132

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 8/115 (6%)

Query: 4   SLMRRAKNVVNGYSTTQVLLREATS-NDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           ++    +N V   S T++ +R AT  N+  G +  LM+EI+  ++ + +  EI+ +L KR
Sbjct: 2   AIFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKR 59

Query: 63  LNDKGK-----NWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED 112
           L   GK     N  H+ K+LT++ YL+  GS   + W  EN  + + ++ F   D
Sbjct: 60  LTGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSD 114

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 70/130 (53%), Gaps = 15/130 (11%)

Query: 4   SLMRRAKNVVNGYSTTQVLLREATS-NDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           SLM   K  +   S T++ +R+AT  N+  G +  LM+EI+  ++   +  +++ ++ KR
Sbjct: 2   SLMHTFKGFL--LSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKR 59

Query: 63  LNDKGKNWR-------HVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREF---THED 112
           L+  G N R       HV K+LT++ YL+  GS   + W K + Y+I+ L  F   +  D
Sbjct: 60  LS--GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQSSSD 117

Query: 113 ETGVDQGQIV 122
           E  V+Q + +
Sbjct: 118 EPMVNQIRFL 127

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 56/105 (53%), Gaps = 6/105 (5%)

Query: 15  GYSTTQVLLREATS-NDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKG-----K 68
           G S T   +R+AT  N+  G S  L+ EI   ++   +  ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  NWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE 113
           N  H+ K+LT+ +YL+  GSE  V W +    +++ L++FT  +E
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNE 115

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 7/120 (5%)

Query: 17  STTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKRL------NDKGKN 69
           S T+  +++ATS D   G +  LM+EI+  ++   +  EI+ ++ KRL       +  +N
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQIVRVKAREL 129
              V K+LT++ YL+  GS   + W K N+ +I+ L  F  +D     + + +R  +R L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 17  STTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKRL------NDKGKN 69
           S T+  +++AT+ D   G +  LM+EI+  ++   +  EI+ ++ KRL       +  +N
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED 112
              V K+LT++ YL+  GS   + W K N+ +I+ L +F  +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 57/103 (55%), Gaps = 7/103 (6%)

Query: 17  STTQVLLREATSNDP-DGPSLDLMDEIAERSWDSVSFFEIMDMLDKRL------NDKGKN 69
           S T+  +++AT+ D   G +  LM+EI+  ++   +  EI+ ++ KRL       +  +N
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHED 112
              V K+LT++ YL+  GS   + W K N+ +++ L +F  +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 17  STTQVLLREATSNDPD-GPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRH--- 72
           S T+  +++AT+ D   G +  LM+EI+  ++   +  EI+ +L KRL+   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --VAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTL----REFTHEDETGVDQGQI 121
             + K+LT++ YL+  GS   V W + N  +I  L     E+  +D+ G +   I
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKSI 127

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 72/140 (51%), Gaps = 17/140 (12%)

Query: 5   LMRRAKNVVNGYSTTQVLLREATS-NDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRL 63
           L    KN V   + ++V  ++AT  N+  G +  LM+EI+  ++   +  +I+ ++ KRL
Sbjct: 3   LFDTVKNFVQTPTESKV--KQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRL 60

Query: 64  ND---KGKNWRH-----VAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLRE---FTHED 112
           +      K   H     + K+LT++ YL+  GS   + W + N Y+++ + +   F  +D
Sbjct: 61  SSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQD 120

Query: 113 ETGVDQ--GQIVRVKARELT 130
            +   +  GQI +V A ++T
Sbjct: 121 NSADSKMIGQI-KVIAEDMT 139

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R+AT+ D  GP+   +D+I     + V   +I+D + KRL D 
Sbjct: 21  RYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V KSL VL +L+
Sbjct: 80  INTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
          similar to uniprot|P53309 Saccharomyces cerevisiae
          YGR241C YAP1802 Yeast Assembly Polypeptide, member of
          AP180 protein family, binds Pan1p and clathrin; member
          of clathrin assembly polypeptide AP180 family and
          weakly similar to uniprot|P38856 Saccharomyces
          cerevisiae YHR161C YAP1801 Yeast Assembly Polypeptide
          member of AP180 protein family binds Pan1p and clathrin
          clathrin assembly protein
          Length = 669

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 22 LLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   + DS  F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82 YLVRCG 87
           ++R G
Sbjct: 65 LMMRDG 70

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    ++ VS F + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +L+YL+
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLL 116

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   ++++  R+   V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVM-RNRFQVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   M ++  R  + V  + I +   KRL D 
Sbjct: 21  RFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVM-RHKNHVPMYLITEYTMKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L VL++L+
Sbjct: 80  MAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 69/139 (49%), Gaps = 14/139 (10%)

Query: 4   SLMRRAKNVVNGYSTTQVLLREAT-SNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           S     +N+V  YS T++ +R+AT  N+    +  LM+EI+  ++ + +  EI+ +L K+
Sbjct: 2   SFFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKK 59

Query: 63  L-------NDKG----KNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHE 111
           L       N  G    K    V K+ T++ YL+  GS   + W K N  +++ L +    
Sbjct: 60  LSLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSN 119

Query: 112 DETGVDQGQIVRVKARELT 130
           +    D+   +  +A+++T
Sbjct: 120 NHITDDEDLHILNQAQKIT 138

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRCGSE 89
                              G  WR V K L V+D+L+   SE
Sbjct: 80  IASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSE 121

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 22 LLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   + +   F+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRCGSE 89
           ++R GS+
Sbjct: 65 LMIREGSK 72

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 47/116 (40%), Gaps = 33/116 (28%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + +++   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL-------------VRCGSEH 90
                              G  WR V K LTV++YL             VRC   H
Sbjct: 80  IAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTH 135

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 20/101 (19%)

Query: 3   KSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           ++  R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + + + + KR
Sbjct: 17  RNAARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKR 75

Query: 63  LNDK-------------------GKNWRHVAKSLTVLDYLV 84
           L D                    G  WR V K LTV+++L+
Sbjct: 76  LVDHIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + I + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V++YL+
Sbjct: 80  IAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   ++++    +  V  + I +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K LTV++YL+
Sbjct: 80  IATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 24/99 (24%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPS---------------LDLMDEIA-ERSWDSV 50
           R A+NV+  Y   QV +R AT+ D  GP+               L LM E   +R  D +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 51  S-----FFEIMDMLDKRLNDKGKNWRHVAKSLTVLDYLV 84
           +     F+E      K+  + G  WR V K L VL+YL+
Sbjct: 81  ASRPKNFYE---KARKQYVNYGSEWRVVLKCLVVLEYLL 116

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 22 LLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   +     F+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82 YLVRCGSE 89
           ++R G +
Sbjct: 65 LMMREGKK 72

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 66/140 (47%), Gaps = 17/140 (12%)

Query: 5   LMRRAKNVVNGYSTTQVLLREAT--SNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKR 62
           L    +N VN  STT++ +++AT  S      +  +M+EI+  ++   +  EI  +L KR
Sbjct: 3   LFDSVRNFVN--STTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKR 60

Query: 63  LNDKGKNWRHVA--------KSLTVLDYLVRCGSEHCVPWAKENLYIIKTLR-----EFT 109
            +      R V         K+LT++ +L+  GS   V W K N+   + L+     EF+
Sbjct: 61  FHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFS 120

Query: 110 HEDETGVDQGQIVRVKAREL 129
             D+  +   + +R  A ++
Sbjct: 121 FTDKADLPMYEQIRQSASDI 140

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 20/96 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL 83
                              G  WR V K L V+D+L
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFL 115

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 44/105 (41%), Gaps = 23/105 (21%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYL---VRCGSE 89
                              G  WR V K L VL+YL   V  GSE
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSE 124

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 47/104 (45%), Gaps = 21/104 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPS---------------LDLMDEIA-ERSWDSV 50
           R A+NV+  Y   QV +R AT+ D  GP+               L LM E   +R  D +
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQVPLHLMTEYTLKRLVDHI 80

Query: 51  SFF--EIMDMLDKRLNDKGKNWRHVAKSLTVLDYL---VRCGSE 89
           +     + +   K+  + G  WR V K L VL+YL   V  GSE
Sbjct: 81  ASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSE 124

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 22 LLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLD 81
          L++ AT      P    +D I   +     F+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRCGSE 89
           ++R G++
Sbjct: 65 LMIREGAK 72

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ +R AT+ D  GP+   + ++    + SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLVRCGSE 89
                              G  WR + K L V++YL+   SE
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSE 121

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   ++++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT+ D  GP+   + ++  R+   V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVM-RNRFQVPLYLMTEYILKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +L++++
Sbjct: 80  IATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHML 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L V+++L+
Sbjct: 80  IATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLL 116

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ +R A++ D  GP+   + ++    + SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 20/97 (20%)

Query: 7   RRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D  GP+   + ++    +  V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKY-HVPVYLMTEYILKRLIDH 79

Query: 67  -------------------GKNWRHVAKSLTVLDYLV 84
                              G  WR V K L ++++L+
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLL 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,262,936
Number of extensions: 1391688
Number of successful extensions: 4423
Number of sequences better than 10.0: 112
Number of HSP's gapped: 4420
Number of HSP's successfully gapped: 171
Length of query: 502
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 388
Effective length of database: 40,409,475
Effective search space: 15678876300
Effective search space used: 15678876300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)