Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01298g7.348ON2142149661e-134
Kwal_56.246357.348ON2261837731e-104
Ecym_47257.348ON2341837421e-99
TDEL0C020007.348ON2131847303e-98
Kpol_530.337.348ON1951837266e-98
TPHA0F029507.348ON2161827287e-98
SAKL0F11330g7.348ON2081837155e-96
KLLA0D12386g7.348ON2111837112e-95
ACL150W7.348ON2191837096e-95
NCAS0A141407.348ON2241817011e-93
KAFR0B008607.348ON2281807011e-93
Smik_4.727.348ON1971826806e-91
NDAI0A019107.348ON2141816801e-90
ZYRO0F11660g7.348ON1981836693e-89
YDL166C (FAP7)7.348ON1971826615e-88
KNAG0C037707.348ON2231816628e-88
CAGL0I03366g7.348ON2121836618e-88
Suva_4.807.348ON2061826573e-87
TBLA0E005207.348ON2091836487e-86
Skud_4.917.348ON1941786424e-85
KLLA0E13201g3.69ON32932790.11
Suva_14.493.69ON34032770.18
TDEL0E007803.69ON33632770.18
YNL290W (RFC3)3.69ON34032770.18
SAKL0C12144g3.69ON32932770.19
KAFR0A082903.69ON33232770.20
Smik_14.413.69ON34032770.20
NDAI0A060603.69ON33832760.21
TBLA0B084503.69ON33332760.23
Kpol_1066.383.69ON33632760.24
NCAS0A098903.69ON33632760.24
Skud_14.473.69ON34032760.25
ZYRO0C02090g3.69ON33839740.41
Kwal_23.52473.69ON32932740.42
Ecym_35343.69ON33229740.44
Kpol_1033.248.295ON491523740.50
KLTH0A01540g3.69ON32832730.51
AEL196W3.69ON33332730.51
KNAG0K023003.69ON33432720.65
CAGL0H09174g1.506ON103133730.74
CAGL0M03575g3.69ON33132720.78
TPHA0P012003.69ON33532710.97
SAKL0H16214g8.295ON492323720.97
Kwal_56.236388.295ON492220711.2
ZYRO0A13310gsingletonOFF51531701.6
Zrou_YGOB_A13310g8.558ON55831701.7
Smik_12.224.23ON83766682.7
AGR074C8.295ON489920682.8
KLTH0G12892g8.295ON492822682.8
Suva_10.384.23ON83766683.0
TBLA0B019501.517ON35037673.6
NDAI0D048904.23ON87033674.0
NCAS0A029404.23ON85733674.2
NCAS0C020208.558ON56241655.8
KAFR0H028408.618ON20780646.4
NDAI0D030504.327ON89742657.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01298g
         (214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   376   e-134
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   302   e-104
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   290   1e-99
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   285   3e-98
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   284   6e-98
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   285   7e-98
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   280   5e-96
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   278   2e-95
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   277   6e-95
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   274   1e-93
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   274   1e-93
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   266   6e-91
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   266   1e-90
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   262   3e-89
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   259   5e-88
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   259   8e-88
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   259   8e-88
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   257   3e-87
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   254   7e-86
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   251   4e-85
KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highl...    35   0.11 
Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W (...    34   0.18 
TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.6...    34   0.18 
YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit...    34   0.18 
SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa] ...    34   0.19 
KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa] {...    34   0.20 
Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W (...    34   0.20 
NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa] ...    34   0.21 
TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa] ...    34   0.23 
Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa] {O...    34   0.24 
NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa] ...    34   0.24 
Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W (...    34   0.25 
ZYRO0C02090g Chr3 complement(165011..166027) [1017 bp, 338 aa] {...    33   0.41 
Kwal_23.5247 s23 complement(1073605..1074594) [990 bp, 329 aa] {...    33   0.42 
Ecym_3534 Chr3 (1013065..1014063) [999 bp, 332 aa] {ON} similar ...    33   0.44 
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    33   0.50 
KLTH0A01540g Chr1 (137284..138270) [987 bp, 328 aa] {ON} highly ...    33   0.51 
AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic ho...    33   0.51 
KNAG0K02300 Chr11 complement(459360..460364) [1005 bp, 334 aa] {...    32   0.65 
CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa] ...    33   0.74 
CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa] {...    32   0.78 
TPHA0P01200 Chr16 complement(242758..243765) [1008 bp, 335 aa] {...    32   0.97 
SAKL0H16214g Chr8 (1413429..1428200) [14772 bp, 4923 aa] {ON} si...    32   0.97 
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    32   1.2  
ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]...    32   1.6  
Zrou_YGOB_A13310g Chr1 complement(1049931..1050068,1050140..1051...    32   1.7  
Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}...    31   2.7  
AGR074C Chr7 complement(854312..869011) [14700 bp, 4899 aa] {ON}...    31   2.8  
KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} si...    31   2.8  
Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}...    31   3.0  
TBLA0B01950 Chr2 complement(449277..450329) [1053 bp, 350 aa] {O...    30   3.6  
NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON} Anc_7...    30   4.0  
NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23      30   4.2  
NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 a...    30   5.8  
KAFR0H02840 Chr8 (541137..541760) [624 bp, 207 aa] {ON} Anc_8.61...    29   6.4  
NDAI0D03050 Chr4 complement(718700..721393) [2694 bp, 897 aa] {O...    30   7.6  

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  376 bits (966), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 186/214 (86%), Positives = 186/214 (86%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NELVXXXXXXXXXXXXXXXXXXNSASSGEDGEDA 214
           NELV                  NSASSGEDGEDA
Sbjct: 181 NELVERGSDEEDGTDEEGGSYGNSASSGEDGEDA 214

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  302 bits (773), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 140/183 (76%), Positives = 158/183 (86%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M STR +PNILVTGTPGCGKTSTCELLQRRL+ + YYNISDFA++++CYDGYDEARKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+R GGAIVDWHVND+FPERLIDLVVVLRTDN+ L+DRL  RGYHEAK
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           IQENIDAEIMGVV+ DA+DSY +EIVVELQSDT +QMDENVDRI +W  AW EQ+P+GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  290 bits (742), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 154/183 (84%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M STR  PNI+VTGTPGCGKT+TCELLQRRL D  YYNISDFA++H+CY+GYDE RKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+RKGGAI+DWHVND+FPERLIDLVVVLR DN+ LYDRL  RGYH+AK
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+ENIDAEIMGVV+QDA DSY  +IVVELQS+TA+QM+ENV RI +W ++W+ Q+P GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NEL 183
           NEL
Sbjct: 195 NEL 197

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  285 bits (730), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 154/184 (83%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M   RF PN+L+TGTPGCGK++TCELLQRRL D  YYNISDFA++H+C+DGYDEARKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+R+G AIVDWHVND+FPERLIDLVVVLR DNT+LYDRLKSR YH+AK
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           IQEN+DAEIMGVV+QDA DSYE+EIVVELQSD+ +QM+ NVDRI SW   WL+Q+  G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NELV 184
           NEL+
Sbjct: 181 NELL 184

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  284 bits (726), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 154/183 (84%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           MLS R  PN+L+TGTPGCGK+++CELLQRRL D  YYNISDFA++H+CY+GYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+R+GG+IVDWHVND+FPERLIDLVVVLR DN++LYDRL +R YH++K
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           IQEN+DAEIMGVV+QDAQ+SY +EIVVELQSDT +QM+ NVDRI  W   WL+Q+ KGVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  285 bits (728), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 129/182 (70%), Positives = 152/182 (83%)

Query: 2   LSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIV 61
           +S R+ PN+L+TGTPGCGK++TCELLQRRL D  YYNISDFA++H CYDG+DE RKSHIV
Sbjct: 1   MSRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIV 60

Query: 62  XXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKI 121
                     PL+RKG  IVDWHVND+FPERLIDLVVVLR DN+VLYDRLKSRGYH++KI
Sbjct: 61  DEDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKI 120

Query: 122 QENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTN 181
            EN+DAEIMGVV+QDAQ+SY +EIVVELQSDT +QMDENVD+I  W   W++Q+  GVTN
Sbjct: 121 DENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTN 180

Query: 182 EL 183
           EL
Sbjct: 181 EL 182

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  280 bits (715), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 148/183 (80%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M + R  PNILVTGTPGCGK++TCELL RRL D  YYNISDFA++H+CYDGYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+RKG +IVDWHVND+FPERLIDLVVVLR DN++LYDRL  RGYH++K
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+EN+DAEIMGVV+QDA +SY +EIVVELQSDT + MD NVDRI  W   WL Q+P GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  278 bits (711), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 151/183 (82%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M   RF PNI+V+GTPGCGK++TCELL RRL +  YYNISDFA++H+CYDGYD+ARKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+RKGG I+DWHVND+FPERL+DLVVVLR DN +LYDRL  RGYH AK
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+EN+DAEIMGVV+QDA DSY +EIVVELQSDT ++MD+NVDRI +W   WL+Q+ KGVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  277 bits (709), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 128/183 (69%), Positives = 150/183 (81%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M  TR  PNILV+GTPGCGK++TCELLQR L D  Y+NISDFA++H CYDGYDEARKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+R+GGAIVDWHVNDIFPERLIDLVVVLR DN +L+DRL+ RGYH +K
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+ENIDAEIMGVV+QDA DSY +EIVVELQSD  +QM +NVDRIA+W A W+ ++P GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NEL 183
           N L
Sbjct: 181 NAL 183

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  274 bits (701), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 124/181 (68%), Positives = 147/181 (81%)

Query: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVX 62
           S R+ PN+L+TGTPGCGK++TCELLQRRL +  YYNISDFA++H+CYDGYD+ RKSHIV 
Sbjct: 4   SRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIVD 63

Query: 63  XXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122
                    PL+R+G +I+DWHVND+FPERLIDLV VLR DN+VLYDRL  R YH+ KI+
Sbjct: 64  EDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKIE 123

Query: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182
           EN+DAEIMGVV+QDA +SY KEIVVELQSDT +QMD NVDRI  W   WLEQ+  GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTNE 183

Query: 183 L 183
           L
Sbjct: 184 L 184

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  274 bits (701), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 151/180 (83%)

Query: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVX 62
           S R++PN+LVTGTPGCGK++TCELL RRL D  Y+NIS+FA++H+CYDGYDE+RKSHIV 
Sbjct: 8   SRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIVD 67

Query: 63  XXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122
                    PL+R+G +I+DWHVND+FPERLIDLVVVLR DN++L+DRL  RGYHE+KIQ
Sbjct: 68  DDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKIQ 127

Query: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182
           EN+DAEIMGVV+QDA DSYE+EIVVELQS++ ++MD NV+RI +W   WL Q+  GVTNE
Sbjct: 128 ENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTNE 187

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  266 bits (680), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 146/182 (80%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M S R+ PNI+VTGTPGCGK+S CELL+ +LKD  YYNISDFA+ H+C++GYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+R+G +IVDWHVNDIFPERLIDLVVVLR DN+ LY RL +RGYH++K
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+EN+DAEIMGVV QDA +SYE  IVVELQSDT + M+ NV RI +W   WLEQ+P+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  266 bits (680), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 149/181 (82%)

Query: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVX 62
           S R+ PN+L+TGTPG GK++TCELLQRRL +  YYNISDFA++++CY+GYD+ RKSHIV 
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  XXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122
                    PL+RKG +IVDWHVNDIFPERLIDLVVVLR DN++LYDRL  RGYH++KIQ
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182
           EN+DAEIMGVV+QDA +SY++EIVVELQSD  +QM+ NV+RI  W   W++Q+  GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 L 183
           L
Sbjct: 186 L 186

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  262 bits (669), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 124/183 (67%), Positives = 147/183 (80%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M S R+ PN+L+TGTPG GK++T ELLQRRL D  YYNISDFAQ+++C+DGYDE RKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+RKGG I+DWHVND+FPERLIDLVVVLR +N++L+ RLK RGYH+ K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I ENIDAEIMGVV+QDA DSYEKEIVVEL SD+ +QM+ NVDRI SW   W +Q+  GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  259 bits (661), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 144/182 (79%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M + R+ PNI+VTGTPGCGK+STCE L+ +LKD  YYNISDFA+ ++C++GYDE RKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+R+G +IVDWHVND+FPERLIDLVVVLR DN+ LY RL +RGYH++K
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+EN+DAEIMGVV QDA +SYE  IVVELQSDT + M  NV RI +W   WLEQ+P GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  259 bits (662), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 142/181 (78%)

Query: 3   STRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVX 62
           S R  PNILVTGTPG GK++TCELL R L D  YYNISDFA +++CYDGYDEARKSHIV 
Sbjct: 4   SRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIVD 63

Query: 63  XXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQ 122
                    PL+  GG I+DWHVND+FPERLIDLV VLR D++VL+DRL  R YH +KI 
Sbjct: 64  EDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKID 123

Query: 123 ENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182
           EN+DAEIMGVV+QDA DSYE++IVVELQSD  +QM  NVDR+ +W+  W EQ+P+GVTNE
Sbjct: 124 ENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTNE 183

Query: 183 L 183
           L
Sbjct: 184 L 184

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  259 bits (661), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 151/183 (82%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M S RF PNI+VTGTPGCGK++TCELLQRRL    YYNIS+FA++H+CYDGYDE RKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PL+ +G +I+DWHVND+FPERLIDLVVVLR++N  LYDRLK+RGYH++K
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+EN+DAEIMGVV+QDAQ+SYE EIVVELQS+T + M+ NVDRI +W   W+E++  GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NEL 183
           +EL
Sbjct: 181 SEL 183

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  257 bits (657), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 120/182 (65%), Positives = 143/182 (78%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M S R+ PNI+VTGTPGCGK+STCELL+  LK   YYNISDFA+ ++C++GYDE RKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          PLMR+G +I+DWHVND+FPERLIDLVVVLR DN+ LY RL +RGYH++K
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           I+EN+DAEIMGVV QDA DSYE  IVVELQSDT   +  NV RI +W   WLEQ+P+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  254 bits (648), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 115/183 (62%), Positives = 145/183 (79%)

Query: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60
           M S R+ PN+L++GTPG GK+STCELL+R L+D  Y NISDFA++  CYDG+D+ RKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VXXXXXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120
           V          P++R+G  IVDWHVND+FPERLIDLVV+LR DN+VLYDRL++R YH+AK
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180
           +QEN+DAEIMGVV+QDA DSY +EIV+ELQS+  ++M  NVDRI SW   W +Q+  GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NEL 183
           NEL
Sbjct: 181 NEL 183

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  251 bits (642), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 117/178 (65%), Positives = 139/178 (78%)

Query: 5   RFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHIVXXX 64
           RF PNI+VTGTPGCGK+STCELL+  LK   YYNISDFA+ ++C++ YDEARKSHIV   
Sbjct: 5   RFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHIVDED 64

Query: 65  XXXXXXXPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAKIQEN 124
                  PL+R+G +I+DWHVND+FPERLIDLVVVLR DN+ LY RL +RGYH++KI+EN
Sbjct: 65  KLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIEEN 124

Query: 125 IDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVTNE 182
           +DAEIMGVV QDA DSYE  IVVELQ DT + M  NV RI +W   WLEQ+  GVTNE
Sbjct: 125 LDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVTNE 182

>KLLA0E13201g Chr5 (1168489..1169478) [990 bp, 329 aa] {ON} highly
          similar to uniprot|P38629 YNL290W Saccharomyces
          cerevisiae RFC3 Subunit of heteropentameric Replication
          factor C (RF-C)
          Length = 329

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +  +NY N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGSNYRNM 73

>Suva_14.49 Chr14 (82953..83975) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>TDEL0E00780 Chr5 (162061..163071) [1011 bp, 336 aa] {ON} Anc_3.69
          YNL290W
          Length = 336

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 45 PHLLFYGPPGTGKTSTVVALAREIYGKNYSNM 76

>YNL290W Chr14 (86218..87240) [1023 bp, 340 aa] {ON}  RFC3Subunit
          of heteropentameric Replication factor C (RF-C), which
          is a DNA binding protein and ATPase that acts as a
          clamp loader of the proliferating cell nuclear antigen
          (PCNA) processivity factor for DNA polymerases delta
          and epsilon
          Length = 340

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>SAKL0C12144g Chr3 complement(1088849..1089838) [990 bp, 329 aa]
          {ON} highly similar to uniprot|P38629 Saccharomyces
          cerevisiae YNL290W RFC3 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 329

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 42 PHLLFYGPPGTGKTSTIVALAREIYGKNYKNM 73

>KAFR0A08290 Chr1 complement(1662119..1663117) [999 bp, 332 aa]
          {ON} Anc_3.69 YNL290W
          Length = 332

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 44 PHLLFYGPPGTGKTSTIIALAREIYGKNYSNM 75

>Smik_14.41 Chr14 (70565..71587) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGKNYSNM 78

>NDAI0A06060 Chr1 complement(1374529..1375545) [1017 bp, 338 aa]
          {ON} Anc_3.69
          Length = 338

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 48 PHLLFYGPPGTGKTSTIVALAREIFGKNYSNM 79

>TBLA0B08450 Chr2 complement(2024891..2025892) [1002 bp, 333 aa]
          {ON} Anc_3.69 YNL290W
          Length = 333

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 45 PHLLFYGPPGTGKTSTIVALAREIYGNNYSNM 76

>Kpol_1066.38 s1066 complement(64176..65186) [1011 bp, 336 aa]
          {ON} complement(64176..65186) [1011 nt, 337 aa]
          Length = 336

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L + +   NY+N+
Sbjct: 46 PHLLFYGPPGTGKTSTIIALAKEIYGKNYHNM 77

>NCAS0A09890 Chr1 complement(1978423..1979433) [1011 bp, 336 aa]
          {ON} Anc_3.69
          Length = 336

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGRNYSNM 78

>Skud_14.47 Chr14 (79783..80805) [1023 bp, 340 aa] {ON} YNL290W
          (REAL)
          Length = 340

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY N+
Sbjct: 47 PHLLFYGPPGTGKTSTIVALAREIYGRNYSNM 78

>ZYRO0C02090g Chr3 complement(165011..166027) [1017 bp, 338 aa]
          {ON} highly similar to uniprot|P38629 Saccharomyces
          cerevisiae YNL290W RFC3 Subunit of heteropentameric
          Replication factor C (RF-C) which is a DNA binding
          protein and ATPase that acts as a clamp loader of the
          proliferating cell nuclear antigen (PCNA) processivity
          factor for DNA polymerases delta and epsilon
          Length = 338

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 1  MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
           L T   P++L  G PG GKTS+   L R +   NY N+
Sbjct: 39 FLETGKLPHLLFYGPPGTGKTSSIIALAREIYGKNYSNM 77

>Kwal_23.5247 s23 complement(1073605..1074594) [990 bp, 329 aa]
          {ON} YNL290W (RFC3) - Subunit 3 of Replication Factor
          C; homologous to human RFC 36 kDa subunit [contig 8]
          FULL
          Length = 329

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTS    L R +  +NY N+
Sbjct: 42 PHLLFYGPPGTGKTSMIVALAREIYGSNYRNM 73

>Ecym_3534 Chr3 (1013065..1014063) [999 bp, 332 aa] {ON} similar
          to Ashbya gossypii AEL196W
          Length = 332

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANY 36
          P++L  G PG GKTST   L R +   NY
Sbjct: 45 PHLLFYGPPGTGKTSTISALAREIYGKNY 73

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
            4915 aa] {ON} complement(49973..58081,58083..64721)
            [14748 nt, 4916 aa]
          Length = 4915

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%)

Query: 10   ILVTGTPGCGKTSTCELLQRRLK 32
            IL+ G  GCGKT+ C++L   LK
Sbjct: 1362 ILLVGETGCGKTTVCQILAEHLK 1384

>KLTH0A01540g Chr1 (137284..138270) [987 bp, 328 aa] {ON} highly
          similar to uniprot|P38629 Saccharomyces cerevisiae
          YNL290W RFC3 Subunit of heteropentameric Replication
          factor C (RF-C) which is a DNA binding protein and
          ATPase that acts as a clamp loader of the proliferating
          cell nuclear antigen (PCNA) processivity factor for DNA
          polymerases delta and epsilon
          Length = 328

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTS    L R +   NY N+
Sbjct: 42 PHLLFYGPPGTGKTSMIVALSREIYGTNYRNM 73

>AEL196W Chr5 (264744..265745) [1002 bp, 333 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL290W (RFC3)
          Length = 333

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L + +   NY N+
Sbjct: 45 PHLLFYGPPGTGKTSTICALAKEIYGKNYRNM 76

>KNAG0K02300 Chr11 complement(459360..460364) [1005 bp, 334 aa]
          {ON} Anc_3.69 YNL290W
          Length = 334

 Score = 32.3 bits (72), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L R +   NY ++
Sbjct: 40 PHLLFYGPPGTGKTSTIVALAREIYGKNYSHM 71

>CAGL0H09174g Chr8 complement(898883..901978) [3096 bp, 1031 aa]
           {ON} some similarities with uniprot|P24004 Saccharomyces
           cerevisiae YKL197c PAS1
          Length = 1031

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%)

Query: 7   APNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
           AP  LV G  G GKT   + LQRRL   N  N+
Sbjct: 419 APAFLVEGESGMGKTMLFKYLQRRLATQNQLNV 451

>CAGL0M03575g Chr13 complement(403738..404733) [996 bp, 331 aa]
          {ON} highly similar to uniprot|P38629 Saccharomyces
          cerevisiae YNL290w RFC3
          Length = 331

 Score = 32.3 bits (72), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L + +   NY N+
Sbjct: 43 PHLLFYGPPGTGKTSTIVALAKDIYGKNYSNM 74

>TPHA0P01200 Chr16 complement(242758..243765) [1008 bp, 335 aa]
          {ON} Anc_3.69 YNL290W
          Length = 335

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 8  PNILVTGTPGCGKTSTCELLQRRLKDANYYNI 39
          P++L  G PG GKTST   L + +   NY N+
Sbjct: 45 PHLLFYGPPGTGKTSTIIALAKEIYGKNYSNM 76

>SAKL0H16214g Chr8 (1413429..1428200) [14772 bp, 4923 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4923

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 10   ILVTGTPGCGKTSTCELLQRRLK 32
            IL+ G  GCGKT+ C+L+ + +K
Sbjct: 1358 ILLVGETGCGKTTVCQLIAQYMK 1380

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 10   ILVTGTPGCGKTSTCELLQR 29
            IL+ G  GCGKT+ C+L+ R
Sbjct: 1366 ILLVGETGCGKTTVCQLIAR 1385

>ZYRO0A13310g Chr1 complement(1050131..1051678) [1548 bp, 515 aa]
           {OFF} similar to uniprot|P38126 Saccharomyces cerevisiae
           YBR186W PCH2 Nucleolar component of the pachytene
           checkpoint which prevents chromosome segregation when
           recombination and chromosome synapsis are defective also
           represses meiotic interhomolog recombination in the rDNA
          Length = 515

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 3   STRFAPN--ILVTGTPGCGKTSTCELLQRRL 31
           S+ FA N  +LV G PG GKT+ C+ L ++L
Sbjct: 298 SSAFANNKLLLVQGPPGTGKTTICKALCQKL 328

>Zrou_YGOB_A13310g Chr1
           complement(1049931..1050068,1050140..1051678) [1677 bp,
           558 aa] {ON} ANNOTATED BY YGOB -
          Length = 558

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 2/31 (6%)

Query: 3   STRFAPN--ILVTGTPGCGKTSTCELLQRRL 31
           S+ FA N  +LV G PG GKT+ C+ L ++L
Sbjct: 298 SSAFANNKLLLVQGPPGTGKTTICKALCQKL 328

>Smik_12.22 Chr12 complement(54975..57488) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 11/66 (16%)

Query: 1   MLSTRFAP--NILVTGTPGCGKTSTCELLQRRLKDANYYNISDFA--------QQHECYD 50
            LST   P   +L+ G PGCGKTS    L   LK   + +IS  +         + +  D
Sbjct: 231 FLSTGVEPPRGVLLHGPPGCGKTSIANALAGELK-VPFISISAPSVVSGMSGESEKKIRD 289

Query: 51  GYDEAR 56
            +DEA+
Sbjct: 290 LFDEAK 295

>AGR074C Chr7 complement(854312..869011) [14700 bp, 4899 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR106C
            (MDN1)
          Length = 4899

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 15/20 (75%)

Query: 10   ILVTGTPGCGKTSTCELLQR 29
            +L+ G  GCGKT+ C+L+ R
Sbjct: 1364 VLLVGETGCGKTTICDLIAR 1383

>KLTH0G12892g Chr7 (1095023..1109809) [14787 bp, 4928 aa] {ON} similar
            to uniprot|Q12019 Saccharomyces cerevisiae YLR106C MDN1
            Huge dynein-related AAA-type ATPase (midasin) forms
            extended pre-60S particle with the Rix1 complex
            (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
            of 60S subunits and subsequent export from nucleoplasm to
            cytoplasm
          Length = 4928

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 16/22 (72%)

Query: 10   ILVTGTPGCGKTSTCELLQRRL 31
            +L+ G  GCGKT+ C+L+ + L
Sbjct: 1369 VLLVGETGCGKTTVCQLIAKYL 1390

>Suva_10.38 Chr10 complement(75024..77537) [2514 bp, 837 aa] {ON}
           YLL034C (REAL)
          Length = 837

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 11/66 (16%)

Query: 1   MLSTRFAP--NILVTGTPGCGKTSTCELLQRRLKDANYYNISDFA--------QQHECYD 50
            LST   P   +L+ G PGCGKTS    L   LK   + +IS  +         + +  D
Sbjct: 231 FLSTGVEPPRGVLLHGPPGCGKTSIANALAGELK-VPFISISAPSVVSGMSGESEKKIRD 289

Query: 51  GYDEAR 56
            +DEA+
Sbjct: 290 LFDEAK 295

>TBLA0B01950 Chr2 complement(449277..450329) [1053 bp, 350 aa]
          {ON} Anc_1.517 YJR068W
          Length = 350

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 2  LSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYN 38
          L T   P++L  G PG GKTST   + + L   N  N
Sbjct: 47 LQTSNLPHMLFYGPPGTGKTSTILAMTKELYGPNLIN 83

>NDAI0D04890 Chr4 (1160943..1163555) [2613 bp, 870 aa] {ON}
           Anc_7.215 YER047C
          Length = 870

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 2   LSTRFAP--NILVTGTPGCGKTSTCELLQRRLK 32
           LST   P   +L+ G PGCGKTS    L   LK
Sbjct: 251 LSTGVEPPRGVLLHGPPGCGKTSIANALAGELK 283

>NCAS0A02940 Chr1 (567021..569594) [2574 bp, 857 aa] {ON} Anc_4.23
          Length = 857

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 2   LSTRFAP--NILVTGTPGCGKTSTCELLQRRLK 32
           LST   P   +L+ G PGCGKTS    L   LK
Sbjct: 235 LSTGVEPPRGVLLHGPPGCGKTSIANALAGELK 267

>NCAS0C02020 Chr3 (375594..377126,377196..377351) [1689 bp, 562 aa]
           {ON} Anc_8.558 YBR186W
          Length = 562

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 10  ILVTGTPGCGKTSTCELLQRRLKDAN--YYNISDFAQQHEC 48
           +LV G PG GKTS C  L ++L   N  + NI +   + +C
Sbjct: 304 LLVYGPPGTGKTSICRALCQKLSIRNDLHTNIGEGELECKC 344

>KAFR0H02840 Chr8 (541137..541760) [624 bp, 207 aa] {ON} Anc_8.618
           YPL121C
          Length = 207

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 97  VVVLRTDNTVLYDRLKSR--GYHEAKIQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTA 154
             VL+ +    Y+  K R  G  +AKI+  +D      V    +    K + V+ Q++  
Sbjct: 96  FTVLKINKLGGYEEYKKREIGMEKAKIEYQMDTSFQEEVDTVLESEEFKSLSVDEQTEYR 155

Query: 155 DQMDENVDRIASWSAAWLEQ 174
           DQ+D  ++ + SW  + L++
Sbjct: 156 DQIDGKINEMESWKTSQLQK 175

>NDAI0D03050 Chr4 complement(718700..721393) [2694 bp, 897 aa] {ON}
           Anc_4.327 YLR442C
          Length = 897

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 2   LSTRFAPNILVTGTPGCGKTSTC-ELLQRRLKDANYYNISDF 42
           L +  A  + V GTPG GKT T  E+++  +  AN + +  F
Sbjct: 472 LESESATTLYVAGTPGVGKTLTIKEVIKDLISSANQHELPKF 513

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,177,815
Number of extensions: 755208
Number of successful extensions: 3171
Number of sequences better than 10.0: 62
Number of HSP's gapped: 3208
Number of HSP's successfully gapped: 62
Length of query: 214
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 109
Effective length of database: 41,441,469
Effective search space: 4517120121
Effective search space used: 4517120121
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)