Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01320g7.347ON19019010141e-142
Kwal_56.246347.347ON1901909741e-136
SAKL0F11308g7.347ON1911908221e-113
ZYRO0F11638g7.347ON1911927921e-108
TDEL0C020107.347ON1911927801e-106
Suva_4.817.347ON1911927771e-106
YDL165W (CDC36)7.347ON1911927761e-106
Smik_4.737.347ON1911927761e-106
Skud_4.927.347ON1911927761e-106
Kpol_530.347.347ON1911927751e-106
NDAI0A019207.347ON1931947631e-104
TPHA0F029407.347ON1911927581e-103
CAGL0I03388g7.347ON1911927561e-103
KAFR0B008507.347ON1921937521e-102
KNAG0C037607.347ON1911927421e-100
NCAS0A141307.347ON1911927314e-99
KLLA0D12408g7.347ON1841906983e-94
TBLA0E005107.347ON2871687051e-93
Ecym_47267.347ON1911966923e-93
ACL151C7.347ON2081966873e-92
ZYRO0C16588g3.370ON608831101e-05
Smik_16.3163.370ON560831091e-05
YPR072W (NOT5)3.370ON560821091e-05
SAKL0B08052g3.370ON576901091e-05
KAFR0H008603.370ON578891082e-05
CAGL0D01342g3.370ON548891082e-05
Kwal_23.39623.370ON553851072e-05
Skud_16.3613.370ON560821073e-05
Suva_16.4013.370ON565821063e-05
NDAI0A050803.370ON575881054e-05
KLTH0F11880g3.370ON563851036e-05
Kpol_1006.73.370ON540841011e-04
TPHA0A035003.370ON548821011e-04
KNAG0A072903.370ON50786974e-04
TBLA0H014903.370ON55281920.002
KLLA0B09196g3.370ON59076920.002
Ecym_34563.370ON50885920.002
ADL364C3.370ON50486910.002
TDEL0C051203.370ON56283880.006
KLTH0A03652g7.214ON77238780.11
TDEL0H023307.214ON812112760.25
NCAS0A112103.370ON582100730.54
KNAG0G024908.328ON60298710.94
Kpol_1070.257.214ON68682691.5
ZYRO0D16302g7.214ON829116691.9
Smik_1.197.25ON17075653.4
KLLA0E04335g7.214ON75836664.4
YAL044C (GCV3)7.25ON17075644.6
Kpol_397.18.571ON64742654.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01320g
         (190 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   395   e-142
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   379   e-136
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   321   e-113
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   309   e-108
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   305   e-106
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   303   e-106
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   303   e-106
Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   303   e-106
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   303   e-106
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   303   e-106
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   298   e-104
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   296   e-103
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   295   e-103
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   294   e-102
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   290   e-100
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   286   4e-99
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   273   3e-94
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   276   1e-93
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   271   3e-93
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   269   3e-92
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    47   1e-05
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    47   1e-05
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    47   1e-05
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    47   1e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    46   2e-05
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    46   2e-05
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    46   2e-05
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    46   3e-05
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    45   3e-05
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    45   4e-05
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   6e-05
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    44   1e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    44   1e-04
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    42   4e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    40   0.002
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    40   0.002
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    40   0.002
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    40   0.002
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    39   0.006
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    35   0.11 
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    34   0.25 
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    33   0.54 
KNAG0G02490 Chr7 (565893..567701) [1809 bp, 602 aa] {ON} Anc_8.3...    32   0.94 
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    31   1.5  
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    31   1.9  
Smik_1.19 Chr1 complement(40912..41424) [513 bp, 170 aa] {ON} YA...    30   3.4  
KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} simila...    30   4.4  
YAL044C Chr1 complement(57950..58462) [513 bp, 170 aa] {ON}  GCV...    29   4.6  
Kpol_397.1 s397 (565..2508) [1944 bp, 647 aa] {ON} (565..2508) [...    30   4.7  

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  395 bits (1014), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 190/190 (100%), Positives = 190/190 (100%)

Query: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60
           MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV
Sbjct: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60

Query: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120
           ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG
Sbjct: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120

Query: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180
           SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR
Sbjct: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180

Query: 181 DFVLFYNAIM 190
           DFVLFYNAIM
Sbjct: 181 DFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  379 bits (974), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 181/190 (95%), Positives = 187/190 (98%)

Query: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60
           MEKYGLSALLPLIRREDQSP+YDSSMTLGIDLSPVLHSLGI +NQ +R RVLDTFQSPWV
Sbjct: 1   MEKYGLSALLPLIRREDQSPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSPWV 60

Query: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120
           ETSRSEVEPKFFVPESFKNIPNVLQ+G++PPAFNSVQQDHAKISLFQDETLFYLFYKHPG
Sbjct: 61  ETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120

Query: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180
           SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR
Sbjct: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180

Query: 181 DFVLFYNAIM 190
           DFVLFYNAIM
Sbjct: 181 DFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  321 bits (822), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 170/190 (89%), Gaps = 1/190 (0%)

Query: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60
           +EKYGL ALLPLI++E  + +YD +MT+G+DLS +LHSLGI +NQ  + RVLDTF SPWV
Sbjct: 3   VEKYGLKALLPLIKQETGNAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSPWV 62

Query: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120
           ETSRSEVEPKFF PESF NIPNVLQS   PP+FNSVQQDH KI+LFQDETLFYLFYKHPG
Sbjct: 63  ETSRSEVEPKFFTPESFVNIPNVLQSPS-PPSFNSVQQDHPKIALFQDETLFYLFYKHPG 121

Query: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180
           +VVQE+TYLELRKRNWRYHKTLKVWLTKDPMMEPVV+  G SERGSYVFFDPQRWEKCQR
Sbjct: 122 TVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKCQR 181

Query: 181 DFVLFYNAIM 190
           DFVLFYNAIM
Sbjct: 182 DFVLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  309 bits (792), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 166/192 (86%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL AL+PL+++ED+  S  YD SMTLG DLS +LHSLGIP +   R++VLDTFQSP
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDS-KRHKVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP+FF+PESF NIPNVL S   PP FNSVQQD  +++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  305 bits (780), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 164/192 (85%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQSPD--YDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           MEK+GL AL+PLI++E++     YD S+TLG DLS +LHSLGIP +   R+RVLDTFQSP
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDS-KRHRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEPKFF+P+SF NIP VLQS   PP FNSVQ D  +++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QR+F+LFYNAIM
Sbjct: 180 QREFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  303 bits (777), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 142/192 (73%), Positives = 165/192 (85%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL AL+PL+++ED+  S  YD SMTLG DLS +L+SLGIP +    +RVLDTFQSP
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQD-HRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP+FF PESF NIP+VLQS   PP FNS+Q D  +++LFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  303 bits (776), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 163/192 (84%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           MEK+GL AL+PL++ ED+  S  YD SMTLG DLS +L+SLGIP +    +RVLDTFQSP
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQD-HRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP+FF PESF NIP VLQS   PP FNS+Q D  +++LFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  303 bits (776), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 163/192 (84%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           MEK+GL AL+PL++ ED+  S  YD SMTLG DLS +L+SLGIP +    +RVLDTFQSP
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQD-HRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP+FF PESF NIP VLQS   PP FNS+Q D  +++LFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  303 bits (776), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 163/192 (84%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           MEK+GL AL+PL++ ED+  S  YD SMTLG DLS +L+SLGIP +    +RVLDTFQSP
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQD-HRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP+FF PESF NIP VLQS   PP FNS+Q D  +++LFQDETLF+LFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  303 bits (775), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 141/192 (73%), Positives = 165/192 (85%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL ALLPLI+++D   S  Y+ +MT+G DLS +LHSLGIP +   R R+LDTFQSP
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDN-QRYRILDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP+FF PESFKNIPNVLQS   PP FNS++ D  +++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPM+EP+V+  G SERGSY+FFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QR+FVLFYNAIM
Sbjct: 180 QREFVLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  298 bits (763), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 168/194 (86%), Gaps = 5/194 (2%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL AL+PLI+ +D+  S  YD SMTLG DL+ +LHSLGIP +   R+RVLDTFQSP
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDS-KRHRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGER--PPAFNSVQQDHAKISLFQDETLFYLFY 116
           W ETSRSEVEP FF+P+SF +IP+VLQS  +  PP+F+SVQ+D  +++LFQDETLFYLFY
Sbjct: 60  WAETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFY 119

Query: 117 KHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWE 176
           KHPG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEPVV+  G SERGSYVFFDPQRWE
Sbjct: 120 KHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWE 179

Query: 177 KCQRDFVLFYNAIM 190
           KCQR+F+LFYNAIM
Sbjct: 180 KCQREFLLFYNAIM 193

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  296 bits (758), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 161/192 (83%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL ALLPLI+++D   S  Y+ +MT+G DL+ + HSLGIPNN   R RVLDTFQSP
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNN-KRYRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP++F P+SF NIP VLQS + P  FNSV+ D  +ISLFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHK LK WLTKDP++EP+V   G SERGSY+FFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDFVLFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  295 bits (756), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/192 (72%), Positives = 160/192 (83%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQSPD--YDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M K+GL  L+PLIR +++     YD SMT+G DLS +LHSLGIP +    +RVLDTFQSP
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDS-KHHRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEPK+++PESFKNIP+VLQS   PP F+ VQ D  +++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHK LK WLTKDPMMEPVVA  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF LFY+AIM
Sbjct: 180 QRDFPLFYSAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  294 bits (752), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 137/193 (70%), Positives = 164/193 (84%), Gaps = 4/193 (2%)

Query: 1   MEKYGLSALLPLIRRE---DQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQS 57
           M+K+GL AL+PLI+++   +++  YD SMTLG DLS +L+SLGIP ++   +RVLDTFQS
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDK-QHHRVLDTFQS 59

Query: 58  PWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYK 117
           PW ETSRSEVEPKF +P+SF NI NVLQS   PP F+S+Q D  +++LFQDETLFYLFYK
Sbjct: 60  PWAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYK 119

Query: 118 HPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEK 177
           HP +V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SE+GSYVFFDPQRWEK
Sbjct: 120 HPATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEK 179

Query: 178 CQRDFVLFYNAIM 190
           CQRDF+LFYNAIM
Sbjct: 180 CQRDFLLFYNAIM 192

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  290 bits (742), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 138/192 (71%), Positives = 157/192 (81%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRRED--QSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL AL+PL+R+ D   +  YD SM LG DLS +LHSLGIP +   R  VL TFQSP
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDS-KRQAVLATFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP F++P SF  I  VLQS   PP F+SVQ+D  +++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDP MEPVV+P G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           QRDF+LFYNAIM
Sbjct: 180 QRDFLLFYNAIM 191

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  286 bits (731), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 160/192 (83%), Gaps = 3/192 (1%)

Query: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58
           M+K+GL AL+PL+R++D+  S  YD SMTLG DLS ++HSLGIP +  +R+RVLDTFQSP
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDN-TRHRVLDTFQSP 59

Query: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           W ETSRSEVEP FF+P+SF  I  VLQS   PP F+S Q D  +++LFQDETLFYLFYKH
Sbjct: 60  WAETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKH 119

Query: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178
           PG+V+QELTYLELR RNWRYH TL+ WLTKDP+MEP V+  G SERGSYVFFDPQRWEKC
Sbjct: 120 PGTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKC 179

Query: 179 QRDFVLFYNAIM 190
           Q+DF+LFYNAIM
Sbjct: 180 QKDFLLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  273 bits (698), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 153/190 (80%), Gaps = 6/190 (3%)

Query: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWV 60
           MEKYGL  L+P++R +   P YD++MTLGIDL+ +L+SL I  +  S +  LD F+SPWV
Sbjct: 1   MEKYGLKDLVPVLRHD---PTYDANMTLGIDLNSLLNSLDITKDTKSHH-CLDAFESPWV 56

Query: 61  ETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPG 120
           ETSRSEV+P FF+PESFKNI  +L  G     F SV +D  +ISL QDETLFYLFYKHPG
Sbjct: 57  ETSRSEVQPTFFIPESFKNIKGML--GTDQVEFTSVNRDQPRISLLQDETLFYLFYKHPG 114

Query: 121 SVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR 180
           SV+QELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVA    SERGSYVFFDPQRWEKCQR
Sbjct: 115 SVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQR 174

Query: 181 DFVLFYNAIM 190
           DFVL YNAIM
Sbjct: 175 DFVLHYNAIM 184

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  276 bits (705), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 122/168 (72%), Positives = 144/168 (85%), Gaps = 1/168 (0%)

Query: 23  DSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWVETSRSEVEPKFFVPESFKNIPN 82
           D S+T+G DLS +LHSLG+P +   R+R+LDTFQSPW ETSRSEV+P+FF+P SF NI N
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDN-KRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISN 179

Query: 83  VLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTL 142
           VLQ    PP FN+++ D  +++LFQDETLFYLFYKHPG+V+QELTYLELRKRNWR+HK L
Sbjct: 180 VLQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKIL 239

Query: 143 KVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQRDFVLFYNAIM 190
           K WLTKDPMMEP+VA  G SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 240 KTWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  271 bits (692), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 135/196 (68%), Positives = 153/196 (78%), Gaps = 11/196 (5%)

Query: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQP------SRNRVLDT 54
           M KYGL +LLP+I+ + Q   YDSSMTLG DL  +LHSL +           + +  LDT
Sbjct: 1   MSKYGLKSLLPVIKHDKQ---YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTLDT 57

Query: 55  FQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYL 114
           F SPWVETSRSEVEPKFF+PESFKNI  VL  G+    F SV +DH +ISL QDETLFYL
Sbjct: 58  FPSPWVETSRSEVEPKFFIPESFKNIVGVL--GQPSTYFTSVARDHPRISLLQDETLFYL 115

Query: 115 FYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQR 174
           FYKHPG+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+    SERGSYVFFDPQR
Sbjct: 116 FYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR 175

Query: 175 WEKCQRDFVLFYNAIM 190
           WEKCQRDF+L YNAIM
Sbjct: 176 WEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  269 bits (687), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 154/196 (78%), Gaps = 11/196 (5%)

Query: 1   MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQ------PSRNRVLDT 54
           M+KYGL  LLP+I+ E Q   YD+ MTLG+D+S +LHSL + +         + +  LDT
Sbjct: 18  MDKYGLKGLLPVIKHEKQ---YDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHALDT 74

Query: 55  FQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYL 114
           F SPWVETSRSEVEPKFF+PESF NI  VL  G+    F SV +DH +ISL QDETLFYL
Sbjct: 75  FPSPWVETSRSEVEPKFFIPESFCNIGGVL--GQASTDFTSVARDHPRISLLQDETLFYL 132

Query: 115 FYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQR 174
           FYKHPG+V+QELTYLELRKRNWRYHKTLKVWLTKDP+MEP+V+    SERGSYVFFDPQR
Sbjct: 133 FYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDPQR 192

Query: 175 WEKCQRDFVLFYNAIM 190
           WEKCQRDF+L Y+AIM
Sbjct: 193 WEKCQRDFILNYSAIM 208

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 8/83 (9%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPGGA-SE 163
           F  +TLF++FY + G+  Q L   EL K R W+++K  + W  K+    P   PG A SE
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKEVEKLP---PGMAQSE 575

Query: 164 RGSYVFFDPQR-W--EKCQRDFV 183
             S+ +FD QR W   +C  DF+
Sbjct: 576 EESWRYFDYQRSWLARRCNSDFI 598

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 46/83 (55%), Gaps = 8/83 (9%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPG-GASE 163
           F  +TLF++FY + GS  Q L   EL K RNW ++K  + W  K+    P   PG G SE
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKEIEKLP---PGMGKSE 528

Query: 164 RGSYVFFDPQR-W--EKCQRDFV 183
             S+ +FD ++ W   +C  DFV
Sbjct: 529 EESWRYFDYKKSWLARRCGNDFV 551

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLEL-RKRNWRYHKTLKVWLTKDPMMEPVVAPGGASER 164
           F  +TLF++FY + GS  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 165 GSYVFFDPQR-W--EKCQRDFV 183
            S+ +FD ++ W   +C  DFV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 49/90 (54%), Gaps = 7/90 (7%)

Query: 101 AKI-SLFQDETLFYLFYKHPGSVVQELTYLEL-RKRNWRYHKTLKVWLTKDPMMEP--VV 156
           AKI S F  +TLF++FY + G+  Q L   EL + RNW+++K    W  K+    P  VV
Sbjct: 478 AKITSKFDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVV 537

Query: 157 APGGASERGSYVFFDPQR-W--EKCQRDFV 183
           +     E  S+ +FD Q+ W   +C  DFV
Sbjct: 538 SSENKQEEISWRYFDYQKSWLARRCGSDFV 567

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 9/89 (10%)

Query: 101 AKI-SLFQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAP 158
           AKI + F  +TLF++FY + G+  Q L+  EL K RNW+++K  + W  K+    P   P
Sbjct: 484 AKIFTKFDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKEIEKLP---P 540

Query: 159 G-GASERGSYVFFDPQR-W--EKCQRDFV 183
           G   SE  S+ +FD ++ W   +C  DFV
Sbjct: 541 GMNKSEEESWRYFDYKKSWLARRCSPDFV 569

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 9/89 (10%)

Query: 101 AKI-SLFQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAP 158
           AKI ++F  +TLF++FY + G+  Q L   EL K RNW+++K  + W  K+    P   P
Sbjct: 454 AKIFNMFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKEIEKLP---P 510

Query: 159 G-GASERGSYVFFD-PQRW--EKCQRDFV 183
           G   SE  S+ +FD  + W   +C  DFV
Sbjct: 511 GMTKSEEESWRYFDFKKSWLSRRCGSDFV 539

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 46/85 (54%), Gaps = 7/85 (8%)

Query: 103 ISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPG-GA 161
           +S F  +TLF++FY + G+  Q L   EL  R W+++K  + W  K+    P   PG   
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKEVEKLP---PGMEQ 519

Query: 162 SERGSYVFFDPQR-W--EKCQRDFV 183
           SE  S+ +FD Q+ W   +C  DFV
Sbjct: 520 SEEISWRYFDYQKSWLARRCGTDFV 544

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPGGASER 164
           F  +TLF++FY + GS  Q L   EL K RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 165 GSYVFFDPQR-W--EKCQRDFV 183
            S+ +FD ++ W   +C  DFV
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPGGASER 164
           F  +TLF++FY + GS  Q L   EL K RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 165 GSYVFFDPQR-W--EKCQRDFV 183
            S+ +FD ++ W   +C  DFV
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 101 AKI-SLFQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAP 158
           AKI + F  +TLF++FY + G+  Q L   EL K R+W+Y+K    W  K+    P  A 
Sbjct: 479 AKIYTKFDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGAN 538

Query: 159 GGASERGSYVFFDPQR-W--EKCQRDFV 183
               E  S+ +FD ++ W   +C  DFV
Sbjct: 539 YNKDEEESWRYFDYKKSWLSRRCGNDFV 566

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 47/85 (55%), Gaps = 7/85 (8%)

Query: 103 ISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPG-GA 161
           +S F  +TLF++FY + G+  Q L+  EL  R W+++K  + W  K+    P   PG   
Sbjct: 473 MSKFDLDTLFFIFYHYQGTYEQFLSARELSIRGWQFNKVNRCWFYKEVEKLP---PGMEQ 529

Query: 162 SERGSYVFFDPQR-W--EKCQRDFV 183
           SE  S+ +FD Q+ W   +C  +FV
Sbjct: 530 SEEISWRYFDYQKSWLARRCGAEFV 554

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 8/84 (9%)

Query: 104 SLFQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPG-GA 161
           S F  +TLF++FY + G+  Q L   EL K RNW+++K  + W  K+    P   PG   
Sbjct: 450 SKFDLDTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSP---PGMQQ 506

Query: 162 SERGSYVFFDPQR-W--EKCQRDF 182
           +E  ++ +FD Q  W   +C  DF
Sbjct: 507 AEEETWRYFDYQNSWLARRCNSDF 530

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 44/82 (53%), Gaps = 8/82 (9%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPGGA-SE 163
           F  +TLF++FY + G+  Q L   EL K RNW+Y+K  + W  K+       AP  A +E
Sbjct: 460 FDLDTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFKEVTK---SAPDMAQTE 516

Query: 164 RGSYVFFDPQR-W--EKCQRDF 182
             ++ +FD Q  W   +C  DF
Sbjct: 517 EETWRYFDYQNSWLARRCNHDF 538

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 47/86 (54%), Gaps = 8/86 (9%)

Query: 103 ISLFQDETLFYLFYKHPGSVVQELTYLELR-KRNWRYHKTLKVWLTKDPMMEPVVAPG-G 160
           ++ F  +TLF++FY + G+  Q L   EL   R+W+++K  + W  K+    P   PG  
Sbjct: 416 LTKFDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKEIEKLP---PGMN 472

Query: 161 ASERGSYVFFDPQR-W--EKCQRDFV 183
            SE  S+ +FD ++ W   +C  DFV
Sbjct: 473 KSEEESWRYFDYKKSWLARRCNSDFV 498

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 6/81 (7%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPGGASER 164
           F  +TLF++FY + G+  Q L+  EL K RNW ++K  + W  ++    P   P   SE 
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYREVEKLPPGLP--QSEE 520

Query: 165 GSYVFFDPQR-W--EKCQRDF 182
            S+ +FD Q+ W   +C  +F
Sbjct: 521 ISWRYFDYQKSWLSRRCNSNF 541

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 5/76 (6%)

Query: 101 AKI-SLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPG 159
           AKI S F  +TLF++FY + GS  Q L   EL  R W ++K  + W  K+    P   PG
Sbjct: 496 AKIMSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKEVEKLP---PG 552

Query: 160 -GASERGSYVFFDPQR 174
               E  ++ +FD Q+
Sbjct: 553 IEGKEEVTWRYFDYQK 568

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 103 ISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPG-GA 161
           ++ F  +TLF++FY + G+  Q L   EL  R W +++  + W  ++    P   PG   
Sbjct: 418 LTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYREVEKLP---PGMEQ 474

Query: 162 SERGSYVFFDPQR-W--EKCQRDFV 183
            E  S+ +FD Q+ W   +C  DFV
Sbjct: 475 KEEVSWRYFDYQKSWLARRCGPDFV 499

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 103 ISLFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPG-GA 161
           ++ F  +TLF++FY + G+  Q L   EL  R W +++  + W  K+    P   PG   
Sbjct: 414 MTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKEVEKLP---PGMDQ 470

Query: 162 SERGSYVFFDPQR-W--EKCQRDFVL 184
            E  S+ +FD Q+ W   +C  DFV 
Sbjct: 471 KEEVSWRYFDYQKSWLARRCGPDFVF 496

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 106 FQDETLFYLFYKHPGSVVQELTYLELRK-RNWRYHKTLKVWLTKDPMMEPVVAPGG-ASE 163
           F  +TLF++FY + G+  Q L   EL K R W+++K  + W  K+    P   PG   +E
Sbjct: 473 FDLDTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKEVEKLP---PGMLQAE 529

Query: 164 RGSYVFFDPQ-RW--EKCQRDFV 183
             S+ +FD Q  W   +C  D V
Sbjct: 530 EESWRYFDYQGSWLARRCNNDVV 552

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 111 LFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTK 148
           LFY FY     + QE+ Y  L +RNW+  KT + W ++
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSR 704

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 11/112 (9%)

Query: 82  NVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKHPGSVV---QELTYLELRKRNWRY 138
           +++Q+G+     N  ++  A I  F+   +F LFY +  +V    Q +  L L +RNW+ 
Sbjct: 665 SIIQNGD----LNDDEKYEAIIEKFRSLEMFTLFYNYYFAVTPLEQTIASLVLSERNWKV 720

Query: 139 HKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR-DFVLFYNAI 189
            K+  +W  +    EP  A     E   Y  F    W    + +F L Y A+
Sbjct: 721 SKSGTLWFLR--QGEPKFA-NEVCEVADYKIFKLDDWTVADKPNFKLDYAAL 769

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 17/100 (17%)

Query: 101 AKI-SLFQDETLFYLFYKHPGSVVQELTYLEL-RKRNWRYHKTLKVWLTKD-PMMEPVV- 156
           AKI S F  +TLF++FY + G+  Q L   EL + R+W ++K    W  ++   + P + 
Sbjct: 474 AKIFSKFDLDTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCWYFREIEKLPPTIN 533

Query: 157 ----------APGGASERGSYVFFDPQR-W--EKCQRDFV 183
                         + E  S+ +FD ++ W   +C  DFV
Sbjct: 534 MSNTIPNNKREDSNSDEEESWRYFDYKKSWLARRCGPDFV 573

>KNAG0G02490 Chr7 (565893..567701) [1809 bp, 602 aa] {ON} Anc_8.328
           YDR147W
          Length = 602

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 7/98 (7%)

Query: 27  TLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSPWVETSRSEVEPKFFVPESFKN------I 80
           T G  + P L S+ I +N PS   + ++   P+++ S     P  ++ E   N      I
Sbjct: 89  TDGSSVLPALSSIKISSNGPS-GSIFESIAVPFIKASLDTSLPDDYLREDILNMIQSLKI 147

Query: 81  PNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118
           P   + G   P+ +S + +  KI       +F + Y H
Sbjct: 148 PRWYRRGAAKPSCDSSKMELVKIKGAMTNAIFKISYPH 185

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 42/82 (51%), Gaps = 4/82 (4%)

Query: 110 TLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVF 169
           TLFY +Y     + ++++ + L +R+W+  K   +W  K    EP  +   + E G+Y  
Sbjct: 564 TLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK--QGEPKFS-NESFEVGNYKI 620

Query: 170 FDPQRWEKCQR-DFVLFYNAIM 190
           F    W   ++ +F L +N++M
Sbjct: 621 FKADDWTVIEKFNFKLDFNSLM 642

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 11/116 (9%)

Query: 82  NVLQSGERPPAFNSVQQDHAK----ISLFQDETLFYLFYKHPGSVV---QELTYLELRKR 134
           ++L+   RP   NS   D  K    +  F+   +F LFY +  +V    QE+  + L +R
Sbjct: 677 DILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQEIASIILSER 736

Query: 135 NWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKCQR-DFVLFYNAI 189
           +W+  K   +W  +    E   A     E   Y  F    W    R +F L Y A+
Sbjct: 737 DWKVSKNCAMWFLR--QSETKFA-NELCEVADYKIFKLDDWTVIDRLNFKLDYAAL 789

>Smik_1.19 Chr1 complement(40912..41424) [513 bp, 170 aa] {ON}
           YAL044C (REAL)
          Length = 170

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 62  TSRSEVEPKFFVPESFKNIPN-----VLQSGERPPAFNSVQQDHAKISLFQDETLFYLFY 116
           T+R     K F+  S  N  N      L S + P A     Q H  I++ QD+T F    
Sbjct: 9   TTRIPTAGKLFLRNSSSNALNKNKLPFLYSSQGPQAVRYTTQ-HEWIAVHQDKTAFVGIT 67

Query: 117 KHPGSVVQELTYLEL 131
           K+    + + TY+EL
Sbjct: 68  KYATDALGDATYVEL 82

>KLLA0E04335g Chr5 (391816..394092) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q75AN0 Ashbya gossypii ADL108C ADL108Cp and
           some similarites with YIL038C uniprot|P06102
           Saccharomyces cerevisiae YIL038C NOT3 Subunit of the
           CCR4- NOT complex which is a global transcriptional
           regulator with roles in transcription initiation and
           elongation and in mRNA degradation
          Length = 758

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 110 TLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVW 145
           TLFY +Y     + Q +  L L++R WR  KT   W
Sbjct: 641 TLFYHYYFSVTPLEQRICALLLKQREWRVLKTGDCW 676

>YAL044C Chr1 complement(57950..58462) [513 bp, 170 aa] {ON}  GCV3H
           subunit of the mitochondrial glycine decarboxylase
           complex, required for the catabolism of glycine to
           5,10-methylene-THF; also required for all protein
           lipoylation; expression is regulated by levels of
           5,10-methylene-THF
          Length = 170

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 6/75 (8%)

Query: 62  TSRSEVEPKFFVPESFKNIPN-----VLQSGERPPAFNSVQQDHAKISLFQDETLFYLFY 116
           T+R     K F+  S  N  N      L S + P A     Q H  I++ QD+T F    
Sbjct: 9   TTRMPTVSKLFLRNSSGNALNKNKLPFLYSSQGPQAVRYTSQ-HEWIAVHQDKTAFVGIT 67

Query: 117 KHPGSVVQELTYLEL 131
           K+    + + TY+EL
Sbjct: 68  KYATDALGDATYVEL 82

>Kpol_397.1 s397 (565..2508) [1944 bp, 647 aa] {ON} (565..2508)
           [1944 nt, 648 aa]
          Length = 647

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 41  IPNNQPSRNRVLDTFQSPWVET--SRSEVEPKFFVPESFKNI 80
           I N   S+NR+ +      V    +R ++E K ++PESFKN+
Sbjct: 344 IENKLKSQNRINNVLNKIHVSKPGARDDIERKPYIPESFKNM 385

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,450,794
Number of extensions: 980238
Number of successful extensions: 2441
Number of sequences better than 10.0: 58
Number of HSP's gapped: 2432
Number of HSP's successfully gapped: 58
Length of query: 190
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 87
Effective length of database: 41,670,801
Effective search space: 3625359687
Effective search space used: 3625359687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)