Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01342g7.346ON42242222200.0
Kwal_56.246317.346ON42242220420.0
SAKL0F11286g7.346ON42340518530.0
TDEL0C020207.346ON42540417230.0
Skud_12.2667.346ON43641017090.0
Ecym_47277.346ON42941717030.0
KLLA0D12430g7.346ON41840316980.0
Smik_12.2617.346ON43641916990.0
Suva_10.2977.346ON43640216950.0
YLR203C (MSS51)7.346ON43640216940.0
NCAS0E028807.346ON42941816800.0
Kpol_530.357.346ON42540716780.0
TPHA0F029307.346ON43642216700.0
ZYRO0F11616g7.346ON41541316660.0
CAGL0A03927g7.346ON43743416320.0
KNAG0B026307.346ON43841215610.0
NDAI0E044807.346ON44341515490.0
ACL152W7.346ON42841315230.0
TBLA0E005007.346ON43742815000.0
KAFR0B008407.346ON42641914960.0
NCAS0A141207.346ON42740214740.0
NDAI0A019307.346ON45043914350.0
KNAG0C037507.346ON42440214220.0
KAFR0L021108.875ON51475790.31
KLTH0G11418g8.357ON897142751.1
Suva_6.1261.331ON82072732.0
CAGL0G08844g2.231ON84771713.8
KLTH0G09108g2.231ON782166696.6
Suva_9.2392.651ON97157688.4
Smik_9.2272.651ON95757689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01342g
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   859   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   791   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   718   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   668   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   662   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   660   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   658   0.0  
Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   659   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   657   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   657   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   651   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   650   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   647   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   646   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   633   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   605   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   601   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   591   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   582   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   580   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   572   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   557   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   552   0.0  
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    35   0.31 
KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} simila...    33   1.1  
Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON...    33   2.0  
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    32   3.8  
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    31   6.6  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    31   8.4  
Smik_9.227 Chr9 (373211..376084) [2874 bp, 957 aa] {ON} YIR023W ...    31   9.4  

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/422 (97%), Positives = 410/422 (97%)

Query: 1   MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLR 60
           MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGL            NRFHPWDQSPSPDLR
Sbjct: 1   MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLR 60

Query: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH 120
           ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH
Sbjct: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH 120

Query: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG 180
           DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG
Sbjct: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG 180

Query: 181 SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEA 240
           SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEA
Sbjct: 181 SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEA 240

Query: 241 QLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDY 300
           QLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDY
Sbjct: 241 QLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDY 300

Query: 301 FHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELD 360
           FHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELD
Sbjct: 301 FHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELD 360

Query: 361 LRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAI 420
           LRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAI
Sbjct: 361 LRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAI 420

Query: 421 EV 422
           EV
Sbjct: 421 EV 422

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/422 (86%), Positives = 398/422 (94%)

Query: 1   MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLR 60
           MQR IL+R+++R+   ++QKRHIMGFVRNALGL            NRFHPWDQSPSPDLR
Sbjct: 1   MQRYILNRSSLRNSHCSLQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLR 60

Query: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH 120
           ERAATIRALAKCPVTGREINYTCPKSGIPTH+SREAWE DL+YQQSKRPEILKKVNIYEH
Sbjct: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEH 120

Query: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG 180
           DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGF+SMDTEFQLAAVTKMLSYP+TIG
Sbjct: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIG 180

Query: 181 SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEA 240
           SVLHQFSPYSLNPKGP+TLEGLKSLAALRYTLYP+QNRRVTSI KNSPLRIF+LGARAEA
Sbjct: 181 SVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEA 240

Query: 241 QLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDY 300
           QLPGHVWKQLQFMFPET +E+HFVGPESYYDRNKREYVHS++PI+RRVDETL+FVYHTDY
Sbjct: 241 QLPGHVWKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDY 300

Query: 301 FHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELD 360
           FHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCA+FTTGFNE+D
Sbjct: 301 FHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVD 360

Query: 361 LRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAI 420
           L+RD+  VV ++GKELD++M+P  NAFGSTKWELND+NPQEVYQFNMF+AGFRGKRYHAI
Sbjct: 361 LQRDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAI 420

Query: 421 EV 422
           EV
Sbjct: 421 EV 422

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/405 (81%), Positives = 364/405 (89%)

Query: 18  VQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGR 77
           +QKRHI+GFVRNALGL            NRFHPWDQSPSPDLR RAATIRALA+CPVTG+
Sbjct: 19  IQKRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGK 78

Query: 78  EINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQ 137
           EINYTCP+SGIPTH+SREAWE D  Y  +K+ EILKKVNIYEHDLRSGRPFPEFDFP DQ
Sbjct: 79  EINYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138

Query: 138 DFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPV 197
           D+DRMVN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GSVLH+FSPY+LNPKGP+
Sbjct: 139 DYDRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPI 198

Query: 198 TLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPET 257
           TLEGLKSLAALRYTLYP+Q+R+V++ TK+ P+RIFILGARAEAQLPGHVWKQ QF+FPE 
Sbjct: 199 TLEGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEI 258

Query: 258 NIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYT 317
           N ELHF+GPES+YDR KREY+ SS+PIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPY 
Sbjct: 259 NFELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYL 318

Query: 318 DIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELD 377
           DIFFCFHPGFAAPES E+WMGKTME LLETKCA+FTTGFNE DL RD+  V  K+G E+D
Sbjct: 319 DIFFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMD 378

Query: 378 MLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           MLMEPV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYHAIEV
Sbjct: 379 MLMEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 423

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/404 (76%), Positives = 349/404 (86%), Gaps = 1/404 (0%)

Query: 19  QKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGRE 78
           Q+R I+GFVRNALGL            NRFHPWDQSP  DLRERAA IR LA+CPVTG+E
Sbjct: 23  QRRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKE 82

Query: 79  INYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQD 138
           INYTCP SGIPTH+SREAWE D +Y QSK+ EILKKVNIYEHDLRSGRPFPEFDFP  QD
Sbjct: 83  INYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQD 142

Query: 139 FDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVT 198
           FDR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP++I SVLHQFSPYSLNPKGPVT
Sbjct: 143 FDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVT 202

Query: 199 LEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETN 258
           LEGLKSLAALRYTLYP +N+ ++S TK+ P+RIFILGARAEAQLPGHVWKQLQ++FPE  
Sbjct: 203 LEGLKSLAALRYTLYPLENKTISS-TKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQM 261

Query: 259 IELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTD 318
            ELHFVGPE   ++ K +YV SS+P+V+RVDET+SFVYHTD+FHV HEAQDFFPYDPY D
Sbjct: 262 FELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLD 321

Query: 319 IFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDM 378
           +FFCFHPGF APE+  +W+ +TM+ LLETKCA+FTTGFN+ DL RDV  V  K+GKE+D+
Sbjct: 322 VFFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDV 381

Query: 379 LMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           LMEPV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYHAIEV
Sbjct: 382 LMEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/410 (74%), Positives = 348/410 (84%)

Query: 12  RSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAK 71
           R   ++  +RH+MGFVRNALGL            NRFHPWDQSPS DLRERAA IR LA 
Sbjct: 25  RLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAH 84

Query: 72  CPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEF 131
           CPVTG++INYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEF
Sbjct: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144

Query: 132 DFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSL 191
           DFP  Q +D+ VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGSVLH+FSPYSL
Sbjct: 145 DFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHKFSPYSL 204

Query: 192 NPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQ 251
           NPKGP+TLEGLKSLAALRYTLYP +NR V + TKN  +RIFILGARAEAQLPGHVWKQLQ
Sbjct: 205 NPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNRAMRIFILGARAEAQLPGHVWKQLQ 264

Query: 252 FMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFF 311
           F+FPE N E+HFVGPE  Y R+K+EYV S++P+V+RVDETL F++HTD+F VFHEAQDFF
Sbjct: 265 FLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQRVDETLRFIHHTDFFDVFHEAQDFF 324

Query: 312 PYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGK 371
           PYDPY D+FF FHPG+A+PES  +WMG+TM ALLETKCA+FTTGFN+ DL  D+  V  K
Sbjct: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMRALLETKCAIFTTGFNKKDLMDDINAVKSK 384

Query: 372 HGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421
           +GKE+D+LM+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 385 YGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/417 (73%), Positives = 354/417 (84%), Gaps = 2/417 (0%)

Query: 6   LSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAAT 65
           +S ++ R C    Q+R IMGFVRNALGL            NRFHPWDQSPSP+LRERAA 
Sbjct: 15  ISSSSSRVCGKQ-QRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAAR 73

Query: 66  IRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSG 125
           I+ALAKCPVTG+ I ++C  SGIPTH+S EAW+ND EY +SKR  +LKKVNIYEHDLRSG
Sbjct: 74  IKALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSG 133

Query: 126 RPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQ 185
           RPF EFDFP  QD+DRMVN+ NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TIGS+LHQ
Sbjct: 134 RPFLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQ 193

Query: 186 FSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGH 245
           +SPYSLNPKGP+TLEGLKSLAALRYTLYPEQNRRV SI ++ PLR+FILGARAEAQLPGH
Sbjct: 194 YSPYSLNPKGPITLEGLKSLAALRYTLYPEQNRRVRSI-QDKPLRVFILGARAEAQLPGH 252

Query: 246 VWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFH 305
           VWKQLQ++FPE+ IELHFVGPES YDR KREYV SS P+V+R+D+T+   YHTDYFHVFH
Sbjct: 253 VWKQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFH 312

Query: 306 EAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDV 365
           EAQDFFPYDPY DIFFCFHPGF +PE+R+ WM  T++ALL+TKCA+FTTGFN+ DL  D+
Sbjct: 313 EAQDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDL 372

Query: 366 GTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
             V  K+G ELDML++P  N FGSTKWELND+NP EVYQFNM+IAGFRGKRYHAIE+
Sbjct: 373 QAVKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIEL 429

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/403 (76%), Positives = 348/403 (86%), Gaps = 2/403 (0%)

Query: 21  RHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80
           R IMGFVRNALGL            NRFHPWDQSPSPDLRERAA I+A+A CPVT ++I 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 81  YTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140
           +TCP SGIPTH+SREAWE D EY +SKR E+LKKVNIYEHDLRSGRPFPEFDFP DQD+D
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 141 RMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLE 200
           RMVN++NWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGSVLHQ+SPYSLNPKGP+TLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 201 GLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIE 260
           GLKSLAALRYTLYPEQ+ R  +  +++P+RIFILG RAEAQLPGHVWKQLQ++ P+T+IE
Sbjct: 197 GLKSLAALRYTLYPEQSGRFRA-GQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 261 LHFVGPESYYDRNKREYVHSSS-PIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDI 319
           LHFVGPES+YDR KR YV SS+  IV+R+DE +   YHTD+FHVFHEAQDFFPYDPY D+
Sbjct: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315

Query: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDML 379
           FFCFHPGFAAPE+ E WMG TM+AL++TKCAVFTTGF++ DL RD+  V  K+G ELDML
Sbjct: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375

Query: 380 MEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           MEPV N FGSTKWELND NP EVYQFNM+IAGFRGKRYHAIE+
Sbjct: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIEL 418

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/419 (73%), Positives = 351/419 (83%), Gaps = 9/419 (2%)

Query: 3   RCILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRER 62
           R +LS  T         +RH+MGFVRNALGL            NRFHPWDQSPS DLRER
Sbjct: 25  RLVLSHQT---------RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRER 75

Query: 63  AATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDL 122
           AA IR LA CPVTG++INYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDL
Sbjct: 76  AAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDL 135

Query: 123 RSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSV 182
           RSGRPFPEFDFP +Q +D+ VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGS+
Sbjct: 136 RSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSL 195

Query: 183 LHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQL 242
           LH+FSPYSLNPKGP+TLEGLKSLAALRYTLYP +NR + + TKN  +RIFILGARAEAQL
Sbjct: 196 LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQL 255

Query: 243 PGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFH 302
           PGHVWKQLQF+FPE N E+HF+GPE  Y R+K+EYV S++P+V+RVDETL F++ TD+F 
Sbjct: 256 PGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFE 315

Query: 303 VFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLR 362
           VFHEAQDFFPYDPY D+FF FHPG+A+PES  +WMG+TM+ALLETKCA+FTTGFN+ DL 
Sbjct: 316 VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLT 375

Query: 363 RDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421
            D+  V  K+GKE+D+LM+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 376 DDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/402 (74%), Positives = 343/402 (85%)

Query: 20  KRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGREI 79
           +RH+MGFVRNALGL            NRFHPWDQSPS DLRERAA IR LA CPVTG++I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 80  NYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDF 139
           NYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 140 DRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTL 199
           D+ VNLTNWDLF YTR FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 200 EGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNI 259
           EGLKSLAALRYTLYP +NR V + T+N  +RIFILGARAEAQLPGHVWKQLQF+FPE N 
Sbjct: 213 EGLKSLAALRYTLYPLENRSVLATTRNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272

Query: 260 ELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDI 319
           E+HF+GPE  Y R+K+EYV S++P+V+R+DETL F +HTD+F VFHEAQDFFPYDPY D+
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSATPVVQRIDETLKFFHHTDFFQVFHEAQDFFPYDPYMDV 332

Query: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDML 379
           FF FHPG+A+PES  +WMG+TM ALLETKCA+FTTGFN+ DL  D+  V  K+GKE+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMTALLETKCAIFTTGFNKKDLMDDINLVKSKYGKEMDIL 392

Query: 380 MEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421
           M+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/402 (75%), Positives = 345/402 (85%)

Query: 20  KRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGREI 79
           +RH+MGFVRNALGL            NRFHPWDQSPS DLRERAA IR LA CPVTG++I
Sbjct: 33  RRHLMGFVRNALGLDPPPSPEDPTPENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92

Query: 80  NYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDF 139
           NYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDLRSGRPFPEFDFP  Q +
Sbjct: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQQQGY 152

Query: 140 DRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTL 199
           D+ VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPKGP+TL
Sbjct: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212

Query: 200 EGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNI 259
           EGLKSLAALRYTLYP +NR + + TKN  +RIFILGARAEAQLPGHVWKQLQF+FPE + 
Sbjct: 213 EGLKSLAALRYTLYPLENRSLPTTTKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQSF 272

Query: 260 ELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDI 319
           E+HF+GPE  Y R+K+EYV S++P+V+RVDETL F+Y T++F VFHEAQDFFPYDPY D+
Sbjct: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIYRTNFFEVFHEAQDFFPYDPYMDV 332

Query: 320 FFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDML 379
           FF FHPG+A+PES  +WMG+TM+ALLETKCA+FTTGFN+ DL  D+  V  K+GKE+D+L
Sbjct: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDINLVKSKYGKEMDVL 392

Query: 380 MEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421
           MEPV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 393 MEPVRNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/418 (72%), Positives = 342/418 (81%), Gaps = 2/418 (0%)

Query: 4   CILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERA 63
            +L RN      +  Q RH+MGFVRNALGL            NRFHPWDQSPSPDLRERA
Sbjct: 13  TLLPRNAFNVAGN--QTRHLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERA 70

Query: 64  ATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLR 123
           A IR LA+CPVTG+EINYTCP SGIPTH+SREAWE D EY  SKR E+LKKVNIYEHDLR
Sbjct: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130

Query: 124 SGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVL 183
           SGRPFPEFDFP DQ  DRMVN+TNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TIGSVL
Sbjct: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190

Query: 184 HQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLP 243
           HQFSPYSL PKGP++LEGLKSLAALRYTLYP QNR V S TK  P+RIFILGARAE+QLP
Sbjct: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250

Query: 244 GHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHV 303
           GHVWKQLQ++FPE   E+HF+GPESYYD++K++Y+  ++PI   VDETL  +YHT+YFH 
Sbjct: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310

Query: 304 FHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRR 363
            HEAQDFFPYDPY D+FF FHPGFA+ E  E+WM  TM+ LL+TKCA+FTTGF + DL  
Sbjct: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370

Query: 364 DVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421
           D+  V  K+GKELD+LM+P  N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRY  I+
Sbjct: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIK 428

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/407 (73%), Positives = 346/407 (85%), Gaps = 2/407 (0%)

Query: 18  VQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGR 77
           +QKR +MGFVRNALGL            NRFHPWDQSP  DLRERAA IR LAKCPVT +
Sbjct: 19  IQKRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHK 78

Query: 78  EINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQ 137
           +INYTCP SGIPTH+ +EAW  D +Y +SKR EILKKVNIYEHDLRSGRPFPEFDFP DQ
Sbjct: 79  DINYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQ 138

Query: 138 DFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPV 197
           D+DR++NLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGS+LHQFSPYSLNPKGPV
Sbjct: 139 DYDRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPV 198

Query: 198 TLEGLKSLAALRYTLYPEQNR--RVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFP 255
           TLEGLKSLAALRYTLYP QN+   V   T++ P+RIFILGARAEAQLPGHVWKQ Q++FP
Sbjct: 199 TLEGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFP 258

Query: 256 ETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDP 315
           E   E+HF+GPE Y ++ K +Y+ SS+PIV++VD+TL  V+H DYFHVFHEAQDFFPYDP
Sbjct: 259 EQEFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDP 318

Query: 316 YTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKE 375
           + D+FF FHPG+A PE+ E W+G+TM+ALL+TKCA+FTTGF++ DL RD+  V  ++G E
Sbjct: 319 FLDVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNE 378

Query: 376 LDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           LDMLM+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYHAIEV
Sbjct: 379 LDMLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV 425

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/422 (70%), Positives = 351/422 (83%), Gaps = 2/422 (0%)

Query: 1   MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLR 60
           M   IL++NT+ S   + QKR +MGFV+NALGL            NRFHPWDQSPSPDLR
Sbjct: 15  MSMNILNKNTLTSLPSS-QKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLR 73

Query: 61  ERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEH 120
           ERAA IR LAKCPVT +EINYTCP SGIPTH+SREAWE D +Y QSKR EILKKVNIYEH
Sbjct: 74  ERAARIRTLAKCPVTKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEH 133

Query: 121 DLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIG 180
           DLRSGRPFPEFDFPLDQ  DR+VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIG
Sbjct: 134 DLRSGRPFPEFDFPLDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIG 193

Query: 181 SVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSIT-KNSPLRIFILGARAE 239
           S+LHQFSPYSLNPKGP+TLEGLKSLAALRY+LYP Q +   S+   + P+RIFILGARAE
Sbjct: 194 SILHQFSPYSLNPKGPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAE 253

Query: 240 AQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTD 299
           AQLPGHVWKQLQF+FP+   E+HF+G E   +  K +Y+ S+ P+V+++DET+  +YH+D
Sbjct: 254 AQLPGHVWKQLQFLFPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSD 313

Query: 300 YFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNEL 359
           YFHV+HEAQDF PYDPY D+FF FHPGFAAPE+ + WMG TM+ALLETKCA+FTTGFN+ 
Sbjct: 314 YFHVYHEAQDFVPYDPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQ 373

Query: 360 DLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHA 419
           D+  DV  V  ++GKE+D LM+P+ N++GSTKWELNDMNPQE++QFNM++AGFRGKRYH 
Sbjct: 374 DITNDVEIVKARYGKEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHT 433

Query: 420 IE 421
           I+
Sbjct: 434 IK 435

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/413 (72%), Positives = 348/413 (84%), Gaps = 1/413 (0%)

Query: 10  TVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRAL 69
           ++R C+   Q+R I+GFVRNALGL            NRFH WDQSP+ DLRERAA IRAL
Sbjct: 4   SIRLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRAL 63

Query: 70  AKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFP 129
           A+CPVTG+EINYTCP SGIPTH+S+EAWE D +Y +SK+ E+LKKVNIYEHDLRSGRPFP
Sbjct: 64  AQCPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFP 123

Query: 130 EFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPY 189
           EFDFP D +FDR VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SVL+QFSPY
Sbjct: 124 EFDFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPY 183

Query: 190 SLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQ 249
           SLNPKGP+TLEGLKSLAALRYTLYP +N+ V + TK+ P+R+FILGARAEA LPGHVWKQ
Sbjct: 184 SLNPKGPITLEGLKSLAALRYTLYPFENKTVAA-TKDRPMRLFILGARAEALLPGHVWKQ 242

Query: 250 LQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQD 309
           LQF+FPET  ELHF+GPE   ++ K +YV S +P+V+R+DETLSFVYHTDYFHV+H+AQD
Sbjct: 243 LQFLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQD 302

Query: 310 FFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVV 369
           FFPYDPY D FFCFHPGF APES + W+ KT+  LLETKCA+F TG N+  L RD+  V+
Sbjct: 303 FFPYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVM 362

Query: 370 GKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
            KH KE+D+LMEP  N +GSTKWELND+NPQEVYQFNM+IAGFRGKRYHAIE+
Sbjct: 363 DKHSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIEI 415

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/434 (68%), Positives = 339/434 (78%), Gaps = 17/434 (3%)

Query: 3   RCILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRER 62
           R + +     +C   V KR +MGFVRNALGL            NRFHPWDQSP+ DLRER
Sbjct: 7   RAVQNTGKFYAC---VSKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRER 63

Query: 63  AATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDL 122
           AA I+ LAKCPVT + I YTCP SGIPTH+SREAWE D EY  SK+ EILKKVNIYEHDL
Sbjct: 64  AARIKTLAKCPVTHKPIQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDL 123

Query: 123 RSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSV 182
           RSGRPFPEFDFP DQ  DR VNLTNWDLF YTR FYSMDTEFQLAAVTKMLSYP+TIGSV
Sbjct: 124 RSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSV 183

Query: 183 LHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQL 242
           LHQFSPYSLNPKGP+TLEGLKSLAALRYTLYP QNR VT+  KN P+RIFILGARAEAQL
Sbjct: 184 LHQFSPYSLNPKGPITLEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQL 243

Query: 243 PGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSS--------------PIVRRV 288
           PGHVWKQLQF+FP+ N E+HF+GPES YDR + EY+ S++              P+ +R+
Sbjct: 244 PGHVWKQLQFLFPQQNFEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRI 303

Query: 289 DETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETK 348
           DET+ F YHTDYFH  H AQDFFPYDPY D+FF FHPG A+PES++ WM  T++ LL+TK
Sbjct: 304 DETMKFFYHTDYFHTLHTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTK 363

Query: 349 CAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMF 408
           CA+FTTGFN+ D+  D+  +   +GKE+DMLM PV N FGSTKWEL+D +P  VYQFNM+
Sbjct: 364 CAIFTTGFNKKDMADDIQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMY 423

Query: 409 IAGFRGKRYHAIEV 422
           IAGFRGKRYH I+V
Sbjct: 424 IAGFRGKRYHPIKV 437

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/412 (68%), Positives = 331/412 (80%), Gaps = 8/412 (1%)

Query: 18  VQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGR 77
           + +R +MGFVRNALGL            NRFHPWDQSP   LRERAA I+ LAKCPVTG 
Sbjct: 26  IARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERAARIKTLAKCPVTGL 85

Query: 78  EINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQ 137
            + YTCP SGIPTH+SREAWE D +Y  +KR E LKKVNIYEHDLRSGRPFPEFDFP +Q
Sbjct: 86  NVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLRSGRPFPEFDFPQEQ 145

Query: 138 DFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPV 197
            +D++VN+TNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTI S+L QFSPYSLNPKGP+
Sbjct: 146 GYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLLAQFSPYSLNPKGPI 205

Query: 198 TLEGLKSLAALRYTLYPE---QNRRVTSIT-----KNSPLRIFILGARAEAQLPGHVWKQ 249
           TLEGLKSLAA+RYTLY +    + R   +T     KN P+R+F+LGARAEAQLPGHVWKQ
Sbjct: 206 TLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLGARAEAQLPGHVWKQ 265

Query: 250 LQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQD 309
           L ++FPE + E+ F+GPESYYDR + +YV S +P+V +VDETL F+++TDYFHV HE+QD
Sbjct: 266 LSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFIHYTDYFHVLHESQD 325

Query: 310 FFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVV 369
           FFPYDPY D FF FHPGFA+PE+R+ W+  T+ ALL+TKCA+FTTGF+  DL  DV  + 
Sbjct: 326 FFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTGFDRDDLMNDVALLN 385

Query: 370 GKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421
            K G E+D+LMEP  N FGSTKWELND+NP EVYQFNM+IAGFRGKRYH I+
Sbjct: 386 EKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHTIK 437

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/415 (65%), Positives = 329/415 (79%), Gaps = 2/415 (0%)

Query: 8   RNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIR 67
           RN      H+   R +MGFVRNALGL            NRFHPWDQSP  DLRERAA IR
Sbjct: 31  RNNAHVSHHS--SRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKIR 88

Query: 68  ALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRP 127
            LA CPVT +EINYTCP SGIPTH+S+ AWE D  Y  +K  EILKKVNIYEHDLRSGRP
Sbjct: 89  TLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGRP 148

Query: 128 FPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFS 187
           FPEF FP DQDFDRM+N+TNWDLF YTR FYSMDTEFQ+AAVTKMLSYP+TIGS+LHQFS
Sbjct: 149 FPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQFS 208

Query: 188 PYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVW 247
           PYSL PKGP+TLEGLKS+AALRYTLYP  N+   ++TKN P+RIF+LGARAEAQLPGH+W
Sbjct: 209 PYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHIW 268

Query: 248 KQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEA 307
           KQLQ++FPE   EL F+GPE+YYD+ K++Y+    P+++ +D+TL   + T+YFH  HE+
Sbjct: 269 KQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHES 328

Query: 308 QDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGT 367
           QD FPYDPY D+FF FHPGF+A E+ E+WM  TM++LLET+CA+F TGF+  D+  D+  
Sbjct: 329 QDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMNI 388

Query: 368 VVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           +  K+  +LD+LM+PV N FGSTKWELND+NPQ+VYQFNM+IAGFRGKRY  +E+
Sbjct: 389 LDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVEL 443

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/413 (69%), Positives = 333/413 (80%), Gaps = 4/413 (0%)

Query: 12  RSCQHNV--QKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRAL 69
           R C      Q+R IMGFVRNALGL            NRFH W+QSPSPDLRERAA IRAL
Sbjct: 18  RGCAAGACGQRRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRAL 77

Query: 70  AKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFP 129
           A+CPVTG++I Y+C +SGIPTH+SREAWE D EY +SKR   L+KVN+YEHDLRSGRPF 
Sbjct: 78  ARCPVTGKDIRYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFA 137

Query: 130 EFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPY 189
           EFDFP +Q  DRMVN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYP+TIGS+LHQFSPY
Sbjct: 138 EFDFPQEQGRDRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPY 197

Query: 190 SLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQ 249
           +L P+GP+TLEGLKSLAALRYTLYPE         ++ P+RIFILGARAEAQLPGHVWKQ
Sbjct: 198 ALEPRGPITLEGLKSLAALRYTLYPESES--ARAVRSKPMRIFILGARAEAQLPGHVWKQ 255

Query: 250 LQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQD 309
           LQ++FP +N+E+HF+GPE+ YDR ++EYVHSS+P+ +RVD TL  V+HTDY HVFHEAQD
Sbjct: 256 LQYLFPGSNMEIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQD 315

Query: 310 FFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVV 369
           FFPYDPY D+FFCFHPGFA+ E R +WM KT+ ALLETKCA+F TGF+  D+  D   + 
Sbjct: 316 FFPYDPYNDVFFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALR 375

Query: 370 GKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
             H  E+D+LM P  N FGSTKWELNDMNP EVYQFNM+IAGFRGKRYHAI+V
Sbjct: 376 ASHDAEMDVLMHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQV 428

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/428 (62%), Positives = 333/428 (77%), Gaps = 14/428 (3%)

Query: 5   ILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAA 64
           ILS+N + +C  N  KR++MGFVR+ LGL            NRFHPW+ SP  DLRERAA
Sbjct: 11  ILSKNII-ACS-NYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCDDLRERAA 68

Query: 65  TIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRS 124
            I+ +AKCPV+  +INYTCP SGIPTH+SR+ WE D  Y ++   +ILKKVNIYEHDLRS
Sbjct: 69  RIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNIYEHDLRS 128

Query: 125 GRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLH 184
           GRPFPEFDFP +Q++D ++NL NWDL+FYTR F+SMDTEFQLAAVTKMLSYP+TI SVLH
Sbjct: 129 GRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPMTIASVLH 188

Query: 185 QFSPYSLNPKGPVTLEGLKSLAALRYTLY----------PEQNRRVTSITKNSPLRIFIL 234
           QFSPYSL PKGPVTLEGLKSLAALRYTL              +  +T+ +KN P+RIFIL
Sbjct: 189 QFSPYSLTPKGPVTLEGLKSLAALRYTLNNNSLSDTSSGNSDSTTITATSKNRPMRIFIL 248

Query: 235 GARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSF 294
           GARAEAQLP HVWKQLQ++FP +N E+HF+GPES   ++K  YV S++PI +R+D+++S 
Sbjct: 249 GARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPITKRIDDSMSL 308

Query: 295 VYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTT 354
           VYHTDYFHV+H+AQDF+PYDPY DIFF FHPG AA  ++E W+ +TM+ LL++KC +F T
Sbjct: 309 VYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAA--TKETWLNETMQGLLDSKCPIFMT 366

Query: 355 GFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRG 414
           GF+E D+  D+  +     K++D+LM+PV N FGSTKWELND NPQEVYQFNM+IAG+RG
Sbjct: 367 GFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQFNMYIAGYRG 426

Query: 415 KRYHAIEV 422
           KRYHA E 
Sbjct: 427 KRYHATET 434

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/419 (64%), Positives = 327/419 (78%), Gaps = 2/419 (0%)

Query: 5   ILSRNTVRSCQHNVQKRHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAA 64
           + +R  ++  Q  V  R ++GFVRNALGL            NRF+PWDQSPSP+LRERAA
Sbjct: 9   VYARGRLQHLQRRVLSRTLVGFVRNALGLEPPPTPDEPRVSNRFYPWDQSPSPELRERAA 68

Query: 65  TIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRS 124
            I+A+A+CP+TG+EINYTCP SGIPTH+SREAWE D  Y ++K P+ILKKVNIYEHDLRS
Sbjct: 69  KIKAMARCPITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIPDILKKVNIYEHDLRS 128

Query: 125 GRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLH 184
           GR FPEFDFP DQ FDR VNL NWDL+FYTR FYSMDTEFQLA VTKMLSYP+TI SVLH
Sbjct: 129 GRSFPEFDFPSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATVTKMLSYPITIASVLH 188

Query: 185 QFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSI-TKNSPLRIFILGARAEAQLP 243
           Q+SPYSL P GP+TLEGLKS+AALRY+LYP Q++   S+  K  P+RIFILGARAE+QLP
Sbjct: 189 QYSPYSLYPHGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRPMRIFILGARAESQLP 248

Query: 244 GHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHV 303
           GHVWKQ Q++FP    E+ F+GPE    R     V  ++ IV+R+D+T+S VYH   FH 
Sbjct: 249 GHVWKQFQYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRIDDTISLVYHPKLFHD 307

Query: 304 FHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRR 363
            H+AQDFFPYDPY D+FF FHPGFA+PE++E WM  T++ALL+TKCAVF TGF++ DL  
Sbjct: 308 IHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTKCAVFHTGFSKKDLSN 367

Query: 364 DVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           DV  +   +G +LD LM PV N FGSTKWELND+NPQEVYQFNM+I+ FRGKRYH IE+
Sbjct: 368 DVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMYISAFRGKRYHPIEI 426

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/402 (65%), Positives = 320/402 (79%), Gaps = 4/402 (0%)

Query: 21  RHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80
           R ++GFV+NALG+            NRF+PWD+SPSP +RERAA I+A AKCPVTG+EI 
Sbjct: 30  RTLVGFVKNALGIDPPPLPTEPVFANRFYPWDESPSPAIRERAARIKAQAKCPVTGKEIR 89

Query: 81  YTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140
           +TCP SGIPTHYS+EAWEND  Y ++K  E L+KVNIYEHDLRSGRPFPEFDFP +Q  D
Sbjct: 90  FTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKVNIYEHDLRSGRPFPEFDFPGEQARD 149

Query: 141 RMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLE 200
             VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSYP+TIGS+L+++SPY+L PKGPVTLE
Sbjct: 150 STVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSYPITIGSILYKYSPYNLIPKGPVTLE 209

Query: 201 GLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIE 260
           GLKSLAALRYTL         + TK  P+RIFILGARAE+QLP H+WKQLQF+FP    E
Sbjct: 210 GLKSLAALRYTL----RNNAFATTKTRPMRIFILGARAESQLPIHIWKQLQFLFPAQAFE 265

Query: 261 LHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIF 320
           ++F+GPE         Y+ S S IV+RVDE+L+  Y+ DYF  FH+AQDFFPYDPY DIF
Sbjct: 266 INFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLAYYPDYFDKFHKAQDFFPYDPYNDIF 325

Query: 321 FCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLM 380
           F FHPGFA+PES + WMG TM+ALL+TKCA+FTTGF++ D+ +D+ +V   +G+E+DMLM
Sbjct: 326 FTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTGFSQDDIMKDITSVQDTYGEEVDMLM 385

Query: 381 EPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
            P+ N FGSTKWELND+NPQ+VYQFNM+IAGFRGKRYH ++ 
Sbjct: 386 NPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGKRYHTVKA 427

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/439 (60%), Positives = 332/439 (75%), Gaps = 26/439 (5%)

Query: 1   MQRCILSRNTVRSCQHNVQK---RHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSP 57
           +Q C +S       ++N QK   RH +GFV+NALG+            NRFHPWDQSPSP
Sbjct: 21  LQECSISY-----FKNNYQKFSNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSP 75

Query: 58  DLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNI 117
           DLRERAA IRALAKCPVTG+EINYTCP SGIPTH+S+EAWEND  Y Q+K  +ILKKVN+
Sbjct: 76  DLRERAARIRALAKCPVTGKEINYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNV 135

Query: 118 YEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPV 177
           +EHDLRSGR FPEF+FP  QD D  V++ NWD+FFYTR F SMD+EFQLA VTKMLSYP+
Sbjct: 136 FEHDLRSGRSFPEFEFPQSQDHDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPI 195

Query: 178 TIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGAR 237
           TI S+LH++ PY+L P GP+TLEGLKS+AAL+Y+L    N   T  TK  P+RIFILGAR
Sbjct: 196 TIASILHKYCPYALEPNGPITLEGLKSIAALKYSL--RHNEFET--TKERPMRIFILGAR 251

Query: 238 AEAQLPGHVWKQLQFMFPETNIELHFVGPES----YYDRNKREYVHSSSP---------- 283
           AE+QLP H+WKQ  ++FP  N E++F+GPE       +    E  ++++           
Sbjct: 252 AESQLPEHIWKQFSYLFPFQNFEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNR 311

Query: 284 IVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEA 343
           IV+R+DE L+ VYHTD+FH  H A+DFFPYD Y D+FF FHPGFA+PE+ ++WMG+TM+A
Sbjct: 312 IVKRIDERLNLVYHTDFFHTLHNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKA 371

Query: 344 LLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVY 403
           LL+TKCA+FTTGFN+ DL +D+  V   +GKE+DMLM+P  N FGSTKWELNDM+PQEVY
Sbjct: 372 LLDTKCAIFTTGFNKQDLLKDIDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVY 431

Query: 404 QFNMFIAGFRGKRYHAIEV 422
           Q+NM+IAGFRGKRYHA++V
Sbjct: 432 QYNMYIAGFRGKRYHAVKV 450

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/402 (63%), Positives = 316/402 (78%), Gaps = 6/402 (1%)

Query: 21  RHIMGFVRNALGLXXXXXXXXXXXXNRFHPWDQSPSPDLRERAATIRALAKCPVTGREIN 80
           R IMG+VRNA GL            NRFHPW++SP  DLR+RAA I+ LA+CPVTG+ IN
Sbjct: 29  RTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEESPCADLRDRAARIKTLARCPVTGKNIN 88

Query: 81  YTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFD 140
           YTCP SGIPTH+SR+AWE+D +Y ++K  E LKKVNIYEHDLRSGR FPEFDFP +Q  D
Sbjct: 89  YTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKKVNIYEHDLRSGRSFPEFDFPAEQGRD 148

Query: 141 RMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLE 200
           R VNL NWDLF YTR FYSMDTEF LA VTKMLSYP+TI SVLH+FSPY L P+GPVTLE
Sbjct: 149 RAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLSYPITIASVLHEFSPYKLQPRGPVTLE 208

Query: 201 GLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIE 260
           GLKS+AALRYTLYP+  +  TS++ NSP+RIFI+G RAE+QLPGHVWKQLQ++F E   E
Sbjct: 209 GLKSIAALRYTLYPKLGK--TSLSNNSPMRIFIVGTRAESQLPGHVWKQLQYLFSERIFE 266

Query: 261 LHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIF 320
           +HF+GPE       +E  ++S+P++++VD+TLS +YH  YFH  H++ D FPY+PY D+F
Sbjct: 267 IHFIGPEC----QLKEPKNTSTPLIKKVDDTLSLIYHPQYFHELHKSGDLFPYNPYKDVF 322

Query: 321 FCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLM 380
           F FHPGFA P++R+ W+ +T+  LLETKCA+F TGFNE D+  DV  +   +  E+D+LM
Sbjct: 323 FIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHTGFNEGDITNDVTLIDKCYRNEIDVLM 382

Query: 381 EPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIEV 422
           +P+ N FGS KWELND+NPQEVYQFNM+IAGFRGKRYH I++
Sbjct: 383 KPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRGKRYHPIKI 424

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 199 LEGLKSLAALRYTLYPEQ-NRRVTSI----TKNSPLRIFILGARAEAQLPGHVWKQLQFM 253
           +E L S+    YT+  E  ++RVTSI     ++SP+ +   G    + L   + +QL+  
Sbjct: 217 METLDSMKEKLYTVLNESVSKRVTSIHPLHIESSPISVLFSGGLDCSVLVALICEQLRIF 276

Query: 254 FPETNIELHFVGPES 268
            P T +EL  VG E+
Sbjct: 277 NPNTTVELLTVGFEN 291

>KLTH0G11418g Chr7 (962267..964960) [2694 bp, 897 aa] {ON} similar
           to uniprot|P89102 Saccharomyces cerevisiae YDR166C SEC5
           Essential 107kDa subunit of the exocyst complex (Sec3p
           Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and Exo84p) which
           has the essential function of mediating polarized
           targeting of secretory vesicles to active sites of
           exocytosis
          Length = 897

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 66/142 (46%), Gaps = 15/142 (10%)

Query: 169 VTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRV-----TSI 223
           V +++S    + S+L + +    NP+ P T+  L +L  ++ +++P+  R       T +
Sbjct: 661 VQQIVSMEAVLESILKEAAKEKENPRNPRTILTLTNLQYIKGSVFPQVLRYFDESFETQL 720

Query: 224 TKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSP 283
           ++ + L IF L A+ E  + G+    L+       + L  +  E +Y+ N   Y  +S  
Sbjct: 721 SRKN-LEIFTLLAKMETSILGNYLSDLK-------VTLRDILEERFYEINWAAYNSNSFR 772

Query: 284 IVRRVDETLSFV--YHTDYFHV 303
           +   + E L  +   H++ F +
Sbjct: 773 VGDYIIEALMVLVRVHSECFKI 794

>Suva_6.126 Chr6 complement(209913..212375) [2463 bp, 820 aa] {ON}
           YJL051W (REAL)
          Length = 820

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 10/72 (13%)

Query: 88  IPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTN 147
           +P H + E WE D E        IL+KV     +L   +  P F F    D DR  + T 
Sbjct: 455 LPAHVTLEMWEKDQE-------NILRKVTT---NLADSKLLPPFRFTSKSDIDRNSSPTE 504

Query: 148 WDLFFYTRGFYS 159
            ++  +T+  +S
Sbjct: 505 LEVELHTQNNFS 516

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 53  QSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQ-SKRPEI 111
           ++P  D +E + T  + +  PV GREI    P   I   + +  WE+     +   RP  
Sbjct: 206 ETPVMDAKENSKTSHSSSIPPVVGREIKIILPPKPIALEFVKNTWEHCCVLLRFYHRPTF 265

Query: 112 LKKVN-IYEHD 121
           +K+++ +YE D
Sbjct: 266 IKQMDELYETD 276

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/166 (19%), Positives = 70/166 (42%), Gaps = 20/166 (12%)

Query: 114 KVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKML 173
           K+ + ++ +  GR FP+   P++Q     V++ ++   F  +GF + + EFQ A     +
Sbjct: 84  KLQLSKYKMLFGRLFPQMP-PIEQ-----VDVASFANAF--QGFVASNEEFQNATKNSHV 135

Query: 174 SYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFI 233
           + PV+  S     +  S  P+G V   G+ ++  +  ++   + R +  I    P+ +  
Sbjct: 136 TVPVSSASGAGSPATASATPEGSV---GVDAIEGIDGSIQSHEGREIKIILPPKPVALHF 192

Query: 234 LGARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVH 279
           +            W+Q   +F   +        +  Y+ +  +Y H
Sbjct: 193 IQV---------TWEQCCVLFRFYHRPSFIASLDELYETDPHDYTH 229

>Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa]
           {ON} YIR023W (REAL)
          Length = 971

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 9/57 (15%)

Query: 263 FVGPESYYDRNKREYVH---------SSSPIVRRVDETLSFVYHTDYFHVFHEAQDF 310
           FVGP S +D N  ++V          S +  +R+V  T  F+   D+    H  Q++
Sbjct: 246 FVGPTSVFDLNLTKHVRLDNVDQIQLSKTLSLRKVSPTAQFILQDDFDSALHSKQEY 302

>Smik_9.227 Chr9 (373211..376084) [2874 bp, 957 aa] {ON} YIR023W
           (REAL)
          Length = 957

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 9/57 (15%)

Query: 263 FVGPESYYDRNKREYVH---------SSSPIVRRVDETLSFVYHTDYFHVFHEAQDF 310
           FVGP S +D N  ++V          S +  +R+V  T  F+   D+    H  Q++
Sbjct: 232 FVGPASVFDLNLTKHVRLDNVDQIQLSKTLSLRKVSPTAQFILQDDFDTTLHSKQEY 288

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,944,265
Number of extensions: 2021463
Number of successful extensions: 4001
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4050
Number of HSP's successfully gapped: 31
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)