Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01408g7.343ON72372334420.0
Kwal_56.246167.343ON71573528620.0
SAKL0F10912g7.343ON69360524780.0
ZYRO0F11572g7.343ON73167023310.0
CAGL0I03410g7.343ON72462023270.0
TDEL0C020407.343ON70560723260.0
NCAS0A141107.343ON75366523190.0
KNAG0C037407.343ON72766322860.0
Suva_4.827.343ON75561022850.0
NDAI0A019407.343ON76562622760.0
Kpol_2001.717.343ON72666022700.0
YDL164C (CDC9)7.343ON75563922700.0
Skud_4.937.343ON75561022570.0
Smik_4.747.343ON84561022650.0
KAFR0B008307.343ON71063122370.0
ACL155W7.343ON69764822200.0
KLLA0D12496g7.343ON70060522070.0
TBLA0E020507.343ON72062520100.0
TPHA0D045707.343ON73665820040.0
TPHA0M002606.18ON9662322762e-24
ZYRO0C07854g6.18ON9442362495e-21
Smik_15.1746.18ON9452352479e-21
TDEL0G045106.18ON9692352461e-20
Kwal_56.224146.18ON9632592432e-20
NCAS0D026506.18ON9502442433e-20
ACR008W6.18ON9814162423e-20
YOR005C (DNL4)6.18ON9444522414e-20
TBLA0G010406.18ON9722352397e-20
Kpol_1032.76.18ON9652092389e-20
KNAG0F028706.18ON9542672371e-19
CAGL0E02695g6.18ON9462382325e-19
Skud_15.1666.18ON9472352325e-19
NDAI0I022606.18ON9672392282e-18
KLTH0C11286g6.18ON9512762282e-18
KLLA0D01089g6.18ON9073792253e-18
Suva_15.1806.18ON9482782237e-18
KAFR0A050506.18ON9482362093e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01408g
         (723 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...  1330   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...  1107   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   959   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   902   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   900   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   900   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   897   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   885   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   884   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   881   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   879   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   879   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   874   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   877   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   866   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   859   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   854   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   778   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   776   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   110   2e-24
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   100   5e-21
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   100   9e-21
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    99   1e-20
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    98   2e-20
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    98   3e-20
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    98   3e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    97   4e-20
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...    97   7e-20
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    96   9e-20
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    96   1e-19
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    94   5e-19
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    94   5e-19
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    92   2e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    92   2e-18
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    91   3e-18
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    91   7e-18
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    85   3e-16

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score = 1330 bits (3442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/723 (91%), Positives = 658/723 (91%)

Query: 1   MLRLVRAEMSSIKKQATLAXXXXXXXXXXXXXXXXXPAKKLHXXXXXXXXXXXXXXXXXX 60
           MLRLVRAEMSSIKKQATLA                 PAKKLH                  
Sbjct: 1   MLRLVRAEMSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLA 60

Query: 61  XXXXDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKDSKI 120
               DAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKDSKI
Sbjct: 61  TGSSDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKDSKI 120

Query: 121 LYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPXXX 180
           LYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP   
Sbjct: 121 LYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLE 180

Query: 181 XXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFS 240
                   MKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFS
Sbjct: 181 LGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFS 240

Query: 241 NLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKA 300
           NLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKA
Sbjct: 241 NLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKA 300

Query: 301 LLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPL 360
           LLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPL
Sbjct: 301 LLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPL 360

Query: 361 KPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPE 420
           KPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPE
Sbjct: 361 KPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPE 420

Query: 421 IRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAF 480
           IRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAF
Sbjct: 421 IRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAF 480

Query: 481 DILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCE 540
           DILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCE
Sbjct: 481 DILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCE 540

Query: 541 GLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFL 600
           GLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL               FL
Sbjct: 541 GLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFL 600

Query: 601 LGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPT 660
           LGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPT
Sbjct: 601 LGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPT 660

Query: 661 LLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQS 720
           LLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQS
Sbjct: 661 LLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQS 720

Query: 721 HVS 723
           HVS
Sbjct: 721 HVS 723

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/735 (74%), Positives = 594/735 (80%), Gaps = 32/735 (4%)

Query: 1   MLRLVRAEMSSIKKQATLAXXXXXXXXXXXXXXXXXPAKKLHXXXXXXXXXXXXXXXXXX 60
           M+R VR  MSS KKQATLA                    K                    
Sbjct: 1   MIRTVRLSMSSAKKQATLA--------------------KFFSSKKRSNDEKEGPQESAK 40

Query: 61  XXXXDAGSVKVETSATS------TGENT------KAGTPTLPDSDEPAKRAVAATKGDPA 108
               +A   K E+S  S      T   T       A  P    +  PAK AV  + GD A
Sbjct: 41  KSQLNAIDAKPESSKGSQPNVDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVA 100

Query: 109 KLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLI 168
           K+G SAPKDS ++Y+EMC+VFNEIEGTSSRLQIVKLC DFLYSVL K RKD+VPITYLLI
Sbjct: 101 KIGISAPKDSNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLI 160

Query: 169 NKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMF 228
           NKLGPDYQP           MKTISESCGKSLQQ+KARYRELGDLGRIAQEAR+VQPTMF
Sbjct: 161 NKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMF 220

Query: 229 KPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGL 288
           KPKPLTTG VF+NLQ IAR+QGKDSQLRKVQLIK+MLTAC+G+EAKFLIRSLESKLRIGL
Sbjct: 221 KPKPLTTGMVFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGL 280

Query: 289 AEKSVLVALSKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMEL 348
           AEKSVLVALSKA+LT+EH GKEPSS+LVD AEQKIRDAFCQVPNY+IVI  ALEHGIMEL
Sbjct: 281 AEKSVLVALSKAILTHEHGGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMEL 340

Query: 349 DKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYS 408
           +KHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYS
Sbjct: 341 EKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYS 400

Query: 409 RNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAV 468
           RNGENMTERYPEI ISDF+A P  THTLILDCEAVAWDK+KN ILPFQVLSTRKRKGV  
Sbjct: 401 RNGENMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVA 460

Query: 469 EDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528
           EDVKVRVCLFAFDILCYNDEPLI + LAERR  LER L PVPGELQLASEVTTMSLDE+Q
Sbjct: 461 EDVKVRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQ 520

Query: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXX 588
            YLDQ+V+DCCEGLMVK+L+GEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL     
Sbjct: 521 LYLDQSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYG 580

Query: 589 XXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHS 648
                     FLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L+++LSPT IP PKAFYV+S
Sbjct: 581 RGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYS 640

Query: 649 ESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATS 708
           ESA PDVW EP++LFEVLTADLSLSPVYKAG SSYGKGISLRFPRFIR+RDDK+ E+ATS
Sbjct: 641 ESAQPDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATS 700

Query: 709 SEQVVEFYESQSHVS 723
           SEQV+EFYESQSH++
Sbjct: 701 SEQVIEFYESQSHIN 715

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/605 (73%), Positives = 522/605 (86%)

Query: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177
           SKI Y+++CN+F+EIE TSSRL IVK+C +F YSVL +   ++VPITYL IN+LGPDY+P
Sbjct: 87  SKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDYEP 146

Query: 178 XXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237
                      MKTI+ESCGKSLQQ++A+YRE+GDLG +AQEARAVQPTMFKPKPLT GE
Sbjct: 147 GLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTVGE 206

Query: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297
           VF+NL++IA+SQGKDSQ RK+QLIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 207 VFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 266

Query: 298 SKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPG 357
           SKALL+YEH+G+EPSSELV+ AEQ++RDAFCQVPNY+IVI T LEHGIME++KHCVL PG
Sbjct: 267 SKALLSYEHDGEEPSSELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNKHCVLKPG 326

Query: 358 IPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTER 417
           IPLKPMLAKPSKSI+EVLDRF G++FTCEYKYDGERAQVHLLPDGSM IYSRNGENMTER
Sbjct: 327 IPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRNGENMTER 386

Query: 418 YPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCL 477
           YPE+ I D++ADP  TH+LILDCEAVAWD E+  ILPFQ+LSTRKRKGV  +DVKVRVCL
Sbjct: 387 YPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCL 446

Query: 478 FAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRD 537
           FAFD+LCYN + LI   L ERR  L+R L PV G+ Q A+E+ + +L+++Q YL+Q+V+D
Sbjct: 447 FAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKD 506

Query: 538 CCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXX 597
            CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL              
Sbjct: 507 ACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYG 566

Query: 598 XFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWF 657
            FLLGCYNQD+GE+ETCCKIGTGFS+EML +L+++L P+++  PKAFYV+  SA PDVWF
Sbjct: 567 GFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWF 626

Query: 658 EPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYE 717
           EPT+LFEVLTADLSLSP+YKAG S+YGKGISLRFPRFIR+RDDK  E+ATSSEQ+VE YE
Sbjct: 627 EPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYE 686

Query: 718 SQSHV 722
           SQ ++
Sbjct: 687 SQVNL 691

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/670 (65%), Positives = 516/670 (77%), Gaps = 24/670 (3%)

Query: 74  SATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKD---------------- 117
           S   +  N K  +P   DS+    R+ A +        A APK                 
Sbjct: 66  SPVRSNSNEKESSPMFDDSN---GRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQD 122

Query: 118 ---SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPD 174
              S + YA++CN+F EIE TSSRL I+K+C DF   ++ +  +++VP TYL INKLGPD
Sbjct: 123 DHFSTVPYADVCNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPD 182

Query: 175 YQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLT 234
           Y+P           MKTISESCGKSL Q+K RYRE+GDLG+IA EAR VQPTMFKPKPLT
Sbjct: 183 YEPGMELGLGEGLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLT 242

Query: 235 TGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVL 294
            GEVF NL+ IA +QGKDSQ +K++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL
Sbjct: 243 VGEVFVNLRNIANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 302

Query: 295 VALSKALLTYEHN-GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCV 353
           ++LS ALL +E     EPS E VD AEQ IRDAFCQVPNY+IVI T LEHGI +L KHC 
Sbjct: 303 ISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQ 362

Query: 354 LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGEN 413
           LTPGIPLKPMLAKP+K+I+EVLDRFQGQ F  EYKYDGERAQ+HLLPDG+MRIYSRNGEN
Sbjct: 363 LTPGIPLKPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGEN 422

Query: 414 MTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKV 473
           MTERYPEI I DF++DP+ T +LILDCEAVAWDKE+  ILPFQVLSTRKRK V  +DVKV
Sbjct: 423 MTERYPEIDIRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKV 481

Query: 474 RVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQ 533
           RVCLFAFD+LC+N EPLI + L ER+  L++   PV GE + A+++ T +++ELQH+LDQ
Sbjct: 482 RVCLFAFDLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQ 541

Query: 534 AVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXX 593
           +V+D CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL          
Sbjct: 542 SVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRT 601

Query: 594 XXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPP 653
                FLLGCYNQD+GEYETCCKIGTGFSEE+LQ L+DRL PTA+  P AFYV+  +  P
Sbjct: 602 GTYGGFLLGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQP 661

Query: 654 DVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVV 713
           DVWFEPTLLFEVL ADLSLSPVYKAG++ Y KGISLRFPRF+R+RDDK+ EEATSSEQVV
Sbjct: 662 DVWFEPTLLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVV 721

Query: 714 EFYESQSHVS 723
           + YE+Q+H+S
Sbjct: 722 DLYEAQAHLS 731

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/620 (68%), Positives = 511/620 (82%), Gaps = 8/620 (1%)

Query: 112 ASAPK--DSKIL----YAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITY 165
           AS P+  DSK      Y+++CN+F EIEGTSSRL I+KLC DF   ++ +  ++++P+TY
Sbjct: 104 ASTPRQVDSKFFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTY 163

Query: 166 LLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQP 225
           L INKLGPDY+P           MKTISESCGKS+QQIK +YRE+GDLG+IA EAR VQP
Sbjct: 164 LFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQIALEARNVQP 223

Query: 226 TMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLR 285
           TMFKPKPL  GEVF NL+ IA+SQGKDSQ +K++LIKRMLTACQG EAKFLIRSLESKLR
Sbjct: 224 TMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLR 283

Query: 286 IGLAEKSVLVALSKALLTYE--HNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEH 343
           IGLAEK+VL+ALSKALL ++  ++ KEPS ++V+ AEQKIRDAFCQVPNY++VI   L++
Sbjct: 284 IGLAEKTVLIALSKALLIHDEKYSNKEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDY 343

Query: 344 GIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS 403
           GIM+LD+HC + PGIPLKPMLAKP+K+I+EVLDRFQGQ FT EYKYDGERAQVHLL DG+
Sbjct: 344 GIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGT 403

Query: 404 MRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKR 463
           MRIYSRNGENMTERYPEI+I DF+ADPA T +LILDCEAVAWDKE+N ILPFQVL+TRKR
Sbjct: 404 MRIYSRNGENMTERYPEIQIKDFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKR 463

Query: 464 KGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMS 523
           K V + +VKVRVCLFAFDIL +ND  LI  PL++RR  L     PV GE Q A+++TT +
Sbjct: 464 KDVNINEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSN 523

Query: 524 LDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
           LDELQ +LD++V++ CEGLMVK+++G ES+YEPSKRSRNWLKLKKDYL+GVGDSLDLCVL
Sbjct: 524 LDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 583

Query: 584 XXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKA 643
                          FLLGCYN DS ++ETCCKIGTGFSEEMLQTL+++LSPT I  PK 
Sbjct: 584 GAYFGRGKRTGTYGGFLLGCYNADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKG 643

Query: 644 FYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTP 703
            YV   SA PDVWFEPT+LFEVLTADLSLSP+YKAG+S Y KGISLRFPRF+R+RDDK+ 
Sbjct: 644 TYVFDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSV 703

Query: 704 EEATSSEQVVEFYESQSHVS 723
           E+ATSSEQ++E Y++QSHV+
Sbjct: 704 EDATSSEQIIEMYQNQSHVA 723

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/607 (71%), Positives = 494/607 (81%), Gaps = 1/607 (0%)

Query: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177
           SK+ Y+++CNVF EIEGTSSRL I+K+C +F   ++    ++++P TYL IN+LGPDY+P
Sbjct: 99  SKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEP 158

Query: 178 XXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237
                      MKTISE+CGKSL Q+K RYRE+GDLG+IA EAR VQPTMFKPKPLT GE
Sbjct: 159 GLELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGE 218

Query: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297
           VF NL+AIA SQGKDSQ RK++LIKRMLTAC+G+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 219 VFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISL 278

Query: 298 SKALLTYE-HNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTP 356
           SKALLT E   GKEPS ELV+ AE KIRDAFCQVPNY+IVI   L++GIMELDKHC L P
Sbjct: 279 SKALLTNEGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRP 338

Query: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTE 416
           GIPLKPMLAKP+KSI+EVLDRFQGQ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTE
Sbjct: 339 GIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE 398

Query: 417 RYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVC 476
           RYPEI I DF+AD   T TLILDCEAVAWDK +  ILPFQVLSTRKRK V  +DVKVRVC
Sbjct: 399 RYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVC 458

Query: 477 LFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVR 536
           LFAFDI+C+N E  I + L ERR  L +   PV GE Q A E+TT S++ELQ +LDQ+V+
Sbjct: 459 LFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVK 518

Query: 537 DCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXX 596
           D CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL             
Sbjct: 519 DSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTY 578

Query: 597 XXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVW 656
             FLLGCYNQDSGE+ETCCKIGTGFS+EMLQ L++R S T +  PKA YV   SA PDVW
Sbjct: 579 GGFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVW 638

Query: 657 FEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFY 716
           FEPT LFEVLTADLSLSPVYKAG S+Y KG+SLRFPRF+RLRDDK+ E+ATSS Q+VE Y
Sbjct: 639 FEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELY 698

Query: 717 ESQSHVS 723
           + QSHV+
Sbjct: 699 QDQSHVA 705

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/665 (65%), Positives = 526/665 (79%), Gaps = 16/665 (2%)

Query: 74  SATSTGENTKAGTPTLPD--SDEPA-----KRAVAATKGDPAK--------LGASAPKDS 118
           +++S G +  A TP++P+  +DE       K+ +  +  +P+K          ++ P  S
Sbjct: 88  ASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDSTKPYFS 147

Query: 119 KILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPX 178
            I Y E+CN+F EIE TSSRL I+KLC DF   ++ +  ++++P+TYL INKLGPDY+P 
Sbjct: 148 SIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDYEPG 207

Query: 179 XXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEV 238
                     MKTISESCGKSL Q++ +YRELGDLG+IA +AR VQPTMFKPKPLT GEV
Sbjct: 208 LELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTVGEV 267

Query: 239 FSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALS 298
           F NL+ IA+S+GKDSQ RK++LIKRMLTAC+G EAKFLIRSLESKLRIGLAEK+VL++LS
Sbjct: 268 FENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLISLS 327

Query: 299 KALLTYE-HNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPG 357
           KALL +E  + K+   EL++TAEQKIRDAFCQVPNY+IVI + L++GIMEL+ HC L PG
Sbjct: 328 KALLVHECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELETHCSLRPG 387

Query: 358 IPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTER 417
           IPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGENMTER
Sbjct: 388 IPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRNGENMTER 447

Query: 418 YPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCL 477
           YPEI I DFIADP  T TLILDCEAVAWD E+N ILPFQVLSTRKRK V ++DVKV+VCL
Sbjct: 448 YPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKDVKVKVCL 507

Query: 478 FAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRD 537
           FAFDILC+NDE LI + L ERR  L+     V GE Q A+E+T+ +LDELQ +LDQ+V D
Sbjct: 508 FAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHD 567

Query: 538 CCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXX 597
            CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+G+GDSLDLCV+              
Sbjct: 568 SCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYG 627

Query: 598 XFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWF 657
            FLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L+ RL+PT +  PKA +V+  SA PDVWF
Sbjct: 628 GFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWF 687

Query: 658 EPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYE 717
           EPTLLFEVLTADLSLSP+YKAG+S+Y KGISLRFPRFIR R+DK  E+ATSSEQ++E YE
Sbjct: 688 EPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSEQIIELYE 747

Query: 718 SQSHV 722
           +Q+H 
Sbjct: 748 NQAHT 752

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/663 (65%), Positives = 514/663 (77%), Gaps = 14/663 (2%)

Query: 74  SATSTGENTKAGT-PTLPDSDEPAKRAVAATKGDPAKLGASAPK------DSK-----IL 121
           +A    EN    T P +  S+  AKR    T   P  + +   K      D+K     + 
Sbjct: 63  TAEEKHENMDVDTDPVISSSEVSAKRNSPLTSPSPTPVVSKKIKIQDENNDTKEFYSTVP 122

Query: 122 YAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPXXXX 181
           YA++CN+F EIEG SSRL I+KLC  FL SV+    ++++P+TYL INKLGPDY P    
Sbjct: 123 YADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLEL 182

Query: 182 XXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSN 241
                  +KTI+ESCG+SLQQIK +Y E+GDLG+IA EAR VQPTMFKPKPLT GEVF N
Sbjct: 183 GLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQN 242

Query: 242 LQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKAL 301
           L++IA SQGKDSQ +K++LIKRMLT+CQG+EAKFLIRSLESKLRIGLAEK+VL++LSKAL
Sbjct: 243 LKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKAL 302

Query: 302 LTYEH--NGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIP 359
           L YE+  + K+   E V+ AEQKIRDAFCQVPNY++VI++ L+HGIM LD+HC L P IP
Sbjct: 303 LVYEYGESDKDIDMETVENAEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIP 362

Query: 360 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYP 419
           LKPMLAKP+KSISE+ DRFQ Q+FTCEYKYDGERAQVHLL DG+MRIYSRNGENMTERYP
Sbjct: 363 LKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYP 422

Query: 420 EIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFA 479
           EI I DF+ D + T +LILDCEAVAWDKE+N ILPFQVLSTRKRK V + ++KVRVCLFA
Sbjct: 423 EIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFA 482

Query: 480 FDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCC 539
           FDIL +NDE LI + L ERR  L      V GE Q A+E+TT +L+ELQ +LDQ+V++ C
Sbjct: 483 FDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSC 542

Query: 540 EGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXF 599
           EGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               F
Sbjct: 543 EGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGF 602

Query: 600 LLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEP 659
           LLGCYNQD+GE+ET CKIGTGFS+E+LQ L +RL  T I  PKA YV   SA PDVWFEP
Sbjct: 603 LLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEP 662

Query: 660 TLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQ 719
           TLLFEVLTADLSLSPVYKAG+S+Y KG+SLRFPRF+RLR+DK  E+ATSSEQ+VE YE+Q
Sbjct: 663 TLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQ 722

Query: 720 SHV 722
           +++
Sbjct: 723 ANL 725

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/610 (68%), Positives = 495/610 (81%), Gaps = 5/610 (0%)

Query: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177
           S I Y+E+C VFNEIE  SSRL+I+++C DF   ++ ++ K+++P TYL IN+LGPDY+P
Sbjct: 144 SNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEP 203

Query: 178 XXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237
                      MKTISESCGKS+ QIK +Y+E+GDLG IA  AR VQPTMFKPKPLT GE
Sbjct: 204 GLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGE 263

Query: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297
           VF NL++IA++QGKDSQLRK++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 264 VFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 323

Query: 298 SKALLTYEHNGKEPS-----SELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHC 352
           SKALL +  NG+         +++++A+QKIRDAFCQVPNY+IVI + LEHGIM LDK C
Sbjct: 324 SKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKFC 383

Query: 353 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 412
            L PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 384 TLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSRNGE 443

Query: 413 NMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK 472
           NMTERYPEI+I+DFI D   T  LILDCEAVAWDKE+  ILPFQVLSTRKRK V + DVK
Sbjct: 444 NMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKDVELSDVK 503

Query: 473 VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLD 532
           VRVCLFAFD+LC+N E LI + L ERR CL +    VPGE Q A+++ T +LDELQ +LD
Sbjct: 504 VRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLDELQKFLD 563

Query: 533 QAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXX 592
           ++V   CEGLMVK+LEG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL         
Sbjct: 564 ESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKR 623

Query: 593 XXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAP 652
                 FLLGCYNQD+GE+ETCCKIGTGFS+E LQ L +RL+PT I  PKA +V   SA 
Sbjct: 624 TGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATFVFDSSAE 683

Query: 653 PDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQV 712
           PDVWFEPT LFEVLTADLSLSP+YKAG++++ KG+SLRFPRF+R+R+DK  E+ATSSEQ+
Sbjct: 684 PDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVEDATSSEQI 743

Query: 713 VEFYESQSHV 722
           VE YE+QSHV
Sbjct: 744 VELYENQSHV 753

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/626 (68%), Positives = 500/626 (79%), Gaps = 3/626 (0%)

Query: 100 VAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKD 159
           VA    DP K   S P    I Y E+C +F EIE TSSRL I+KLC DFL  ++ +  ++
Sbjct: 140 VADHTLDP-KTAVSKPFLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQN 198

Query: 160 IVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQE 219
           ++P+TYL INKLGPDY+P           MKTISESCGKSL QI+A+YRELGDLG+IA E
Sbjct: 199 LIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALE 258

Query: 220 ARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQ-GLEAKFLIR 278
           AR VQPTMFKPKPLT GEVF+NL+ IA++ GKDSQ +K++LIKRMLTAC+ G+EAKFLIR
Sbjct: 259 ARNVQPTMFKPKPLTVGEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIR 318

Query: 279 SLESKLRIGLAEKSVLVALSKALLTYEHNG-KEPSSELVDTAEQKIRDAFCQVPNYQIVI 337
           SLESKLRIGLAEK+VL++LSKALL  E +  K+   EL++TAE KIRDAFCQVPNY+IVI
Sbjct: 319 SLESKLRIGLAEKTVLISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVI 378

Query: 338 ETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVH 397
            + L++GIM L++HC L PGIPLKPMLAKP+K+I+E+LDRFQG+ FT EYKYDGERAQVH
Sbjct: 379 NSCLQYGIMNLNEHCSLRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVH 438

Query: 398 LLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQV 457
           LL DG+MRIYSRNGENMTERYPEI I DF+ D   T TLILDCEAVAWDKE+  ILPFQV
Sbjct: 439 LLEDGTMRIYSRNGENMTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQV 498

Query: 458 LSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLAS 517
           LSTRKRK V  +DVKVRVCLFAFDILC+N   LI   L ERR  L R   P PGE Q A+
Sbjct: 499 LSTRKRKDVLAKDVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYAT 558

Query: 518 EVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDS 577
           E+TT +LDELQ +LDQ+V D CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL+G+GDS
Sbjct: 559 ELTTSNLDELQKFLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDS 618

Query: 578 LDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTA 637
           LDLCVL               FLLGCYN ++GE+ETCCKIGTGFS+EMLQ L ++L  T 
Sbjct: 619 LDLCVLGAYYGRGKRTGTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATV 678

Query: 638 IPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRL 697
           I  PKA Y++  SA PDVWFEP+LLFEVLTADLSLSP+YKAG+S+Y KG+SLRFPRFIR+
Sbjct: 679 IDGPKATYIYDSSAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRI 738

Query: 698 RDDKTPEEATSSEQVVEFYESQSHVS 723
           R+DK  E+ATSSEQ++E YE+QSH S
Sbjct: 739 REDKGVEDATSSEQIIELYENQSHRS 764

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/660 (65%), Positives = 509/660 (77%), Gaps = 17/660 (2%)

Query: 72  ETSATSTGENTKAGTPTLPDSDEPAKRAVAATK----GDPAKLGASAPKDSKILYAEMCN 127
           ET  TS G  T    P+L  S  P K  V   K      P K  ++ P      YA++C 
Sbjct: 73  ETPTTSAGSVTSKDEPSLTSS--PQKPIVTPAKVPSNTKPVKFFSTVP------YADLCE 124

Query: 128 VFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPXXXXXXXXXX 187
           VF E+E TSSRL I+K+C DFL  V+ +  +++VPITYL INKLGPDY+P          
Sbjct: 125 VFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGLGEGL 184

Query: 188 XMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIAR 247
            MKTISESCGKS+QQ+K +YRE+GDLG+IAQ+AR VQPTMFKPKPLT GEVF NL+ IA+
Sbjct: 185 LMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQ 244

Query: 248 SQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEH- 306
           SQGKDSQ RK++LIKRMLTAC+G+EAKFLIRSLESKLRIGLAEK+VL++LSKALL  E+ 
Sbjct: 245 SQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYE 304

Query: 307 NGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAK 366
             K+PS EL++TAE+KIRDAFCQVPNY+I+I++ L  GIMELD +C L PGIPLKPMLAK
Sbjct: 305 TSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAK 364

Query: 367 PSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDF 426
           P+K+I+EVLD FQG+ FTCEYKYDGER QVHLL +G MRIYSRNGENMTERYPE+ I DF
Sbjct: 365 PTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDF 424

Query: 427 -IADPARTH---TLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDI 482
            + D + T    +LILDCE VAWD E+N ILPFQVLSTRKRKGV ++DVKVRVCLFAFDI
Sbjct: 425 LVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDI 484

Query: 483 LCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGL 542
           L YN E LIT+ L ERR  L      VPGE Q A+ + T  LDE+Q +LDQA++D CEGL
Sbjct: 485 LYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGL 544

Query: 543 MVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 602
           MVKIL+GEES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLG
Sbjct: 545 MVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGGFLLG 604

Query: 603 CYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLL 662
           CYNQDSGEYETCCKIGTGFS+EML  L++      I  PK+FY    SA PD+WFEP +L
Sbjct: 605 CYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVL 664

Query: 663 FEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722
           FEVLTADLSLSP+YKAG+++Y KGISLRFPRF+R+RDDK+ E+ATSS+Q++E YE+QSH+
Sbjct: 665 FEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/639 (65%), Positives = 508/639 (79%), Gaps = 6/639 (0%)

Query: 89  LPDSDEPAKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDF 148
           + DS + ++R V   + D      +    S I Y+E+C VFN+IE  SSRL+I+++C DF
Sbjct: 116 VADSPQQSQRLVGEVE-DALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDF 174

Query: 149 LYSVLLKARKDIVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYR 208
              ++ ++ K+++P TYL IN+LGPDY+            MKTISE+CGKS+ QIK +Y+
Sbjct: 175 FIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYK 234

Query: 209 ELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTAC 268
           ++GDLG IA  AR VQPTMFKPKPLT GEVF NL+AIA++QGKDSQL+K++LIKRMLTAC
Sbjct: 235 DIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTAC 294

Query: 269 QGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHN-----GKEPSSELVDTAEQKI 323
           +G+EAKFLIRSLESKLRIGLAEK+VL++LSKALL ++ N      K+   +++++A+QKI
Sbjct: 295 KGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKI 354

Query: 324 RDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRF 383
           RDAFCQVPNY+IVI + LEHGIM LDK+C L PGIPLKPMLAKP+K+I+EVLDRFQG+ F
Sbjct: 355 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 414

Query: 384 TCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAV 443
           T EYKYDGERAQVHLL DG+MRIYSRNGENMTERYPEI I+DFI D   T  LILDCEAV
Sbjct: 415 TSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAV 474

Query: 444 AWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLE 503
           AWDK++  ILPFQVLSTRKRK V + DVKV+VCLFAFDILCYNDE LI + L ERR  L 
Sbjct: 475 AWDKDQGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLT 534

Query: 504 RALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNW 563
           +    VPGE Q A+++TT +LDELQ +LD++V   CEGLMVK+LEG ESHYEPSKRSRNW
Sbjct: 535 KVTKVVPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNW 594

Query: 564 LKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSE 623
           LKLKKDYL+GVGDSLDLCVL               FLLGCYNQD+GE+ETCCKIGTGFS+
Sbjct: 595 LKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSD 654

Query: 624 EMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSY 683
           EMLQ L DRL+PT I  PKA +V   SA PDVWFEPT LFEVLTADLSLSP+YKAG++++
Sbjct: 655 EMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATF 714

Query: 684 GKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722
            KG+SLRFPRF+R+R+DK  E+ATSS+Q+VE YE+QSH+
Sbjct: 715 DKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHM 753

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/610 (67%), Positives = 495/610 (81%), Gaps = 5/610 (0%)

Query: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177
           S I Y+E+C VFN+IE  SSRL+I+++C DF   ++ ++ K+++P TYL IN+LGPDY+ 
Sbjct: 144 SNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDYEA 203

Query: 178 XXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237
                      MKTISESCGKS+ QIK +Y+E+GDLG IA  AR VQPTMFKPK LT GE
Sbjct: 204 GLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTVGE 263

Query: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297
           VF NL+ IA++QGKDSQLRK++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 264 VFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 323

Query: 298 SKALLTYEHN-----GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHC 352
           SKALL ++ N      KE   +++++A+Q+IRDAFCQVPNY+IVI + L HGIM LDK+C
Sbjct: 324 SKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDKYC 383

Query: 353 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 412
            L PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 384 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGE 443

Query: 413 NMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK 472
           NMTERYPEI+I+DFI D   T  LILDCEAVAWDKE+  ILPFQ+LSTRKRK V + DVK
Sbjct: 444 NMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKEQKKILPFQILSTRKRKDVELHDVK 503

Query: 473 VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLD 532
           V+VCLFAFDILCYNDE LI + L ERR  L +    VPGE Q A+++ T +LDELQ +LD
Sbjct: 504 VKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDELQKFLD 563

Query: 533 QAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXX 592
           ++V + CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL         
Sbjct: 564 ESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKR 623

Query: 593 XXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAP 652
                 FLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L +RL+PT I  PKA +V   SA 
Sbjct: 624 TGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFVFDASAE 683

Query: 653 PDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQV 712
           PDVWFEPT LFEVLTADLSLSP+YKAG++++ KG+SLRFPRF+R+R+DK  E+ATSS+Q+
Sbjct: 684 PDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQI 743

Query: 713 VEFYESQSHV 722
           +E YE+QSHV
Sbjct: 744 IELYENQSHV 753

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/610 (67%), Positives = 494/610 (80%), Gaps = 5/610 (0%)

Query: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177
           S I Y+++C VFN+IE  SSRL+I+++C DF   V+ ++ K+++P TYL IN+LGPDY+ 
Sbjct: 234 SNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEA 293

Query: 178 XXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237
                      MKTISESCGKS+ QIK +Y+E+GDLG IA  AR VQPTMFKPKPLT GE
Sbjct: 294 GLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGE 353

Query: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297
           VF NL+ IA++QGKDSQLRK++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 354 VFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 413

Query: 298 SKALLTYEHN-----GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHC 352
           SKALL ++ N      K+   +++++A+QKIRDAFCQVPNY+IVI + LEHGIM LDK+C
Sbjct: 414 SKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYC 473

Query: 353 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 412
            L PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGE 533

Query: 413 NMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK 472
           NMTERYPEI+I+DFI D   T  LILDCEAVAWDK++  ILPFQVLSTRKRK V + DVK
Sbjct: 534 NMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVK 593

Query: 473 VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLD 532
           VRVCLFAFDILC+NDE LI   L ERR  L +    VPGE Q A+++ T +LDELQ +LD
Sbjct: 594 VRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLD 653

Query: 533 QAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXX 592
           ++V   CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL         
Sbjct: 654 ESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKR 713

Query: 593 XXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAP 652
                 FLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L  RL+PT I  PKA YV   SA 
Sbjct: 714 TGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAE 773

Query: 653 PDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQV 712
           PDVWFEPT LFEVLTADLSLSP+YKAG++++ KG+SLRFPRF+R+R+DK  E+ATSS+Q+
Sbjct: 774 PDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQI 833

Query: 713 VEFYESQSHV 722
           VE YE+QSHV
Sbjct: 834 VELYENQSHV 843

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/631 (65%), Positives = 496/631 (78%), Gaps = 1/631 (0%)

Query: 94  EPAKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVL 153
           +P    + ++K D ++          I YA++C +F EIE  SSRLQI+KLC +F    +
Sbjct: 79  KPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAM 138

Query: 154 LKARKDIVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDL 213
            +   +++P+TYL INKLGPDY+            MKTISESCGKSLQQ+K  Y+++GDL
Sbjct: 139 KQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDL 198

Query: 214 GRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEA 273
           G IA  AR VQPTMFKPKPLT G VF NL+ IA+S GKDSQL+K++LIK++LTAC+G+EA
Sbjct: 199 GTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEA 258

Query: 274 KFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNGK-EPSSELVDTAEQKIRDAFCQVPN 332
           K+LIRSLESKLRIGLAEKSVL++LSKALL  E+N   +P  EL++ AEQKIRDAFCQ+PN
Sbjct: 259 KYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIPN 318

Query: 333 YQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGE 392
           Y+IVI + L++GIM LD+HC L PGIPLKPMLAKP+K+I EV DRFQ   FT EYKYDGE
Sbjct: 319 YEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDGE 378

Query: 393 RAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTI 452
           RAQVHL+ DGSMRIYSRNGENMTERYPEI ++DFI D   T +LI+DCEAVAWD+E+  I
Sbjct: 379 RAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREEKKI 438

Query: 453 LPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGE 512
           LPFQVLSTRKRK V ++D+KVR+CLFAFDILC+NDE LI + L ERR  L      V GE
Sbjct: 439 LPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREVHGE 498

Query: 513 LQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQ 572
              A E++T +LDELQ +LDQ+V+D CEGLMVK+L+GE+SHYEPSKRSRNWLKLKKDYL 
Sbjct: 499 FTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKDYLD 558

Query: 573 GVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDR 632
           GVGDSLDLCVL               FLLGCYNQD+GE+ET CKIGTGFS+E+LQ+L+DR
Sbjct: 559 GVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSLYDR 618

Query: 633 LSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFP 692
           L  T I  PKA Y++  SA PDVWFEPTLLFEVLTADLS+SP+YKAG S+Y KGISLRFP
Sbjct: 619 LKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISLRFP 678

Query: 693 RFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723
           RFIRLR+DK+ EEATSSEQ++E YE+QSHV+
Sbjct: 679 RFIRLREDKSVEEATSSEQIIELYENQSHVA 709

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/648 (64%), Positives = 500/648 (77%), Gaps = 10/648 (1%)

Query: 82  TKAGTPTLPDSDEP------AKRAVAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGT 135
            K   P L D   P      A  AV   +  P K  AS    + ++YA++C VF  +E T
Sbjct: 53  VKNSLPELADKPAPGGVLPQAASAVPRAQSSPVKPAAS----TSVMYADLCAVFEAVEAT 108

Query: 136 SSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISES 195
           SSRL I KLC DF+YSVL      ++P+TYL IN+LGPDY+P           +KTIS++
Sbjct: 109 SSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDA 168

Query: 196 CGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQL 255
           CGKS  Q+++ YRE GDLG +AQ+AR VQPTMFKPKPLT  +VFS LQAIA+++GKDSQ 
Sbjct: 169 CGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQG 228

Query: 256 RKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNGKEPSSEL 315
           +K++LIK+MLTACQG+EAK+LIRSLESKLRIGLAEK+VLVALSKA+LT+EH+GKEPS E 
Sbjct: 229 KKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHDGKEPSPEQ 288

Query: 316 VDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVL 375
           VD AE  +RD FCQVPNY+++I  AL++GIM L +HCVLTPGIPLKPMLAKP+KSI+EVL
Sbjct: 289 VDAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVL 348

Query: 376 DRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHT 435
           DRFQGQRFTCEYKYDGERAQVHL+ DG++RIYSRN ENMTERYPEI+   F+A+P  T +
Sbjct: 349 DRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFLANPQTTRS 408

Query: 436 LILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPL 495
           LI+DCEAVAWD EK  ILPFQVLSTRKRKGV ++DVKVRVCLFAFD+L  N E L+   L
Sbjct: 409 LIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSL 468

Query: 496 AERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYE 555
           A+RR  L   L  VPGELQ A+E+TTM L ELQ YL+Q+V   CEGLMVK+L+GEES YE
Sbjct: 469 ADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYE 528

Query: 556 PSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCC 615
           PSKRSRNWLKLKKDYL+GVGDSLDL VL               FLLGCYN D  E+ETCC
Sbjct: 529 PSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCC 588

Query: 616 KIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPV 675
           KIGTGFSEE+LQ+L  +L  T I  P+    + +S+PPDVWFEP +LFEVLTADLSLSPV
Sbjct: 589 KIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPV 648

Query: 676 YKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723
           YKAG   YGKGISLRFPRF+R+R+DK+  +ATSS+Q+VEFY+ Q++ S
Sbjct: 649 YKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQANSS 696

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/605 (66%), Positives = 483/605 (79%)

Query: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177
           S I +AE+C+ F  IE TSSRL I  +C  FLYSVL +  + +VPITYL I+KLGPDY+P
Sbjct: 95  SNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDYEP 154

Query: 178 XXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237
                      +KTISE+CGKS+QQI+ +YRE+GDLG IA +AR VQPTMFKPKPLT GE
Sbjct: 155 GLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGE 214

Query: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297
           VF+NL +IA+S GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEK+VL+++
Sbjct: 215 VFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISV 274

Query: 298 SKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPG 357
           SKA+LT+EHNG+EPS+E+V+ AE  IRDAFCQVPNY+++I  AL++GIM L++H  L PG
Sbjct: 275 SKAILTHEHNGQEPSTEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPG 334

Query: 358 IPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTER 417
           IPL+PMLAKP+KSISEVLDRFQG +FTCEYKYDGERAQVHL  DGSM+IYSRNGE+MTER
Sbjct: 335 IPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTER 394

Query: 418 YPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCL 477
           YPEI +  ++ D   T + I+D EAVAWD+E+  ILPFQVLSTRKRKGV ++DVKVRVCL
Sbjct: 395 YPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCL 454

Query: 478 FAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRD 537
           +AFDILC NDEPLI +   ERR  L        G+   A+E+TT + DELQ YLDQ+V+D
Sbjct: 455 YAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKD 514

Query: 538 CCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXX 597
            CEGLMVK+LEGEESHYEPSKRSRNWLKLKKDYL+GVGDSLDL VL              
Sbjct: 515 SCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYG 574

Query: 598 XFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWF 657
            FLLGCYN DS E+ETCCKIGTGFS+EMLQ L+ +L  T +  P    ++  SAP DVWF
Sbjct: 575 GFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWF 634

Query: 658 EPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYE 717
           EP++LFEVLTADLSLSPVYKAG  ++GKGISLRFPRF+R+RDDK   +ATSS+QV+EFYE
Sbjct: 635 EPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYE 694

Query: 718 SQSHV 722
           SQ+H+
Sbjct: 695 SQAHM 699

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/625 (60%), Positives = 463/625 (74%), Gaps = 3/625 (0%)

Query: 100 VAATKGDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKD 159
           V  +   P     S P  S + YA++C +F  IE  SSRL I  LC  F    L      
Sbjct: 95  VTTSTQTPRPTKKSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSL 154

Query: 160 IVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRELGDLGRIAQE 219
           +VP+TYL INKLGPDY             +K I  +CG S QQ+K +YR+LGDLG++A  
Sbjct: 155 LVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKLGDLGQLAMS 213

Query: 220 ARAVQPT--MFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLI 277
            R +QPT  MFK +PLT  +VF  L  IA SQGKDSQ +K+ +IKR+LT+CQG+EAKFLI
Sbjct: 214 TRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLI 273

Query: 278 RSLESKLRIGLAEKSVLVALSKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVI 337
           RSLESKLRIGLAEK+VL +L++AL+ +E        +    AEQ I+D+FCQ+PNY+I+I
Sbjct: 274 RSLESKLRIGLAEKTVLTSLARALVIHEKGNDNIQDDDYSNAEQIIKDSFCQIPNYEIII 333

Query: 338 ETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVH 397
            T+L++G+ +L  H  LTPGIPLKPMLAKP+KSISEVLD FQ  +FT EYKYDGERAQVH
Sbjct: 334 TTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVH 393

Query: 398 LLPDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQV 457
           LLPDGSMRIYSRNGE+MT+RYPE+ I D++ D   T  LILDCEAVAWD E   ILPFQV
Sbjct: 394 LLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQV 453

Query: 458 LSTRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLAS 517
           LSTRKRK V ++D+KVRVCLFAFDIL +N++ LI   L ERR  L     P PG+ Q A+
Sbjct: 454 LSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFAT 513

Query: 518 EVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDS 577
           E+TT +LDELQ +LD+A++D CEGLMVK L+G +SHYEPSKRSRNWLKLKKDYLQG+GDS
Sbjct: 514 ELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDS 573

Query: 578 LDLCVLXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTA 637
           LDLCVL               FLL CYNQD+ E+ETCCKIGTGFS+EMLQTL++ L  TA
Sbjct: 574 LDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETA 633

Query: 638 IPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRL 697
           I +P+A +V   SA PDVWF PT++FEVLTADLSLSP+YKAG++ YGKGISLRFPRFIR+
Sbjct: 634 IESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRI 693

Query: 698 RDDKTPEEATSSEQVVEFYESQSHV 722
           R DK+  +ATSSEQV++FYE+QSH+
Sbjct: 694 RTDKSVNDATSSEQVIDFYENQSHL 718

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/658 (58%), Positives = 476/658 (72%), Gaps = 30/658 (4%)

Query: 93  DEPAKRAVAATKGDPAKLGASAPKD---SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFL 149
           D+  K  V  ++   A   A +P D   S +LY+E+CN+F +IE TSSRL I+KLC +F 
Sbjct: 79  DKKRKVEVHPSQSVGASEKAESPPDQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFF 138

Query: 150 YSVLLKARKDIVPITYLLINKLGPDYQPXXXXXXXXXXXMKTISESCGKSLQQIKARYRE 209
             V+     DI+ + YL IN+LGPDY+P           +KTISE+ GKS++QIK   +E
Sbjct: 139 IRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKE 198

Query: 210 LGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQ 269
            GDLG IA++AR +QPTMFKPKPLT  +VF+NL+ IA + GKDSQLRK++LIK+ML+A +
Sbjct: 199 TGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASK 258

Query: 270 GLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEHNGKEPSS----------ELVDTA 319
           GLEAKFLIRSLESKLRIGLAEK+VL++LSKALL +EH  ++  S          +L++ A
Sbjct: 259 GLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQA 318

Query: 320 EQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQ 379
           E K+R+A CQVPNY+IVI   L+ GI+ +DK C L PGIPLKPMLAKP+K+I+EVL+ FQ
Sbjct: 319 EAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQ 378

Query: 380 GQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDFIA----------- 428
           G+ F  EYKYDGERAQVHLL  G MRIYSRNGENMTERYPE+ + DF+            
Sbjct: 379 GKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEG 438

Query: 429 ----DPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDILC 484
                P +   +ILDCE VAWD E+  ILPFQVL+TRKRK V ++DVKVRVCLFAFD+L 
Sbjct: 439 ENAIQPVKD--IILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLY 496

Query: 485 YNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMV 544
            N+E +I + L ER+  L +  V VPGE Q A+ + T  +DELQ +LDQAV++ CEGLMV
Sbjct: 497 LNNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMV 556

Query: 545 KILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY 604
           K+L+GEESHYEPSKRSRNWLKLKKDYL GVGDSLDL V+               FLLGCY
Sbjct: 557 KMLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCY 616

Query: 605 NQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLFE 664
           N+D+ E+ETCCKIGTGFS+EML  L   L PT I  P   Y++  SA PDVWF+  +LFE
Sbjct: 617 NEDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFE 676

Query: 665 VLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722
           VLTADLSLSPVYKAG S Y KGISLRFPRF+R+R+DK   + T+SE ++EFYESQSH+
Sbjct: 677 VLTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHI 734

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 116/232 (50%), Gaps = 11/232 (4%)

Query: 360 LKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERY 418
            +P LAK      EVL R    +FT E K DGER Q+H +  G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 419 PEIR----ISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVR 474
            + +    IS ++         ILD E V++DK +N ILPF ++ +     + ++ ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 475 VC---LFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYL 531
           +C      FD+L  N  PL   PL +R+  L   L P    +++         + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 532 DQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
             A+    EG+   +L+  +S Y    R+ +W+K+K +YL+  G++LDL V+
Sbjct: 444 QAAISVGSEGI---VLKKYDSLYSVGDRNNDWIKVKPEYLEQFGENLDLIVI 492

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 117/236 (49%), Gaps = 13/236 (5%)

Query: 357 GIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENM 414
           G+P  P LAK    S  +V  R +   F  E K DGER Q+H +  G  ++ +SR G + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSD-FYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 415 TERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVED 470
           T  Y E      ++ ++    +    +LD E +++D E+N++LPF ++ +  R  +  E 
Sbjct: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371

Query: 471 V---KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDEL 527
           +     R      D L  N   LI  PL  R+  L   L P P  +++   +       +
Sbjct: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431

Query: 528 QHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
           +  L++A+    EG+++K  +   S YE   R+ NW+K+K +YL+  G++LDL V+
Sbjct: 432 KSSLEKAIMMGSEGIILKHFK---SKYEIGARTDNWIKIKPEYLEQFGENLDLLVI 484

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 110/235 (46%), Gaps = 11/235 (4%)

Query: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415
           G    P LAK      E + R     F  E K DGER QVH +  G S+R YSR G + T
Sbjct: 251 GFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRGIDYT 310

Query: 416 ERY----PEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVA---V 468
             Y        IS  +         +LD E V +D  +  ILPF ++    +  ++   +
Sbjct: 311 YLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALSFNSI 370

Query: 469 EDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528
            +V        FD+L  N   L   PL +R+  LE  L PV   +++       +++ ++
Sbjct: 371 NNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNVESIK 430

Query: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
             L+ A+    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++
Sbjct: 431 KSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLVII 482

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 117/235 (49%), Gaps = 11/235 (4%)

Query: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMT 415
           G    P LAK      E +       F  E K DGER QVH +  G+ +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 416 ERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471
           + Y E      +++++   +     +LD E + +D ++N +LPF ++ +  R+ ++ E +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 472 ---KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528
                R  L   D++  N   LI  PL +R+  L R L P P  +++   V       ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
             L++++    EG+   +L+  ++ YE   R+  W+K+K +YL+  G++LDL ++
Sbjct: 448 KSLEKSISMGSEGI---VLKSYKARYEIGARNDYWIKVKPEYLEQFGENLDLVII 499

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 126/259 (48%), Gaps = 14/259 (5%)

Query: 336 VIETALEHGIMELDKHCV-LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERA 394
           V+   L +  M L K+ + +  G    P LAK      E +     Q F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 395 QVHLLPDGS-MRIYSRNGENMTERYPEIR----ISDFIADPARTHTLILDCEAVAWDKEK 449
           Q+H +  G+ +R  SR G + T  Y +      IS  +         +LD E V++DKEK
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 450 NTILPFQVLSTRKRKGVAVEDVKV-----RVCLFAFDILCYNDEPLITRPLAERRACLER 504
           N +LPF ++ +   + +   D KV     R     FD++  N   L   PL  R++ L  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 505 ALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWL 564
            L PV   +++ S+V     + ++  L++A+    EG+++K      S YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWI 490

Query: 565 KLKKDYLQGVGDSLDLCVL 583
           K+K +Y + +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 117/244 (47%), Gaps = 13/244 (5%)

Query: 349 DKHCVLTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRI 406
           +   V+ PG    P LAK  S S  ++  + +   F  E K DGER Q+H    G  ++ 
Sbjct: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKND-FIIEEKMDGERIQLHYQDYGEKLKF 309

Query: 407 YSRNGENMTERYPEIRISDFIADPARTHTLILDC----EAVAWDKEKNTILPFQVLSTRK 462
           +SR G + T  Y E     FI    + +  + DC    E + +DK +N ILPF ++ +  
Sbjct: 310 FSRRGTDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSA 369

Query: 463 RKGVAVEDVK---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEV 519
           R  +  + +     +     FD++  N   L   PL  R+  L     P P  ++L S  
Sbjct: 370 RSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429

Query: 520 TTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLD 579
              + D ++  L+ A+    EG+   +L+  +S Y  + R+ +W+K+K +YL+  G+++D
Sbjct: 430 HRFNEDSIRKSLELAISMGSEGI---VLKRYDSRYTVASRNDDWIKVKPEYLEQFGENMD 486

Query: 580 LCVL 583
           L V+
Sbjct: 487 LIVI 490

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 105/416 (25%), Positives = 166/416 (39%), Gaps = 66/416 (15%)

Query: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415
           G    P +A+  K   E +    G  F  E K DG+R QVH +  G S+  +SRNG N T
Sbjct: 291 GYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNGINYT 350

Query: 416 ERYPEIR----ISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471
             Y E      IS+ +         ILD E V++DKE   ILPF +  +     V  E  
Sbjct: 351 YLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVNFETT 410

Query: 472 -----KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDE 526
                  R     FD+L  N + L  + + +R+  LE+ L+P    + L S       + 
Sbjct: 411 GHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCSDAEA 470

Query: 527 LQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXX 586
           +   L  AV    EG+   +L+   S Y   KR  +W+K+K +YL+  G+++DL V+   
Sbjct: 471 ITAALGAAVAHGSEGI---VLKKARSKYSVGKRDDSWIKIKPEYLENFGENMDLVVI--- 524

Query: 587 XXXXXXXXXXXXFLLGCYNQDSGE----------------------------YETCCKIG 618
                       F+      D  E                            + + C I 
Sbjct: 525 ---GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISFCSIA 581

Query: 619 TGFSEEMLQTLFDRLS-----PTAIPTPKAFYVHSESAPPDVWFEP--TLLFEV----LT 667
            G S E  + + DRL+     P     P   +V   +  P  W +P  +++ EV    + 
Sbjct: 582 NGISNEEFKEI-DRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKARSID 640

Query: 668 ADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHVS 723
            + S S +YK G++ Y            R+R DK    A++  +     E++S+ +
Sbjct: 641 NEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTASTVAEYDTAREARSYFN 689

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 104/452 (23%), Positives = 181/452 (40%), Gaps = 61/452 (13%)

Query: 314 ELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISE 373
           +L++      +D    + + ++V     +  +   D    +  G    P LAK      E
Sbjct: 208 KLLNCWHPDAQDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYE 267

Query: 374 VLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYPEIRISDFIADPAR 432
            + R     F  E K DGER QVH +  G S++ +SR G + T  Y     S  I+   R
Sbjct: 268 KICRTLHDDFLVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLR 327

Query: 433 ----THTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVA---VEDVKVRVCLFAFDILCY 485
                   +LD E V +D ++  ILPF ++    ++ ++   + +V        FD+L  
Sbjct: 328 FTDSVKECVLDGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYL 387

Query: 486 NDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVK 545
           N   L   PL +R+  L   L P+   +++        ++ ++  L+ A+    EG+++K
Sbjct: 388 NGTSLTPLPLHQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLK 447

Query: 546 ILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYN 605
                 S Y  + R+ NW+K+K +YL+  G++LDL V+               F+LG   
Sbjct: 448 YYN---SSYNVASRNNNWIKVKPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLV 498

Query: 606 QDSGEYE------------------------------TCCKIGTGFSEEMLQTLFDR--- 632
            D  EY+                              + C I  G S+E  + + DR   
Sbjct: 499 LDEEEYKKHQGDSSEIVDHSSQEKHIQNSRRRVKKILSFCSIANGISQEEFKEI-DRKTR 557

Query: 633 --LSPTAIPTPKAFYVHSESAPPDVWFEP--TLLFEVLTADLSLSPVYKAGTSSYGKGIS 688
                T+   P A  +   S  P  W +P  +++ E+ +  L  +   +     Y    +
Sbjct: 558 GHWKRTSEVAPPASILEFGSKIPAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATNCT 614

Query: 689 LRFPRFIRLRDDKTPEEATSSEQVVEFYESQS 720
           L      R+R DK   E T    + + YES++
Sbjct: 615 LYGGYCKRIRYDK---EWTDCYTLNDLYESRT 643

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 110/235 (46%), Gaps = 11/235 (4%)

Query: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415
           G    P LAK      + +       F  E K DGER Q+H +  G +++ +SR+G + T
Sbjct: 272 GYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFFSRHGTDYT 331

Query: 416 ERYPEIRISDFIADPARTHT----LILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471
             Y   + +  IA   R H      +LD E V +D     +LPF ++ +     +  +D+
Sbjct: 332 YLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQLNKKDI 391

Query: 472 ---KVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528
                      FDIL  N   LI  PL +R+  L   L P    +++ S +      +++
Sbjct: 392 DNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTDSIQIK 451

Query: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
             LD A+    EG+   +L+   S Y P+ R  NW+K+K +YL+  G+++DL V+
Sbjct: 452 KGLDAAISVGSEGI---VLKQYISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 111/209 (53%), Gaps = 11/209 (5%)

Query: 383 FTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERYPEIRISDFIADPARTHT----LI 437
           F  E K DGER Q+H +  G+ ++  SR G + +  Y + R +  I      H      I
Sbjct: 299 FFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGAIGRYLNFHKDVKECI 358

Query: 438 LDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK---VRVCLFAFDILCYNDEPLITRP 494
           LD E V +D  KN ILPF ++ +   + ++V D++         AFD++  N   L T P
Sbjct: 359 LDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMAFDLVYLNGSSLSTLP 418

Query: 495 LAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHY 554
           L +R+  L++ L+P P  +++   +       ++  L++A+    EG+++K  +   S Y
Sbjct: 419 LHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGSEGIILKRFD---SQY 475

Query: 555 EPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
             +KRS +W+K+K +YL+  G+++DL V+
Sbjct: 476 LVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 124/267 (46%), Gaps = 11/267 (4%)

Query: 325 DAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFT 384
           D F  V +   V +   E  +   ++   L  G    P LAK      E + +  G  F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 385 CEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERY----PEIRISDFIADPARTHTLILD 439
            E K DGER Q+H +  G+ ++  SR G + T  Y        I+ ++         ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 440 CEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV---KVRVCLFAFDILCYNDEPLITRPLA 496
            E V +D+EK  ILPF ++ +  +  ++ E +          AFD++  N   L+  PL 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 497 ERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEP 556
           +R+  L + L    G + + S     +L+ +   L  A+    EG+++K L    S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKL---NSRYMV 456

Query: 557 SKRSRNWLKLKKDYLQGVGDSLDLCVL 583
           + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIII 483

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 113/238 (47%), Gaps = 11/238 (4%)

Query: 354 LTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGE 412
           +  G+   P LA       + +    G  F  E K DGER Q+H    GS ++ YSR   
Sbjct: 263 INIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRAT 322

Query: 413 NMTERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAV 468
           + T  Y        +++FI         +LDCE V +D     +LPF ++ +  +  ++ 
Sbjct: 323 DYTYLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQ 382

Query: 469 EDVKVRV---CLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLD 525
           + +  +     L  FD+L  N   L+  P  +RR  L++ L P    +++   +      
Sbjct: 383 DGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQ 442

Query: 526 ELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
            ++  L++A+    EG+   IL+  +S Y  + RS +W+K+K +YL+  G+++DL ++
Sbjct: 443 MIKKSLEKALSVGSEGI---ILKRYDSRYVIASRSDDWIKIKPEYLEQFGENMDLVLM 497

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 109/235 (46%), Gaps = 11/235 (4%)

Query: 357 GIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMT 415
           G    P LAK      E + R     F  E K DGER QVH +  G S++ +SR G + T
Sbjct: 251 GFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRGIDYT 310

Query: 416 ERY----PEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDV 471
             Y        IS ++         +LD E V +D  +  ILPF ++    +  ++  D+
Sbjct: 311 YLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLSCSDI 370

Query: 472 K---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQ 528
                R     FD+L  N+  L   PL +R+  L   L P    +++        +  ++
Sbjct: 371 NNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDVQSVK 430

Query: 529 HYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
           + L+ A+    EG+++K      S Y  + R+ NW+K+K +YL+  G++LDL ++
Sbjct: 431 NSLEVAISLGSEGVVLKYYN---SSYNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 115/239 (48%), Gaps = 13/239 (5%)

Query: 354 LTPGIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNG 411
           +  G P  P  AK  S S  ++  + +   F  E K DGER Q+H    G+ +   SR G
Sbjct: 264 INVGSPFAPQSAKKLSISYEKICAKLK-HDFFIEEKMDGERIQLHYQDYGNKLSFLSRRG 322

Query: 412 ENMTERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVA 467
            + T  Y E      +S ++         +LD E V +DKE+N +LPF ++ +  R  + 
Sbjct: 323 TDYTYLYGESIKDGTVSKYLHLDNNVQNCVLDGEMVTFDKERNALLPFGLVKSSARSIIT 382

Query: 468 VEDVK---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSL 524
            E V     R  L  FD++  N   L+  PL +R+  LE+   P    ++L         
Sbjct: 383 QEGVANEGYRPLLMVFDLVYLNGVSLVNIPLYQRKLYLEKIFTPERHIVELLRSKRCSDE 442

Query: 525 DELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
             +++ L+ A+    EG+   +L+   S Y  + R+ +W+K+K +YL+  G+++DL V+
Sbjct: 443 RSIKNALEHAISIGSEGV---VLKHYNSRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 23/276 (8%)

Query: 328 CQVPNYQI---------VIETALEHGIMELDKHCV-LTPGIPLKPMLAKPSKSISEVLDR 377
           C  P+ QI         ++   L +  + LDK  + +  G    P LAK      E +  
Sbjct: 223 CWHPDAQIYLGVVTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICS 282

Query: 378 FQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENMTERYPE----IRISDFIADPAR 432
                F  E K DGER Q+H +  GS ++  SR G + +  Y +      IS ++   + 
Sbjct: 283 KLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQEVARGVISQYLKLKSD 342

Query: 433 THTLILDCEAVAWDKEKNTILPFQVLSTRK-----RKGVAVEDVKVRVCLFAFDILCYND 487
               +LD E V++DK++  ILPF ++ +          V  E+   R     FD++  N 
Sbjct: 343 VRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEVGNENDGYRPLYMVFDLVYLNG 402

Query: 488 EPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVKIL 547
             L   PL  R+  L+  L PVP  +++   +       +++++ +A+    EG++VK  
Sbjct: 403 VSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVK-- 460

Query: 548 EGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
               S YE   R+ +W+K+K +Y + +G+++DL V+
Sbjct: 461 -QASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI 495

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 160/379 (42%), Gaps = 51/379 (13%)

Query: 354 LTPGIPLKPMLAKPSK-SISEVLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNG 411
           +T     +P LAK +  S   V  + Q   F  E K DGER Q+H +  G  ++  SR G
Sbjct: 241 ITISHAFEPQLAKRTHLSYERVASKLQ-HDFIIEEKMDGERLQIHYINYGEQIKYLSRRG 299

Query: 412 ENMTERYPEIRISDFIADPARTHTLILDC----EAVAWDKEKNTILPFQVLSTRKRKGVA 467
            + +  Y E   S  I+   + H  + DC    E + +D EK+ +LPF ++ +     + 
Sbjct: 300 VDFSYLYGENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQ 359

Query: 468 VEDVKV------RVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTT 521
            E   +      +    AFD++  N + L    L  R+  L + L PV   +++   +  
Sbjct: 360 SELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKA 419

Query: 522 MSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLC 581
           ++ + ++  L+QA+    EG+++K L    S Y    R+ +W+K+K +YL+  G+++DL 
Sbjct: 420 INAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLL 476

Query: 582 VLXXXXXXXXXXXXXXXFLLGCYNQDSGE------YETCCKIGTGFSEEMLQTLFDRLSP 635
           ++               F  G    D  E      + + C I  G S E  + +  +   
Sbjct: 477 II------GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERK--- 527

Query: 636 TAIPTPKAFYVHSESAP-----------PDVWFEP--TLLFEVLTADLSLSPVYKAGTSS 682
               T   +++ SE  P           P  W  P  +++ EV    +      ++    
Sbjct: 528 ----TWGKWHIFSEDPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRK 580

Query: 683 YGKGISLRFPRFIRLRDDK 701
           Y  G +L F    ++R DK
Sbjct: 581 YRSGCTLHFGYCKQIRYDK 599

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 122/278 (43%), Gaps = 11/278 (3%)

Query: 314 ELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKPSKSISE 373
           +L++      +D    V + ++V     +  I   +    +  G    P LAK      E
Sbjct: 208 KLLNCWHPDAQDYLSVVSDLRVVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYE 267

Query: 374 VLDRFQGQRFTCEYKYDGERAQVHLLPDG-SMRIYSRNGENMTERYP----EIRISDFIA 428
            +       F  E K DGER QVH +  G S++ +SR G + T  Y        IS ++ 
Sbjct: 268 KICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLK 327

Query: 429 DPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK---VRVCLFAFDILCY 485
                   +LD E V +D  +  ILPF ++    ++ ++  D+           FD+L  
Sbjct: 328 FSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYL 387

Query: 486 NDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLMVK 545
           N   L   PL +R+  L   L+P    +++         + ++  L+ A+    EG+   
Sbjct: 388 NGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSRCYDAESVKKSLEVAISLGSEGV--- 444

Query: 546 ILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
           +L+   S Y  + R+ NW+K+K +YL+  G++LDL ++
Sbjct: 445 VLKHYSSSYNVASRNNNWIKVKPEYLEEFGENLDLIII 482

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 115/236 (48%), Gaps = 13/236 (5%)

Query: 357 GIPLKPMLAKP-SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGS-MRIYSRNGENM 414
           G    P LAK  S S  ++  + +   F  E K DGER Q+H +  G+ ++  SR G + 
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKND-FFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 415 TERYPEI----RISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVED 470
           T  Y E      I+ ++         +LD E V +D++++ +LPF ++ +     +  E+
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEE 369

Query: 471 VK---VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDEL 527
           +        L  FD++  N   L+  PL +R+  L   L P    +Q+ +     + + +
Sbjct: 370 ISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENII 429

Query: 528 QHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVL 583
           +  L+ A+    EG+   +L+   S Y    R+ +W+K+K +YL+  G+++DL V+
Sbjct: 430 RKSLEHAISVGSEGI---VLKNYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,757,780
Number of extensions: 2586085
Number of successful extensions: 6834
Number of sequences better than 10.0: 38
Number of HSP's gapped: 6934
Number of HSP's successfully gapped: 38
Length of query: 723
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 606
Effective length of database: 40,065,477
Effective search space: 24279679062
Effective search space used: 24279679062
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)