Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01386g7.344ON30730716340.0
Kwal_56.246247.344ON30730613460.0
SAKL0F11242g7.344ON30930611091e-153
TDEL0C020307.344ON31130410411e-142
ZYRO0F11594g7.344ON30930610281e-140
KLLA0D12474g7.344ON3123059871e-134
Skud_12.2687.344ON3183029021e-121
YLR205C (HMX1)7.344ON3173078971e-120
Ecym_47297.344ON3263048931e-119
Suva_10.2997.344ON3203058911e-119
Smik_12.2637.344ON3182808831e-118
NCAS0E028907.344ON3153088331e-111
NDAI0E045007.344ON3273237471e-97
CAGL0A03905g7.344ON2822577187e-94
ACL154W7.344ON3192757149e-93
TPHA0F029207.344ON3202907026e-91
Kpol_530.367.344ON3113116912e-89
KAFR0L014707.344ON3003066312e-80
KNAG0B026407.344ON3022885791e-72
TDEL0D059003.522ON808160790.24
Smik_7.2684.98ON71873676.4
Suva_13.2282.620ON31392667.5
TPHA0B016104.341aON1170106669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01386g
         (307 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   634   0.0  
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   523   0.0  
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   431   e-153
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   405   e-142
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   400   e-140
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   384   e-134
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   352   e-121
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   350   e-120
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   348   e-119
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   347   e-119
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   344   e-118
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   325   e-111
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   292   1e-97
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   281   7e-94
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   279   9e-93
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   275   6e-91
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   270   2e-89
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   247   2e-80
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   227   1e-72
TDEL0D05900 Chr4 (1068588..1071014) [2427 bp, 808 aa] {ON} Anc_3...    35   0.24 
Smik_7.268 Chr7 (444398..446554) [2157 bp, 718 aa] {ON} YGL022W ...    30   6.4  
Suva_13.228 Chr13 complement(367363..368304) [942 bp, 313 aa] {O...    30   7.5  
TPHA0B01610 Chr2 complement(361146..364658) [3513 bp, 1170 aa] {...    30   9.1  

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60
           MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI
Sbjct: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60

Query: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120
           EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE
Sbjct: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120

Query: 121 ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPN 180
           ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPN
Sbjct: 121 ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPN 180

Query: 181 LTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFE 240
           LTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFE
Sbjct: 181 LTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFE 240

Query: 241 WNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMY 300
           WNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMY
Sbjct: 241 WNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMY 300

Query: 301 WVLRKFF 307
           WVLRKFF
Sbjct: 301 WVLRKFF 307

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/306 (79%), Positives = 278/306 (90%)

Query: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60
           M+TIPSPTDVGALANRINF+TRD+HNKIDKQMS KFAFAMKHGFIYRQG+LAFFYVFQAI
Sbjct: 1   MSTIPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAI 60

Query: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120
           EQE+DRL Q AQT EE QTRDIL QFW   F R PRI QDL+LLYAKEFP+   L  FL+
Sbjct: 61  EQEIDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQ 120

Query: 121 ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPN 180
           + TL PE QGFVD+VH S+R+RPT+ILA+CHVLYLALFAGGRVMRSTIYRSTGLFPKFP+
Sbjct: 121 QNTLPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPD 180

Query: 181 LTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFE 240
           LT EEVVR+GTNFFTFSD GVQAENQLRK YKRGYELATR+GLTE+QKLNIL+V+ A FE
Sbjct: 181 LTPEEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFE 240

Query: 241 WNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMY 300
           WNTRV++EIGEINRQELMGKLSF+L++F I+EW++++KLTR+QKS+VLATG V+QIL+MY
Sbjct: 241 WNTRVISEIGEINRQELMGKLSFKLVSFAIDEWKHTEKLTRRQKSIVLATGAVIQILVMY 300

Query: 301 WVLRKF 306
           W+LRKF
Sbjct: 301 WMLRKF 306

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  431 bits (1109), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 243/306 (79%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           TTIPSPTDVGALANRINFHTRD HNKI+  MS K AFAMKHG IYRQG+LAF+Y+F A+E
Sbjct: 4   TTIPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVE 63

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121
           QE+D L Q A TP E QT+ ILNQFW EEFRR+  I QDLELLY+KE+ T   L  FL++
Sbjct: 64  QEIDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDD 123

Query: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181
             L P+ Q FV+Y+H ++R +P  ILAYCHVLYLALFAGG++M+S IYR TGLFPKF +L
Sbjct: 124 NVLPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHL 183

Query: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241
           T E++VRRGTNFFTFS+ G  AE +LR  YK+GYELATR+ LTEEQK  I+ VS+ IF+W
Sbjct: 184 TPEQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDW 243

Query: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301
           N  V+ E+GEINR ELMGK SF+L++F++EEW+YS+KL+++ K  +L    +LQ L+ YW
Sbjct: 244 NMDVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLSKENKITILVIFAILQFLLAYW 303

Query: 302 VLRKFF 307
           +LRK F
Sbjct: 304 LLRKLF 309

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  405 bits (1041), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 187/304 (61%), Positives = 234/304 (76%)

Query: 3   TIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQ 62
           TIP+PTDVGALANRINFHTRD HNK++  MS + AFA+KHGFIYRQG+LAF+++F A+EQ
Sbjct: 7   TIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVEQ 66

Query: 63  ELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEET 122
           ELDRL  + Q  EE Q + +L QFW EEFRR  RI +DLE+LY+ E+  S SLR F+E  
Sbjct: 67  ELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQ 126

Query: 123 TLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLT 182
            LAP+LQ FVD +H++++     ILAYCHVLYLALFAGG+VMRS +YR TGLFPKF  LT
Sbjct: 127 PLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLT 186

Query: 183 TEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWN 242
            +E+V RGTNFFTFSD G  AEN+LR  YK GYELATRQ L+E QK  IL VS+ IF+WN
Sbjct: 187 PKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWN 246

Query: 243 TRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYWV 302
             V+ EIGE+NR ELM K SF+LLT++ EEW+YS  L+++ K  ++   +++Q L+ Y V
Sbjct: 247 MDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAILIQFLVAYIV 306

Query: 303 LRKF 306
           LRKF
Sbjct: 307 LRKF 310

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  400 bits (1028), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 188/306 (61%), Positives = 241/306 (78%), Gaps = 1/306 (0%)

Query: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60
           M TIP+PTDVGALANRINFHTRD HNKI+  MS + AFA+KHG+I+RQG+LA++Y+FQAI
Sbjct: 1   MATIPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAI 60

Query: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120
           EQELDR+   A+  +E Q +++L +FW  +FRR  RI QDL LLY+ EFPT +SL  FL 
Sbjct: 61  EQELDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLT 120

Query: 121 ETT-LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFP 179
               LAP LQ FVD +H +++  P  ILAYCHVLYLALFAGG+VMRS +YR TGLFPKF 
Sbjct: 121 SGNHLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQ 180

Query: 180 NLTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIF 239
           +L+  E+V+RGTNFFTFS+ G +AEN+LR  YKRGYELATR  LTEEQK  I+ VS+ IF
Sbjct: 181 HLSPRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIF 240

Query: 240 EWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMM 299
           +WN   + EIGE+NRQELMG +SFRLLT++ EEW+++DKL++ QK L++   +V+Q L++
Sbjct: 241 QWNMETIAEIGELNRQELMGSVSFRLLTYLHEEWKHTDKLSKNQKDLLVLAVLVVQFLIV 300

Query: 300 YWVLRK 305
           Y VLR+
Sbjct: 301 YLVLRR 306

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  384 bits (987), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/305 (58%), Positives = 235/305 (77%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           TTIPSPTDVGALANRINF TRD HNKI+  MS K AFAM+HGFIYRQG++A++YVF AIE
Sbjct: 7   TTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYYVFHAIE 66

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121
           QE+DRL +   T ++E+ + IL QFW EEFRR+ +++ DL++LY  E+P S  L+ FL+ 
Sbjct: 67  QEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDG 126

Query: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181
             L  +LQ FVD +H++++  P  ILAYCHVLYLALFAGGRVM+S +YR  GLFPKF +L
Sbjct: 127 FQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHL 186

Query: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241
           + +E+VRR TNFFTFS+ GV  EN+LR  YK+GYELATR  LTE +KL I++VS  IF+ 
Sbjct: 187 SPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQR 246

Query: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301
           N  VV EIGEINR ELMGK S++L++F+ EEW+YS+KLT + K L++   +V  ++ +Y 
Sbjct: 247 NMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFNMVFVYT 306

Query: 302 VLRKF 306
           +LR+ 
Sbjct: 307 ILRRL 311

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/302 (56%), Positives = 221/302 (73%), Gaps = 2/302 (0%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           T IPSPTDVGALANRINFHTRD HNKI+  M  + A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 7   TIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121
           QE+DRL  +  T +E QT  IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL +
Sbjct: 67  QEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAK 126

Query: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181
               P LQ FV+ +H +IR  P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 127 FEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERL 186

Query: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241
           + +E+V++GTNFFTFSD G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+W
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDW 246

Query: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301
           N  +V EIGE+NR+ELMGK SF+ +T+V EEW  SDK +  +K+   A  ++L I+ + W
Sbjct: 247 NFHIVAEIGELNRRELMGKFSFKCVTYVYEEWM-SDKDSAFRKAFNTAMLLMLSIIAV-W 304

Query: 302 VL 303
           V+
Sbjct: 305 VI 306

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 166/307 (54%), Positives = 222/307 (72%), Gaps = 2/307 (0%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           T IPSPTDVGALANRINF TRD HNKI+  M  K A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 7   TIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121
           QE+DRL  +  T EE QT  IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL  
Sbjct: 67  QEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126

Query: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181
               P LQ F++ +H +I   P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 127 FQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL 186

Query: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241
           + +E+V++GTNFFTFSD G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+W
Sbjct: 187 SQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246

Query: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYS-DKLTRKQ-KSLVLATGVVLQILMM 299
           N  +V EIGE+NR+ELMGK SF+ +T++ EEW ++ D  TR+   +++L    ++ I ++
Sbjct: 247 NFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSIIAIWVL 306

Query: 300 YWVLRKF 306
           Y++++ F
Sbjct: 307 YFLVKSF 313

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  348 bits (893), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 169/304 (55%), Positives = 211/304 (69%)

Query: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63
           IPSPTDVGALANRINF TRD H K D  +  K A AM+HGFIYRQG+LAF+Y+F A+EQ+
Sbjct: 22  IPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQGILAFYYIFHAVEQQ 81

Query: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123
           +DRL +   T EE Q   IL QFW EEFRR+ R+L+DLE  Y  E+PT   L+ FL +  
Sbjct: 82  IDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFE 141

Query: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183
           L P+LQ FVD++       P+ ILAYCHVLY ALFAGG+VMRS IYR+ GLFPK   ++ 
Sbjct: 142 LPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISA 201

Query: 184 EEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNT 243
            E  R GTNFFTFSD GV  EN+LR  YK+ YELATR+GL E QKL I+DVS A F+   
Sbjct: 202 AESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVM 261

Query: 244 RVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYWVL 303
            ++ EIGE N++ELM   SF+LLTF+  EW+Y+ KL+ + K  +      +  LM+Y+ L
Sbjct: 262 DILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSSEVKQALAIAVFFINFLMIYFTL 321

Query: 304 RKFF 307
           R  F
Sbjct: 322 RTIF 325

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 218/305 (71%), Gaps = 2/305 (0%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           T IPSPTD+GALANRINFHTRD HNKI+  M  K A AM+HGFIYRQG+LA++YVF AIE
Sbjct: 9   TIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 68

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEE 121
           QE+DRL  +A + +E Q   IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL  
Sbjct: 69  QEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 128

Query: 122 TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNL 181
               P LQ FVD +H +IR  P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L
Sbjct: 129 FEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL 188

Query: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241
           T +E+V++GTNFFTFS+ G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+W
Sbjct: 189 TQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDW 248

Query: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301
           N  +V EIGE+NR+ELM K SF+ +T+V EEW +S K +  +K+      ++L I  + W
Sbjct: 249 NFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFS-KGSASRKAFSTTMLLMLSITAV-W 306

Query: 302 VLRKF 306
           +L  F
Sbjct: 307 ILYYF 311

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  344 bits (883), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 162/280 (57%), Positives = 208/280 (74%), Gaps = 1/280 (0%)

Query: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63
           IPSPTD+GALANRINFHTRD HNKI+  M  K A AM+HGFIYRQG+LA++YVF AIEQE
Sbjct: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68

Query: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123
           +DRL  +  T +E QT  IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL    
Sbjct: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128

Query: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183
             P LQ FV+ +H +I+  P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L+ 
Sbjct: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188

Query: 184 EEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNT 243
           +E+V++GTNFFTFSD G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+WN 
Sbjct: 189 KELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248

Query: 244 RVVTEIGEINRQELMGKLSFRLLTFVIEEWQYS-DKLTRK 282
            +V EIGE+NR+ELMGK SF+ +T+V EEW ++ +  TRK
Sbjct: 249 NIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRK 288

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  325 bits (833), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 144/308 (46%), Positives = 219/308 (71%), Gaps = 3/308 (0%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           T IPSPTD  ALANRINF TRD HNKI+K+MS K A A++HGFIYRQG+L ++Y+F+ +E
Sbjct: 7   TIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYYIFKVVE 66

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE- 120
           +E+ +L     T EE +  ++L++ W  EF R   +L+DL+LLY  E+PT  +L+ FLE 
Sbjct: 67  EEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLET 126

Query: 121 -ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFP 179
             T L P L  F+ Y+H SI   P +I AYCHVLYLALFAGG+++RS IY++ G  P F 
Sbjct: 127 NATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFN 186

Query: 180 NLTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIF 239
           +L+++EV  +GTNFF F   GV  E +L+  +K+ YEL TR+ L E++K  I++ S  IF
Sbjct: 187 HLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIF 246

Query: 240 EWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDK-LTRKQKSLVLATGVVLQILM 298
           ++N   + E+G IN+++LM KL+F+++T+++EEW+++D  L+++ K L++   V+L +L 
Sbjct: 247 DYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRGKHLIMVVMVLLHMLF 306

Query: 299 MYWVLRKF 306
            +++L++F
Sbjct: 307 AFFILKRF 314

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  292 bits (747), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 137/323 (42%), Positives = 213/323 (65%), Gaps = 18/323 (5%)

Query: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60
           +T IPSPTD  ALANRINFHTRD HNKIDK+M+ K A A++HG IYRQG+L ++Y+FQA+
Sbjct: 6   VTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYYIFQAV 65

Query: 61  EQELDRLR--QEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTF 118
           E E++ L       T E+++T  +L++ W  EF R  ++ +DL+LLY+  F     L  F
Sbjct: 66  ESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNF 125

Query: 119 LEE------TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRST 172
           + E           +L  FV+++H SI++ P  ILAYCHVLYLALFAGG++++S IY++ 
Sbjct: 126 INEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNL 185

Query: 173 GLFPKFPNLTTEEVVRRGTNFFTF---SDA-----GVQAENQLRKNYKRGYELATRQGLT 224
           G  P F +L+++E+    TNFF F   SD+      +  EN+L+  +KR +EL TR  L 
Sbjct: 186 GFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLN 245

Query: 225 EEQKLNILDVSNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQK 284
           E +KL I++++  IF+WN   + E+G+ N++ELM   SF+L+ ++ EEW+++D + +  K
Sbjct: 246 ENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFNDSIKKNFK 305

Query: 285 SLVLATGVVLQILMMYWVLRKFF 307
           ++++   V+L +L+ ++V R  F
Sbjct: 306 AILMF--VILLLLIQFFVSRSLF 326

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  281 bits (718), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 136/257 (52%), Positives = 180/257 (70%), Gaps = 11/257 (4%)

Query: 32  MSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQELDRLRQ-------EAQTPEEEQ---TRD 81
           MS +FA A++HG +YRQG+LAF+YVFQAIEQE+D L            T   +Q      
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 82  ILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETTLAPELQGFVDYVHASIRS 141
           I+ QFW  EFRR  ++ +DL LLY+ E+PTS  L   L +  L P+LQGFVD VHA++R 
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 142 RPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTTEEVVRRGTNFFTFSDAGV 201
            P  +LAYCHV+YLALFAGG+VMRST+YR+TGLFPKF +L+++E+ R+GTNFFTFSDAGV
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 202 QAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNTRVVTEIGEINRQELMGKL 261
             ENQL+  YK+ YELATR+ L E  KL I+DV+  IFE N  ++ EIG++N++ L    
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239

Query: 262 SFRLLTFVIEEWQYSDK 278
              LL +V EE ++ +K
Sbjct: 240 KLDLLQYVFEELKFYNK 256

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  279 bits (714), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 185/275 (67%), Gaps = 1/275 (0%)

Query: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63
           +P PTD GALANRINFHTR+ H+K D  +SAKFA A++H  IYRQG+LA +Y+F+++EQ 
Sbjct: 18  VPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSVEQH 77

Query: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123
           +DRL +   T +E +  +IL  FW  EF RAP ++QD E+ YA E+ TSA L  FL+   
Sbjct: 78  IDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYE 137

Query: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183
           L P L   V  + A+   +P  ILA+CHVLYLALFAGGRVMRS + R  GL P+   L+ 
Sbjct: 138 LPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSA 197

Query: 184 EEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNT 243
            E   RGT+FFTF  AG   EN+ R  YKR YELATR  L+E +K +++D + A F+   
Sbjct: 198 RETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQ 256

Query: 244 RVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDK 278
            V+ E+   NRQEL+G  S+RLLTF+ EEW+Y  K
Sbjct: 257 AVMAELAVRNRQELLGSPSYRLLTFLGEEWRYRTK 291

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  275 bits (702), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 136/290 (46%), Positives = 191/290 (65%), Gaps = 9/290 (3%)

Query: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63
           IPSPTDV ALANRINF TRD HNKI   MS + A A++HGFIYRQG++AF+++F  IE E
Sbjct: 7   IPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFGTIENE 66

Query: 64  LDRLRQEAQTPEEE---QTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTS-ASLRTFL 119
           +D L     +  +    QT+ IL  F+  EFRR   +LQDL +LY  EF  +   +  FL
Sbjct: 67  IDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFL 126

Query: 120 EETTLA----PELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLF 175
              T      PEL  F DY+  + + +P  I+AYCHVLYLALFAGG++M+S + ++ GLF
Sbjct: 127 NSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLF 186

Query: 176 PKFPNLTTEEVVRRGTNFFTFS-DAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDV 234
           PKF +++ EEV  +G+NFF F+ +     +++LR  YK+ YEL+TR  L E QK +I++V
Sbjct: 187 PKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEV 246

Query: 235 SNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQK 284
           S  IF     V+ EIG  NR +LMG  + + +T+++EEW+Y++KLT+  K
Sbjct: 247 SKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEKLTKTNK 296

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  270 bits (691), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 199/311 (63%), Gaps = 9/311 (2%)

Query: 2   TTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIE 61
           +TIPSPTDVGALANRINF TRD HNK+   M  + A A+KHGFIYR+G++ F+++F  IE
Sbjct: 3   STIPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIE 62

Query: 62  QELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTS-ASLRTFLE 120
            E+D +       ++ Q + IL+ F+ +EFRR  +IL+DLELLY  EF      L  F+ 
Sbjct: 63  TEIDLV---LNNQDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFIN 119

Query: 121 E---TTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPK 177
               T  + +LQ FV Y+  +    P  +LAYCHVLYLALFAGG++M+S + +  G+FPK
Sbjct: 120 SDRFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPK 179

Query: 178 FPNLTTEEVVRRGTNFFTFSDAGV--QAENQLRKNYKRGYELATRQGLTEEQKLNILDVS 235
           F +L+ +E++ RGTNF+ F+D+      + +LR  YK+ YEL+TR  L E+QKL ++  S
Sbjct: 180 FEHLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTS 239

Query: 236 NAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQ 295
             +F      + E+G  NR ELM   S++L TF++EEW+Y+  ++   K  ++   +++Q
Sbjct: 240 KDVFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIIIQ 299

Query: 296 ILMMYWVLRKF 306
             +   +L ++
Sbjct: 300 FTLASVLLNRY 310

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 118/306 (38%), Positives = 195/306 (63%), Gaps = 16/306 (5%)

Query: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63
           +PSPTD  ALANRINFHTRD HN IDK MS K  FA++H FIY+  +L+++YVF+ +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123
           +D +     + +     +IL  F+ ++FRR  +IL+DL+ L   +  +        +  +
Sbjct: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFLNVIQDQSDD------QWLS 114

Query: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLF--PKFPNL 181
             PEL  F++++ +++   P  +LAYCHVLYLALFAGGR+MR+++ ++   F  PKF  +
Sbjct: 115 SRPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174

Query: 182 TTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEW 241
           +  +V+   TNFF F D  + +EN+L+  YKR Y++ T+  L E++KL I+D+S  IF++
Sbjct: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233

Query: 242 NTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTRKQKSLVLATGVVLQILMMYW 301
           N  ++ EIG +N+ ELM   +++++T+V+EEW++     +K   L L   ++  + +   
Sbjct: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKKYVILFL---IIFHLFVFIN 290

Query: 302 VLRKFF 307
           + +KF+
Sbjct: 291 LFKKFY 296

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  227 bits (579), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 175/288 (60%), Gaps = 18/288 (6%)

Query: 1   MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAI 60
           M+TIPSPTD  ALANRINFHTRD HN++DK  S KF  A++H FIY   +  F+ VF  +
Sbjct: 2   MSTIPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTV 61

Query: 61  EQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLE 120
           EQ +D L     +   +    IL +F+  EFRRA +I +D  L++  E+ T  S      
Sbjct: 62  EQRIDEL---IASEGGDGVGAILGEFYVPEFRRADKIKRD--LVFLGEWDTVES-----G 111

Query: 121 ETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPN 180
           + T  P+L GF+ Y+ + +   P  +LA CHVLYLALFAGGRV +S+++++ G  P F +
Sbjct: 112 QWTPPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRD 171

Query: 181 -------LTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILD 233
                  ++   +V   TNFF F++  ++ EN+LR  YKR YELATR  LTE+QKL ++ 
Sbjct: 172 KNGPGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIA 230

Query: 234 VSNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTR 281
            S  +F     V+ EI + N  ELM   SF+++T+ +EEW+++    R
Sbjct: 231 ASRDVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNKNFKR 278

>TDEL0D05900 Chr4 (1068588..1071014) [2427 bp, 808 aa] {ON}
           Anc_3.522 YER032W
          Length = 808

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 67/160 (41%), Gaps = 23/160 (14%)

Query: 48  QGVLAFFYVFQAIEQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAK 107
           QG L FF  F+  +  ++   Q  +T    + RD L+  +T  F   PR++QD +     
Sbjct: 392 QGTLKFFDKFEQSQTPVEAPNQPQETLSPGKQRDQLDLNFT--F---PRLIQDPDFEKVD 446

Query: 108 EFPTSASL---RTFLEETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVM 164
             PTS      R+ L E  L+P  +G     H   RSR    +     ++ A     RV 
Sbjct: 447 NSPTSKDFENRRSALMERNLSPGDKG-----HRHRRSR---SIHNAEDMFAATSTPPRVP 498

Query: 165 RSTIYRSTGLFPKFPNLTTEEVVRRGTNFFTFSDAGVQAE 204
             +  R     PK P  T+E+ +       T S++ + AE
Sbjct: 499 NRSPLR-----PKSP--TSEKNIVDQPEVTTLSNSDILAE 531

>Smik_7.268 Chr7 (444398..446554) [2157 bp, 718 aa] {ON} YGL022W
           (REAL)
          Length = 718

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 18  NFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQELDRLRQEAQTPEEE 77
           +F+T +   ++D + S      M++  +Y+     F  +F    Q  DR+RQ+  TP++ 
Sbjct: 606 DFYTAEGEYRVDARASE----TMRNSLLYKMSYKDFPQLFNG-GQGTDRVRQQMITPQDV 660

Query: 78  QTRDILNQFWTEE 90
              D  ++ +T E
Sbjct: 661 PPLDYFDEVFTSE 673

>Suva_13.228 Chr13 complement(367363..368304) [942 bp, 313 aa] {ON}
           YMR055C (REAL)
          Length = 313

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 12/92 (13%)

Query: 115 LRTFLEETTLAPELQGFVDYVHASIRSRPTA--------ILAYC-HVLYLALFAGGRVMR 165
           L  FL +  L  E+ G    +  S  ++P          + AY  H+  L + A    MR
Sbjct: 199 LSKFLSDNLLTAEIYGMPSILTLSSCNKPLDQVVKLWDFMFAYGFHMNILFVVAFLVKMR 258

Query: 166 STIYRS---TGLFPKFPNLTTEEVVRRGTNFF 194
           S ++RS     L  +FP+   +E++R G  F 
Sbjct: 259 SKVFRSDSPVNLLRQFPDFDADEIIRLGVGFI 290

>TPHA0B01610 Chr2 complement(361146..364658) [3513 bp, 1170 aa] {ON}
           
          Length = 1170

 Score = 30.0 bits (66), Expect = 9.1,   Method: Composition-based stats.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 9/106 (8%)

Query: 190 GTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNTRVVTEI 249
           G  FF F++A              G+ ++ R  +     LN+++   A F  +T+ +   
Sbjct: 392 GNKFFVFNEAAKPMPFLAGGYLMHGFTISLRY-IYSAVALNVINTIGA-FVKHTKYLPGD 449

Query: 250 GEINRQELMGKLSFRLLTFVIEEWQYSD----KLTRKQKSLVLATG 291
              N++E      F LL F+IE +QY +    K T  QKS VL + 
Sbjct: 450 KRFNQKE---NNQFSLLDFIIECYQYENSKYKKFTTSQKSNVLPSA 492

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,304,124
Number of extensions: 1178819
Number of successful extensions: 4737
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4845
Number of HSP's successfully gapped: 27
Length of query: 307
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 198
Effective length of database: 40,982,805
Effective search space: 8114595390
Effective search space used: 8114595390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 65 (29.6 bits)