Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01276g7.349ON55755727150.0
Kwal_56.246387.349ON52756121130.0
TDEL0C019907.349ON60655113540.0
SAKL0F11352g7.349ON58341612971e-173
NCAS0A141507.349ON57057212941e-173
KLLA0D12364g7.349ON63164812861e-171
ZYRO0F11682g7.349ON59742212781e-170
Suva_4.797.349ON70843212141e-159
ACL149W7.349ON62841011781e-154
Smik_4.717.349ON75941411861e-154
Skud_4.907.349ON70743011761e-153
YDL167C (NRP1)7.349ON71942711661e-151
KAFR0B008707.349ON54253411471e-151
KNAG0C037807.349ON53855611141e-146
Kpol_530.327.349ON68447411251e-146
TBLA0E020607.349ON56441510561e-137
TPHA0F029607.349ON6544219941e-127
NDAI0A019007.349ON5654098071e-100
CAGL0I03344g7.349ON6034307007e-84
KLLA0B08976g3.379ON30536830.12
Kwal_56.234868.229ON587122810.34
CAGL0D05236g7.188ON44335751.6
TBLA0B04730singletonON99452751.7
Ecym_13021.408ON28828732.3
SAKL0H17952g8.229ON58976732.6
TDEL0A009402.52ON68231732.7
YHR015W (MIP6)1.357ON65990733.0
SAKL0H05566g8.717ON47060723.0
NCAS0G025802.167ON22430703.7
TBLA0B006002.52ON73432723.8
Kwal_23.45972.52ON66431724.0
KLTH0B07546g2.52ON63931714.5
NDAI0F027202.167ON22633694.8
Suva_4.202.52ON652110715.4
Kpol_1069.88.822ON449132698.6
ABL158C2.52ON72931699.0
NCAS0C059204.7ON287128689.4
YDL224C (WHI4)2.52ON64936689.8
Skud_4.302.52ON65136689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01276g
         (557 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...  1050   0.0  
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   818   0.0  
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   526   0.0  
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   504   e-173
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   503   e-173
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   499   e-171
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   496   e-170
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   472   e-159
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   458   e-154
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   461   e-154
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   457   e-153
YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   453   e-151
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   446   e-151
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   433   e-146
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   437   e-146
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   411   e-137
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   387   e-127
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   315   e-100
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   274   7e-84
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    37   0.12 
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    36   0.34 
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    33   1.6  
TBLA0B04730 Chr2 complement(1106452..1109436) [2985 bp, 994 aa] ...    33   1.7  
Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON} ...    33   2.3  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    33   2.6  
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    33   2.7  
YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putati...    33   3.0  
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    32   3.0  
NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON...    32   3.7  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    32   3.8  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    32   4.0  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    32   4.5  
NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167      31   4.8  
Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON} Y...    32   5.4  
Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON} (14170.....    31   8.6  
ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON} S...    31   9.0  
NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4....    31   9.4  
YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}  WH...    31   9.8  
Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON} Y...    31   9.8  

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/557 (92%), Positives = 516/557 (92%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60
           MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60

Query: 61  LEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWCM 120
           LEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWCM
Sbjct: 61  LEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWCM 120

Query: 121 NHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLVA 180
           NHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLVA
Sbjct: 121 NHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLVA 180

Query: 181 GQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSYLDV 240
           GQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSYLDV
Sbjct: 181 GQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSYLDV 240

Query: 241 RNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXXX 300
           RNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEET           
Sbjct: 241 RNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNN 300

Query: 301 XTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSARVL 360
            TYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSARVL
Sbjct: 301 STYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSARVL 360

Query: 361 DRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYMKNP 420
           DRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYMKNP
Sbjct: 361 DRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYMKNP 420

Query: 421 LQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGXXXXXXXXXXXXXXXXXXXXXXXX 480
           LQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMG                        
Sbjct: 421 LQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGQPQQQQQQQQRMRYNQGQRFGQGQ 480

Query: 481 XXXXXSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG 540
                SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG
Sbjct: 481 QHQGGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG 540

Query: 541 NGMGISLNTRSFSEPAW 557
           NGMGISLNTRSFSEPAW
Sbjct: 541 NGMGISLNTRSFSEPAW 557

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  818 bits (2113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/561 (71%), Positives = 430/561 (76%), Gaps = 44/561 (7%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60
           MHYVVLEV+LAHREDSPKDWSQIA F+YQFLDTE L+ VF+ENKH+ L NGC+LQ+AV+Q
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLENGCSLQEAVSQ 60

Query: 61  LEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWCM 120
           LEKDI EH KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHP+VFDLWKEYDRWC+
Sbjct: 61  LEKDIGEHLKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYDRWCV 120

Query: 121 NHPETSAMRQ-NPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLV 179
           NHPET A+R+ N +GK+ KD+AE+RSVL LD   + + P A                   
Sbjct: 121 NHPETLALRRSNSMGKKVKDVAELRSVLELDSATQDSTPGA------------------- 161

Query: 180 AGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSYLD 239
                                 +PD + Q + II QLHKKCVTA+DKSLVLTHPYDSYLD
Sbjct: 162 ---------------------AEPDALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLD 200

Query: 240 VRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXX 299
           VRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEET          
Sbjct: 201 VRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSN 260

Query: 300 XXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSARV 359
             TYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVE+QPSSARV
Sbjct: 261 NSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARV 320

Query: 360 LDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYMKN 419
           LDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFP+   A MNN GY+KN
Sbjct: 321 LDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPSTGSAPMNNTGYVKN 380

Query: 420 PLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGXXXXXXXXXXXXXXXXXXXX--- 476
            +QPHN Q G QQQAAYKMRT AG+  +Q Q+   MG                       
Sbjct: 381 TMQPHNIQVGGQQQAAYKMRTAAGIPPVQTQASSQMGQPHMAQQHQQQQQRMRFNQGPRF 440

Query: 477 XXXXXXXXXSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDI 536
                    SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQK    VNSY + 
Sbjct: 441 GQNQQPQGGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKGSAAVNSYAEG 500

Query: 537 QDIGNGMGISLNTRSFSEPAW 557
           QDIGNGMG SLNTRSFSEPAW
Sbjct: 501 QDIGNGMGFSLNTRSFSEPAW 521

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/551 (51%), Positives = 344/551 (62%), Gaps = 79/551 (14%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK----HVELGNGCTLQD 56
           MHYVVLEVE  HR ++PKD  ++ K +YQF+D E+++  + +++     ++     + Q+
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 57  AVAQLEKDI-SEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115
           ++A+ ++D+ S   +D+FVLCSL STWH RVTIPRQARDE F+LP +LQHP+VFDLWKEY
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 116 DRWCMNHPETSAMRQNPLG--KRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQS 173
           DRWC NHPE   +R++     KR KD  E+  VL                          
Sbjct: 121 DRWCANHPEVLTLRKSCRTGIKRVKDQTEILKVL-------------------------- 154

Query: 174 GAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHP 233
                            E+S+ E +  E+P  +   V I+ QL ++C T +D S VL+ P
Sbjct: 155 -----------------EMSTEEIT--EKP-VLGYTVDILLQLCERCTTKEDISDVLSRP 194

Query: 234 YDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXX 293
           YDS+LD+RNFLQE+SKVLY+NNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEET    
Sbjct: 195 YDSHLDIRNFLQEQSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETANIN 254

Query: 294 XXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQ 353
                    YVE QDSISGFVVFQ+HEEATE L LNGRSILSN+ANTKQPRV+EHIVEIQ
Sbjct: 255 NKWSMNNSPYVEEQDSISGFVVFQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQ 314

Query: 354 PSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNN 413
           PSS RVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFPAAS   +NN
Sbjct: 315 PSSTRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNN 374

Query: 414 ------NGYMKNPLQPHNAQ----AGSQQQAAYKMRTPA-GLQAMQVQSGPHMGXXXXXX 462
                 NG + +  Q  N       GS  Q+ Y++ T     QA++  +  +        
Sbjct: 375 KQYMNYNGNINSTNQGGNIYITKVGGSPTQSHYQINTQLPQTQAVRTNANYNDQNSLKHS 434

Query: 463 XXXXXXXXXXXXXXXXXXXXXXXSN---------------VPFRAGDWKCATCTYHNFAK 507
                                   N               VPFRAGDWKC TCTYHNFAK
Sbjct: 435 NSAYRFNGNNGGNSPIMNYSNNRFNGQQVNNSNVNNGGSNVPFRAGDWKCPTCTYHNFAK 494

Query: 508 NVVCLRCGGPK 518
           N+VCLRCG  K
Sbjct: 495 NLVCLRCGAAK 505

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNN 414
           R GDW CP+C + NF +   C RC     S +  NN+
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRCGAAKVSISDSNND 514

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 25/57 (43%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIGNGMGISL 547
           R GDW C +C + NF +   C RC  P ++  Q      +N   +I     G  I +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFPAASAVQVNNKQYMNYNGNINSTNQGGNIYI 395

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  504 bits (1297), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 252/416 (60%), Positives = 299/416 (71%), Gaps = 55/416 (13%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60
           M+YVVLE E  H E+ PKD +++++  YQF+ ++TL+ VFE+   VE+G G  L++ VAQ
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQPIIVEVGPG-QLREQVAQ 59

Query: 61  LEKDISEHAKDD---FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDR 117
           L++ ++     D   F L SL+STWH RVTIPRQARDE FILPP+LQHPKVFDLWKEYDR
Sbjct: 60  LDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKEYDR 119

Query: 118 WCMNHPETSAMRQNP-LGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAE 176
           WC+NHPET  +R+N  LGK+++DL E                                  
Sbjct: 120 WCVNHPETLPLRKNSNLGKKSRDLPE---------------------------------- 145

Query: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDS 236
                          LS   ++P  Q   + Q + I++QLHKKC+  +D+S+VLTHPYDS
Sbjct: 146 ---------------LSRVLEAPL-QTFPLDQTIGILSQLHKKCLLPEDQSMVLTHPYDS 189

Query: 237 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXX 296
           YLDVR FLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN+VEET       
Sbjct: 190 YLDVRTFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEETSNVNNNW 249

Query: 297 XXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356
                +YVE QDSISGFVVFQ+HEEATEALSLNGRSILSN+ANTKQPRV+EH+VE+QPSS
Sbjct: 250 SCNNSSYVEEQDSISGFVVFQTHEEATEALSLNGRSILSNMANTKQPRVVEHVVELQPSS 309

Query: 357 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN 412
            RVLDRA E+LSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFPA S   +N
Sbjct: 310 TRVLDRAHELLSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATSAVNVN 365

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 54/89 (60%), Gaps = 17/89 (19%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ-----------------QKELG 528
           SNVPFRAGDWKC +CTYHNFAKNVVCLRCGGPK+                     Q    
Sbjct: 495 SNVPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSA 554

Query: 529 TVNSYTDIQDIGNGMGISLNTRSFSEPAW 557
           +  S +++ + G+  G+SL TRS SEPAW
Sbjct: 555 STISLSEMHNGGSSFGVSLETRSSSEPAW 583

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFP-AASGAGMNNNGYMKNPLQPHNAQAGS 430
           R GDW C SC + NF +   C RC  P    GAG+ N   +   L   + Q GS
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGS 553

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 520
           R GDW C +C + NF +   C RC  P ++
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPATS 360

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  503 bits (1294), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 277/572 (48%), Positives = 347/572 (60%), Gaps = 67/572 (11%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGN-GCTLQDAVA 59
           M YVVLE+E +H+ ++PKD S+I K +YQF+++ETL+  FEE K +++ +     +D ++
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATFEEPKSIDIPDMANAFKDTIS 60

Query: 60  QLEKDISEHAKD--DFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDR 117
           QLE DI     D  DFVLCSL S W  RVT+PRQA D  FILP +L+HP+VF+LWKE+D+
Sbjct: 61  QLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEFDK 120

Query: 118 WCMNHPETSAMRQNPLG----KRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQS 173
           WC NHPE   MR++ L     K   D++++ ++L +D + +     +N            
Sbjct: 121 WCGNHPEVIPMRKSNLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSN------------ 168

Query: 174 GAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHP 233
                         P T LS            I  +  I+T+L KKC T DD  LVLT P
Sbjct: 169 --------------PQTLLS------------IQDSTNILTKLRKKCTTLDDVQLVLTRP 202

Query: 234 YDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXX 293
           YDSY D++ FLQERS+VLYMNNLP DTTQSELESWFTQFGARP+GFWT KN +EET    
Sbjct: 203 YDSYADIKTFLQERSRVLYMNNLPSDTTQSELESWFTQFGARPIGFWTAKNTIEETSSIN 262

Query: 294 XXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQ 353
                     V+ QD ++GFVVFQSHEEATEAL LNGRSILSNIANTKQPRV+EHIVEIQ
Sbjct: 263 SNWSLNGNPLVDEQDCVAGFVVFQSHEEATEALVLNGRSILSNIANTKQPRVVEHIVEIQ 322

Query: 354 PSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAA-SGAGMN 412
           PSS RVLD  Q+ILS FPQSKNKPRPGDW+CPSCGFSNFQRRT+CFRCSFPA  +  G+N
Sbjct: 323 PSSTRVLDAGQDILSAFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPNNNKGLN 382

Query: 413 NNGY----------MKNPLQ-----PHNAQAGSQQ--QAAYKMRTPAGLQAMQVQSGPHM 455
            +G           + N +Q     P + Q+   Q  Q   K  TP+     + Q+  H 
Sbjct: 383 ISGTSNIASTNQMPVVNRIQSTFPIPQSHQSSISQTFQQYNKPLTPSN-SGSRTQNFRHN 441

Query: 456 GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNVPFRAGDWKCATCTYHNFAKNVVCLRCG 515
                                         SNVPFRAGDWKC +CTYHNFAKNVVCLRC 
Sbjct: 442 -GSNNTNNNNNNRYNTNSQFSMTSGGITTGSNVPFRAGDWKCPSCTYHNFAKNVVCLRCR 500

Query: 516 GPKSTE--HQQKELGTVNSYTDIQDIGNGMGI 545
            PK ++  H   E     ++T    + + +GI
Sbjct: 501 IPKISQQSHNGNEGNQSTTFTSHGSVQDQLGI 532

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  499 bits (1286), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 282/648 (43%), Positives = 354/648 (54%), Gaps = 116/648 (17%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60
           M YV+ E E  + E++PKD + I+   YQ +  ETL+P++EE +   +    +L++ +  
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDATHSLKNTIQS 60

Query: 61  LEKDISEH-AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWC 119
           +E  + E+ A ++FVLCSLNSTW  RVT+ RQARDE ++LP  LQHPKVFDLW+E DRW 
Sbjct: 61  MENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVDRWY 120

Query: 120 MNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQS---KAEQSGAE 176
            NHPE                          GT+ G    AN N   Q    K  +S   
Sbjct: 121 RNHPEQYE----------------------KGTDRGGGNVANTNTTTQRNKHKLVKSIDA 158

Query: 177 QLVAGQPDTKQPSTELSSSEQ-----SPAEQPDTITQAVVIITQLHKKCVTADDKSLVLT 231
            LV    D    ST     EQ     +  E   +I Q   ++ +LH+ C + +D++LVLT
Sbjct: 159 LLVFLNIDLDNKSTTDQRMEQVNIDKNSFETLPSIQQCEKVLFKLHRNCTSDNDQTLVLT 218

Query: 232 HPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXX 291
           HP+DSYLD++NFL E+S VLYMNNLPPDTTQSELESWF QFG+RPVGFWTVKN+VE+T  
Sbjct: 219 HPFDSYLDIKNFLLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSN 278

Query: 292 XXXXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVE 351
                      YV+ QDSISGFVV+Q+HEEA ++L+LNGRSILSN++NTKQPRV+EH+VE
Sbjct: 279 VNNNWSTNNNLYVDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVE 338

Query: 352 IQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGM 411
           IQPSS  VLDRAQEIL+ FPQSKNKPRPGDW CPSC FSNFQRRT+CFRCSFP +S   M
Sbjct: 339 IQPSSNSVLDRAQEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398

Query: 412 NN---------NGYMKNPLQPHNAQ-----------------------AGSQQQAAYKMR 439
           +N         +GY      P  A                        + S Q    KM+
Sbjct: 399 SNGNNYNKNSVHGYKARTSTPQTADYNDNIQNQQQQQFVLNSLSGQLTSASAQDLTQKMK 458

Query: 440 TPAGLQAMQVQSGPHMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNVPFRAGDWKCAT 499
                 A +  + P+ G                             SNVPFRAGDWKCA 
Sbjct: 459 LQMSDTANRRFNYPNRGPQLQNQHQQSHQHIQNQAQQQGPMSNG--SNVPFRAGDWKCAN 516

Query: 500 CTYHNFAKNVVCLRCGGPK----------------------------------------- 518
           CTYHNFAKNVVCLRCGGPK                                         
Sbjct: 517 CTYHNFAKNVVCLRCGGPKTANVSANSNNATVTNATSNAATSNKLVSHDDMSVTPSLQNS 576

Query: 519 STEHQQKELGTVNSYTDIQDIG---------NGMGISLNTRSFSEPAW 557
           S  HQ   +  V++ +D+   G         +G+G+SLN RS SEP W
Sbjct: 577 SIYHQNGRIN-VHNMSDVNTTGYVSGQVPSFSGVGLSLNGRSSSEPNW 623

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  496 bits (1278), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 252/422 (59%), Positives = 301/422 (71%), Gaps = 51/422 (12%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK---HVELGNGCT-LQD 56
           M+YVVLEVE AH  + PKD  +IAK +YQF++ ETL+  ++EN+   H+   N  T L +
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 57  AVAQLEKDISEHAKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115
           AVA L ++I+  A D+ FVLCSLNSTWH RVT+ RQARD+ F LP +LQHPK+FDLWKEY
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 116 DRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA 175
           +RWC+NHPE   +R+N  G+R KD+AE+  VL ++G                        
Sbjct: 121 ERWCVNHPEVMPLRKNG-GRRMKDVAELARVLDINGL----------------------- 156

Query: 176 EQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYD 235
                   +    S +LS S              V I+ +LH++C T +D ++VLTHPYD
Sbjct: 157 --------NFNDSSFDLSRS--------------VEILLRLHQRCSTPEDMAMVLTHPYD 194

Query: 236 SYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXX 295
           S++DVRNFLQE SKVLY+NNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEET      
Sbjct: 195 SHMDVRNFLQECSKVLYLNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETSNVNNN 254

Query: 296 XXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPS 355
                  YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTKQPRV+EHIVEIQPS
Sbjct: 255 WSMNNSPYVEEQDSISGFVVFQTHEEATEVLTLNGRSILSNMANTKQPRVVEHIVEIQPS 314

Query: 356 SARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNG 415
           S RVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFPA +   +N   
Sbjct: 315 STRVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQVNTKQ 374

Query: 416 YM 417
           Y+
Sbjct: 375 YI 376

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 57/115 (49%), Gaps = 43/115 (37%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKST---------------------EHQQ 524
           SNVPFRAGDWKC +C YHNFAKNVVCLRCGGPK T                     +H  
Sbjct: 483 SNVPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDLENAATTSNNINNNNGVNQHDA 542

Query: 525 KELGTVNSYT--DIQDIG--------------------NGMGISLNTRSFSEPAW 557
           K +   NS +  D+  +G                    +G G++L++RS SEP W
Sbjct: 543 KVVAKNNSVSLLDLTSMGSTVSLSDKLPNGNATSSAAYDGFGVALDSRSVSEPKW 597

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNN 413
           R GDW CPSC + NF +   C RC  P  +   + N
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVDLEN 523

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523
           R GDW C +C + NF +   C RC  P +T  Q
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQ 369

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  472 bits (1214), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/432 (55%), Positives = 288/432 (66%), Gaps = 60/432 (13%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVEL---GNGCTLQDA 57
           MHYVVLE+++AH  DSPKD  +I    YQ +D ETL   +E      +   G   +L+ A
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 58  VAQLEKDISEH--AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115
           + QL+KDI +H    DDFVL SL STWH RVT+PRQARD+ FIL  +LQHP++FDLWKE+
Sbjct: 61  MGQLDKDI-QHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEF 119

Query: 116 DRWCMNHPETSAMRQNPLG--------------KRTKDLAEMRSVLGLDGTEEGAHPDAN 161
           +RWC+NHPE   +R+N L               K TKDL EM  +L +  T E       
Sbjct: 120 ERWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVE------- 172

Query: 162 QNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCV 221
                                             +    +    + + + ++ QLHKKC 
Sbjct: 173 ---------------------------------EDDFALDNHSLLQRTIDVLLQLHKKCS 199

Query: 222 TADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWT 281
           +A+D   VLT PYDS+ D+R+FLQERSKVLYMNNLPPDTTQSELESWFTQ+GARPVGFWT
Sbjct: 200 SAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQSELESWFTQYGARPVGFWT 259

Query: 282 VKNIVEETXXXXXXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTK 341
           VKNIVE+T             YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTK
Sbjct: 260 VKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTK 319

Query: 342 QPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRC 401
           QPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRC
Sbjct: 320 QPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRC 379

Query: 402 SFPAASGAGMNN 413
           SFPA S + M+N
Sbjct: 380 SFPAPSNSQMHN 391

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 3/57 (5%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIGNG 542
           SN+PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      ++   N Y D   I  G
Sbjct: 558 SNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSV---NADVSETNHYIDTSTIAPG 611

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 388

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGA 409
           R GDW C +C + NF +   C RC  P +  A
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 594

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  458 bits (1178), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 232/410 (56%), Positives = 277/410 (67%), Gaps = 53/410 (12%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60
           M+YV+ E ++AH+ED+PKD ++++K  YQ +    L P++ + + +E+G G  +Q A  Q
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYADAREIEVGGG-GVQMATGQ 59

Query: 61  LEKDISEH-AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRWC 119
           LE  + E  A + FVLCSL+STWH RVT+PRQA DE  +LP  L H KVFDLWKE DRWC
Sbjct: 60  LEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECDRWC 119

Query: 120 MNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQLV 179
            NH    A      G    D+AE+  VL LD                         EQLV
Sbjct: 120 ANHVSERACNAGAKG----DVAELFRVLDLD-------------------------EQLV 150

Query: 180 AGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSYLD 239
           +                         I QA  ++ QLH KC TA+D+SLVLTHPYDSY D
Sbjct: 151 SHA----------------------YIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYAD 188

Query: 240 VRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXX 299
           + +F+QERS+VLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKN+VE+T          
Sbjct: 189 MTSFIQERSEVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSN 248

Query: 300 XXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSARV 359
              YVE  DSISGFVVFQSHE A+EAL+LNGRSILSN+ANTKQPRV+EH+VE++PSS+RV
Sbjct: 249 NSRYVEEHDSISGFVVFQSHEAASEALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRV 308

Query: 360 LDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGA 409
           LD AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRR +CFRCSFPA S  
Sbjct: 309 LDCAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRIACFRCSFPATSAV 358

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG----- 540
           SNVPFRAGDWKC  C+YHNFAKN+VCLRCG PK+    + +      ++    +G     
Sbjct: 499 SNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSSSGPVGAQDSA 558

Query: 541 -NGMGISLNTRSFSE 554
            + + +S++ RS +E
Sbjct: 559 ISSVTVSIDRRSKNE 573

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 520
           R GDW C +C + NF + + C RC  P ++
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPATS 356

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 373 SKNKP-RPGDWNCPSCGFSNFQRRTSCFRCSFP 404
           S N P R GDW C +C + NF +   C RC  P
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNP 530

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  461 bits (1186), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 235/414 (56%), Positives = 284/414 (68%), Gaps = 36/414 (8%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK--HVELGNGC-TLQDA 57
           MHYVVLE+++AH  +SPKD  +I    YQF+D ETL   +E N   ++E+     +L+ A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 58  VAQLEKDISE-HAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYD 116
           + QL+K I +    D+FVL SL STWH RVT+PRQARD+ FIL  +LQHPK+FDLWKE+D
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 117 RWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAE 176
           RWC+NHPE               L +M++               N N G +     SG  
Sbjct: 121 RWCVNHPEI--------------LEQMKTA------------SNNNNSGTKG---NSGGL 151

Query: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPD---TITQAVVIITQLHKKCVTADDKSLVLTHP 233
              A   D      E+SSS +     P+    + +   I+  LH+KC +++D   VLT P
Sbjct: 152 AKNAKDLDEMIRILEISSSTEEAVSVPEEYSLLRRTTDILIHLHRKCCSSEDMKFVLTQP 211

Query: 234 YDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXX 293
           YDS+ D+R FLQERSKVLYMNNLPPDTTQSELESWFTQ+G RPVGFWTVKNIVE+T    
Sbjct: 212 YDSHTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTSNIN 271

Query: 294 XXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQ 353
                    YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTKQPRV+EH++E+Q
Sbjct: 272 NNWSLNNSPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQ 331

Query: 354 PSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAAS 407
           PSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFPA S
Sbjct: 332 PSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPS 385

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKE 526
           SN+PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      E
Sbjct: 616 SNIPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANE 656

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN-NNGYMK 418
           R GDW C +C + NF +   C RC  P +     N  N Y++
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNHYIE 662

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 388

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  457 bits (1176), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 237/430 (55%), Positives = 282/430 (65%), Gaps = 59/430 (13%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK--HVEL-GNGCTLQDA 57
           MHYVVLE+++A+  DSPKD  +I    YQ +D ETL   ++ +    +E+ G   +L+ A
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 58  VAQLEKDISE-HAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYD 116
           + QL+KDI +    D+FVL SL STWH RVT+ RQARD+ FIL  +LQHP++FDLWKE+D
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 117 RWCMNHPETSAMRQ---------------NPLGKRTKDLAEMRSVLGLDGTEEGAHPDAN 161
           RWC+NHPE    R+                 L K TKD  EM  +L +    EGA     
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGA----- 175

Query: 162 QNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCV 221
                                             +  P EQ   + +   I+ QLHKKC 
Sbjct: 176 ----------------------------------DFIPEEQ-SLLRRTTDILLQLHKKCS 200

Query: 222 TADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWT 281
           + +D   VLT PYDSY D+R FLQERSKVLYMNNLPPDTTQSELESWFTQ+G RPVGFWT
Sbjct: 201 SPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTTQSELESWFTQYGVRPVGFWT 260

Query: 282 VKNIVEETXXXXXXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTK 341
           VKNIVE+T             YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTK
Sbjct: 261 VKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHEEATEVLALNGRSILSNLANTK 320

Query: 342 QPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRC 401
           QPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRC
Sbjct: 321 QPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRC 380

Query: 402 SFPAASGAGM 411
           SFPA S   M
Sbjct: 381 SFPAPSNIQM 390

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 40/58 (68%), Gaps = 3/58 (5%)

Query: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIGNGMGI 545
           +PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      E    N Y +   +G G  I
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANE---TNHYIEGLTVGPGSHI 634

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN 412
           R GDW C +C + NF +   C RC  P +  A  N
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADAN 617

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNIQ 389

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  453 bits (1166), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/427 (55%), Positives = 286/427 (66%), Gaps = 59/427 (13%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK--HVELGNGCT--LQD 56
           MHYVVLE+++AH  D+PKD  +IA   +Q ++ ETL   +  N    +E+ NG T  L+ 
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEV-NGTTKSLES 59

Query: 57  AVAQLEKDISE-HAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115
           A+ QL+KDI +    DDFVL SL STWH RVT+PRQARD+ FIL  +LQHPKVFDLWKE+
Sbjct: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119

Query: 116 DRWCMNHPET----SAMRQNPL---------GKRTKDLAEMRSVLGLDGTEEGAHPDANQ 162
           DRWC+NHPE      A+  N            K TKDL E+  +L      E + P    
Sbjct: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRIL------EVSIP---- 169

Query: 163 NGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVT 222
                   E++G                       S  E    + +   I+ QLHKKC +
Sbjct: 170 -------TEEAG-----------------------SVPEIYSLLKRTTDILIQLHKKCTS 199

Query: 223 ADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTV 282
            +D   VLT PYDS+ D+R FLQE+SK+LYMNNLPPDTTQSELESWFTQ+G RPVGFWTV
Sbjct: 200 PEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTV 259

Query: 283 KNIVEETXXXXXXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQ 342
           KNIVE+T             YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTKQ
Sbjct: 260 KNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQ 319

Query: 343 PRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCS 402
           PRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCS
Sbjct: 320 PRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCS 379

Query: 403 FPAASGA 409
           FPA S +
Sbjct: 380 FPAPSNS 386

 Score = 83.6 bits (205), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 39/55 (70%), Gaps = 3/55 (5%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG 540
           SN+PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      E    N Y D    G
Sbjct: 576 SNMPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASE---TNHYIDSSTFG 627

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFP-AASGAGMNNNGYM 417
           R GDW C +C + NF +   C RC  P + SG     N Y+
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYI 621

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 387

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  446 bits (1147), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 248/534 (46%), Positives = 315/534 (58%), Gaps = 50/534 (9%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGC-TLQDAVA 59
           M YV+LE++  H+ ++PKD ++I K  +Q ++   L  V  +   + +     + + A  
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANALGEVPTKVDQIVIDEQAESFKAAFE 60

Query: 60  QLEKDISEHAKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDRW 118
           +L + I+   +D  F+LCSL STW  RVT+ RQARD    +P  LQ+PK+FDL KEY RW
Sbjct: 61  KLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQRW 120

Query: 119 CMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA--E 176
           C+NHPE  + +      +T ++ + +  L    T  G     N       K E  GA  +
Sbjct: 121 CLNHPEVMSWKPKLESDKTINMDKKKLGLLELLTVLGLEDMYN------FKEENDGAIDD 174

Query: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDS 236
           ++   + D                     +T +  ++ QL  +C T+DD   VLT PYDS
Sbjct: 175 KMFKNERD---------------------MTISTSVLLQLLIRCTTSDDTKNVLTCPYDS 213

Query: 237 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXX 296
             DVR+FLQERS+VLYMNNLP DTTQSELESWFTQFG RPVGFWT KN+V +T       
Sbjct: 214 DTDVRSFLQERSRVLYMNNLPSDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTW 273

Query: 297 XXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356
                 YVE  DSI GFVVFQ+HEEA E L+LNGR+ILSN+ANTKQPRV+EH+VEIQPSS
Sbjct: 274 NSNNSPYVEELDSIPGFVVFQTHEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSS 333

Query: 357 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMN---- 412
             VLD+A EILS FPQSKNKPRPGDW+CPSCGFSNFQRRT+CFRCSFPA S   +N    
Sbjct: 334 TSVLDKAHEILSSFPQSKNKPRPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHINIKSQ 393

Query: 413 NNGYMKNPLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGXXXXXXXXXXXXXXXX 472
           NN +       HN + GSQQ    +          +  +    G                
Sbjct: 394 NNSHHPEITSEHNTE-GSQQNNTNRANASFNNSMYRYNTRYVNG-------------SSY 439

Query: 473 XXXXXXXXXXXXXSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPK-STEHQQK 525
                        SN+PFRAGDW CA+CTYHNFAKNV+CLRCGGPK ST +QQ+
Sbjct: 440 NQMNNNNHNNNTGSNIPFRAGDWNCASCTYHNFAKNVLCLRCGGPKTSTIYQQQ 493

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  433 bits (1114), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 236/556 (42%), Positives = 314/556 (56%), Gaps = 57/556 (10%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEP-VFEENKHVELG-NGCTLQDAV 58
           M YV++E++     DS KD +++ + +YQ +D ++LE      N+  +L   G  LQD V
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGSNLQDTV 60

Query: 59  AQLEKDISEHAK-DDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYDR 117
              EK+I+     ++FVLCS+ STW  RV +PR+A DE   LP  L++P V DLWKE+DR
Sbjct: 61  LLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEFDR 120

Query: 118 WCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAEQ 177
           WC NHP+ +        ++ K+L  +  VLG+   E+  +   N NG  + +        
Sbjct: 121 WCTNHPD-ALQSVKGYNRKCKNLPMVHQVLGV---EQRLNESVNANGYTRKEV------- 169

Query: 178 LVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDSY 237
                                       IT  +++  QLHKKC + DD + VLT PY+S 
Sbjct: 170 ---------------------------GITSDILL--QLHKKCSSDDDTNTVLTQPYNSK 200

Query: 238 LDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXX 297
           LD   F +E+S VLY+NNLPPDTTQ ELE+WF QFG+RPV FWT KNIVE+T        
Sbjct: 201 LDYETFTEEQSTVLYLNNLPPDTTQGELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWN 260

Query: 298 XXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSSA 357
                YVE QDS+SGF  FQ+ EEA  AL L+GRSILSN+ANTKQPR++EH+VEI PSSA
Sbjct: 261 LNNSYYVEEQDSVSGFATFQTFEEAFNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSA 320

Query: 358 RVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYM 417
           R+L  ++EILS FPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFP  S A  N+ G+ 
Sbjct: 321 RILHSSEEILSAFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPVPS-AVQNSTGFN 379

Query: 418 KNPLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGXXXXXXXXXXXXXXXXXXXXX 477
                  N           +  +  GL +   ++                          
Sbjct: 380 VESTANTNGHYNGGNNNFQQNASSFGLNSTAQKNN--------ITRLNSGSIHQQTNNSN 431

Query: 478 XXXXXXXXSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQ 537
                   + +PFRAGDWKCA C YHNFAKN++CLRC GPK++         + S+++  
Sbjct: 432 NNGNGNVMTTIPFRAGDWKCAACAYHNFAKNIICLRCSGPKTSHPHN-----LRSHSNYG 486

Query: 538 DIGNGMGISLNTRSFS 553
              N  GI LN+ +F+
Sbjct: 487 QEANTNGIFLNSLNFN 502

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  437 bits (1125), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 231/474 (48%), Positives = 303/474 (63%), Gaps = 20/474 (4%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVF--EENKHVELGN--GCTLQD 56
           M+Y+V+E +  H  ++PKD ++I+K +YQF+D E+LE  +  +E K + + +    + +D
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 57  AVAQLEKDISEHAKDD-FVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115
            + QL++DI     DD FV CSLNS W  RVTIPRQARDE+  LP +LQ  KVFDLWKE+
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 116 DRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA 175
           +RW  NH +T  ++++   +  ++L  +  +     T E    + N +  ++  A  +GA
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHA-NTGA 179

Query: 176 EQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYD 235
           E+       T           +   E P  I +   I+T +HKKC T +D +LVLT PYD
Sbjct: 180 EESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYD 239

Query: 236 SYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXX 295
           S  D + F +E SK+LYMNNLPPDTTQSELESWF QFG++PV FWTVKNIVEET      
Sbjct: 240 SNSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNN 299

Query: 296 XXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPS 355
                  YVE QDSISGFV FQSH+EAT+AL LNGRSILSN+ANTKQPRV+EHIVEIQPS
Sbjct: 300 WSMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPS 359

Query: 356 SARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNG 415
           S  VL+R Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCS+PAAS   +N+  
Sbjct: 360 SVTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN-NLNSRK 418

Query: 416 YM-------KNPLQPHNAQAG------SQQQAAYKMRTPAGLQAMQVQSGPHMG 456
           Y+        NPL  + +         +Q   A  M+  +  Q +Q +S P  G
Sbjct: 419 YVNNSNNMHNNPLNDNGSNLNILNTTPNQYNFALGMQHNSQPQGLQARSSPING 472

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 30/32 (93%)

Query: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519
           VPFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEH 522
           R GDW C +C + NF +   C RC  P ++ +
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYPAASNN 413

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAA 406
           R GDW C +C + NF +   C RC  P +
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  411 bits (1056), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 207/415 (49%), Positives = 268/415 (64%), Gaps = 58/415 (13%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCT---LQDA 57
           M+Y ++E++ AH  ++PKD ++I   +YQF++  TL+  F ++K   +   CT   L ++
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNID--CTTLPLSES 58

Query: 58  VAQLEKDISEHAK--DDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115
           +A L+KD+  +    +DFVLCSLNSTW  RVTI RQA+DE + LP   ++P++FDLWKE+
Sbjct: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118

Query: 116 DRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGA 175
           DRWC+NH E    R     ++ KDL ++ ++L +                          
Sbjct: 119 DRWCVNHKELVQTRD---PRKLKDLKQLATLLHI-------------------------- 149

Query: 176 EQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYD 235
                       PS E  SS          I+ A  ++ QLH+KC T DD+  VLT PYD
Sbjct: 150 ------------PSVETLSS----------ISLASKVLVQLHEKCTTEDDQEKVLTSPYD 187

Query: 236 SYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXX 295
           S LD   F++  S VLYMNNLPPDTTQSELE+WFTQFG RP+GFWTVKNI+E+T      
Sbjct: 188 SKLDWDIFIETSSTVLYMNNLPPDTTQSELETWFTQFGVRPIGFWTVKNILEDTSIINNN 247

Query: 296 XXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPS 355
                  YVE  DSISGF+VF +H+EA + L+LNG SILSNIANTKQPRV+EH+VEIQPS
Sbjct: 248 WCVNNSPYVEEIDSISGFIVFSTHKEAIDVLTLNGHSILSNIANTKQPRVVEHVVEIQPS 307

Query: 356 SARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAG 410
           S +V++R Q IL+PFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCSFP     G
Sbjct: 308 SPKVMERIQSILTPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPQQQAVG 362

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519
           SNVPFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 475 SNVPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAA 406
           R GDW C +CG+ NF +   C RCS P +
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 5/39 (12%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGT 529
           R GDW C +C + NF +   C RC  P     QQ+ +G+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFP-----QQQAVGS 363

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  387 bits (994), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 202/421 (47%), Positives = 262/421 (62%), Gaps = 43/421 (10%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPV---FEENKHVEL--------G 49
           M+Y+ +E E  H+ ++PKD +QI   +YQ ++ E  E +    ++N  V L        G
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 50  NGCTLQDAVAQLEKDISEH-AKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKV 108
           +  T +D + Q  +++ +    ++ VLCSLNSTW  RVTIPRQ+ DE  ILP  L+ P +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 109 FDLWKEYDRWCMNH-PETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQ 167
           FDLWKEY RWC  H  E + M+     K+ KD +E+  +L     E   + DA  N   +
Sbjct: 121 FDLWKEYQRWCNLHFSEINTMKT----KKYKDSSELYKIL-----EINQNSDAKTNN--E 169

Query: 168 SKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKS 227
              ++SG   +  G                    + + +   V +   +  KC T +D  
Sbjct: 170 KLNDRSGNINMDRGY-------------------KKNDVRSTVDVFMAIVDKCSTPEDHE 210

Query: 228 LVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVE 287
            VLTHPY+S +D + F+QE SK++YMNNLPPDTTQSELESWF QFG +P   WTV+NI+E
Sbjct: 211 SVLTHPYNSNVDFQTFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILE 270

Query: 288 ETXXXXXXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIE 347
            T             YVE  DSISGF VFQ+H+EAT+AL LNGRSILSN+ANTKQPRV+E
Sbjct: 271 STSYTNSNGNSNNSPYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVE 330

Query: 348 HIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPAAS 407
           HIVE+QPSS  +L+R QEI S FPQSKNKPRPGDWNC SCGFSNFQRRTSCFRCSFPAA+
Sbjct: 331 HIVELQPSSMVILERIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

Query: 408 G 408
            
Sbjct: 391 S 391

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519
           VPFRAGDWKC+ C+YHNFAKN+VCLRCGGPK+
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYMK-NPLQPHNAQAGSQQQ 433
           R GDW C +C + NF +   C RC  P       + N  M  N  Q +N  +  + Q
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGPKTQAILNDMNKSMSHNSGQKYNGHSNHKSQ 606

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKST 520
           R GDW C +C + NF +   C RC  P +T
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  315 bits (807), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 237/409 (57%), Gaps = 60/409 (14%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQF--LDTETLEPVFEENKHVELGNGC-TLQDA 57
           MHYVVLEVE  H E + KD ++I   +YQ   +D  TL         + + N     QDA
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 58  VAQLEKDI-SEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEYD 116
           + QL+ DI +   +++FV+C+LNS  + RVT+ RQA D    LP +L++PK+FDLW E+ 
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 117 RWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQNGGEQSKAEQSGAE 176
           ++C NHPE   +  N     +KD+A +  +LGL                           
Sbjct: 121 KFCANHPE---LDLNEEMVTSKDVAILTDILGL--------------------------- 150

Query: 177 QLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYDS 236
                               QS   +  TI  +  ++  L+KKC +++D   VLT PYD 
Sbjct: 151 --------------------QSNNTENYTIDISTDVLLSLYKKCSSSEDIKFVLTQPYDL 190

Query: 237 YLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXX 296
            +D++ F +E ++V++++NLPPD TQ+ELE+WF    ++P+ +WT K   E +       
Sbjct: 191 QMDIKTFYEEEARVIFISNLPPDITQNELETWFANHNSKPICYWTSKTPDEYSRNFHNN- 249

Query: 297 XXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356
                TYV  Q SI GF++FQ+HEEA ++L LNG+SI S+  + KQ   +EHI+E+ PSS
Sbjct: 250 -----TYVMNQHSIIGFIIFQTHEEAKQSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSS 304

Query: 357 ARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCSFPA 405
            +VLD  Q+IL PFPQSKNKPR GDWNCPSCGFSNFQRRT+CFRCSFPA
Sbjct: 305 TKVLDHTQDILIPFPQSKNKPRLGDWNCPSCGFSNFQRRTACFRCSFPA 353

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 30/33 (90%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPK 518
           S+VPFRAGDWKC +CTYHNFAKN+ CLRCG PK
Sbjct: 444 SSVPFRAGDWKCPSCTYHNFAKNIACLRCGDPK 476

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASG 408
           R GDW CPSC + NF +  +C RC  P  SG
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLSG 479

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGP 517
           R GDW C +C + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  274 bits (700), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 157/430 (36%), Positives = 230/430 (53%), Gaps = 63/430 (14%)

Query: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKHVELGNGCTLQDAVAQ 60
           MHYVVL+V++    DS      + +  YQ +D  +LE   E   +V   +G ++++ +A+
Sbjct: 1   MHYVVLDVQI----DSSAVKPVLLRLGYQVIDPVSLEARNE--PYVVDVDGESIKEFIAK 54

Query: 61  LEKDISEHA------------------KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPH 102
           L++D+  HA                  + +FV C+LN +W  +V +   A D    LP +
Sbjct: 55  LDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVELPEY 114

Query: 103 LQHPKVFDLWKEYDRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQ 162
           L++P  FD+WKEY  W  NH ++S   Q                               Q
Sbjct: 115 LRYPVFFDIWKEYSIWKKNHSDSSESPQT------------------------------Q 144

Query: 163 NGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVT 222
             GE   +     E+LV     T   STE    +Q   +    +  A +++T LHKKCVT
Sbjct: 145 ANGESIDSFAGKIEELVR----TLDVSTEYDELKQKNDDPTFDVRLATLVLTALHKKCVT 200

Query: 223 ADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTV 282
             D + VLT PYD  +D +NF++E+SK+LY++N+P +  Q++LE WF Q G   VGFWT+
Sbjct: 201 PVDDTTVLTVPYDLGMDYKNFIEEQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTL 260

Query: 283 KNIVEETXXXXXXXXXXXXTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQ 342
           KNI ++               +   DS+ GF +FQSH +A  AL+L+G   +  I   K 
Sbjct: 261 KNISDDATLASQRNHGKM---LSIPDSMFGFAIFQSHNDAEYALNLHG--TVMKIVAPKG 315

Query: 343 PRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCS 402
            + IE +++IQPSS R+L++ Q+ L   PQ+KNKPRPGDWNCPSCGFSNFQRRT+CFRC+
Sbjct: 316 NKHIEQLLDIQPSSMRLLEKVQDNLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCA 375

Query: 403 FPAASGAGMN 412
           FP  +G   N
Sbjct: 376 FPVPNGVSGN 385

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%)

Query: 486 SNVPFRAGDWKCATCTYHNFAKNVVCLRCGGPKS 519
           SNVPFRAGDWKC  C YHNFAKN+VCLRCGGPK+
Sbjct: 530 SNVPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKT 563

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 20/45 (44%)

Query: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFPAASGAGMNNNGYMKNPLQ 422
           R GDW CP C + NF +   C RC  P       + N    + LQ
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTTTRDKNNQDGDTLQ 579

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 491 RAGDWKCATCTYHNFAKNVVCLRCGGP 517
           R GDW C +C + NF +   C RC  P
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFP 377

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 250 VLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNI 285
           VL + NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 234 VLLVQNLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 50/122 (40%), Gaps = 26/122 (21%)

Query: 251 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXXXXTYVEAQDSI 310
           +Y+ N+ P+T Q E E  F+Q+GA       + + V ET               E +   
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGA-------ITSAVLETDN-------------EGKLRG 262

Query: 311 SGFVVFQSHEEATEAL------SLNGRSILSNIANTKQPRVIEHIVEIQPSSARVLDRAQ 364
            GFV F+ H  A +A+        NG+ +    A  K  R+ E   + + S    L + Q
Sbjct: 263 FGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQ 322

Query: 365 EI 366
            +
Sbjct: 323 GV 324

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 23/35 (65%)

Query: 251 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNI 285
           +Y   LP +TT ++L ++FT +G+R +  +  KN+
Sbjct: 185 VYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>TBLA0B04730 Chr2 complement(1106452..1109436) [2985 bp, 994 aa]
           {ON} 
          Length = 994

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 772 EAEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 823

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 782 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 833

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 792 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 843

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 802 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 853

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 812 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 863

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 822 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 873

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 832 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 883

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 842 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 893

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AE+ ++
Sbjct: 852 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEKRES 903

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAE 201
           E    +A Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AE
Sbjct: 862 ESEQREAEQRESEQREAEQRESEQREAEQRESEQREAEKRESEQRKAE 909

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 154 EGAHPDANQNGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDT 205
           E    +  Q   EQ +AEQ  +EQ  A Q +++Q   E   SEQ  AEQ ++
Sbjct: 762 ETEQRETEQREAEQREAEQRESEQREAEQRESEQREAEQRESEQREAEQRES 813

>Ecym_1302 Chr1 complement(613499..614365) [867 bp, 288 aa] {ON}
           similar to Ashbya gossypii AAL018W
          Length = 288

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 246 ERSKVLYMNNLPPDTTQSELESWFTQFG 273
           ERS+++Y  N+PP T +S+L   F   G
Sbjct: 207 ERSRIIYCENMPPATVESDLYDLFETIG 234

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 20/76 (26%)

Query: 251 LYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXXXXTYVEAQDSI 310
           +Y+ N+  +TTQ E E+ FTQFG        + + V E                E +   
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFG-------KITSAVLERDS-------------EGKPRG 262

Query: 311 SGFVVFQSHEEATEAL 326
            GF+ F+ HE A +A+
Sbjct: 263 FGFINFEDHESAAKAV 278

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 250 VLYMNNLPPDTTQSELESWFT-QFGARPVGF 279
            LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 554 TLYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>YHR015W Chr8 (134554..136533) [1980 bp, 659 aa] {ON}  MIP6Putative
           RNA-binding protein, interacts with Mex67p, which is a
           component of the nuclear pore involved in nuclear mRNA
           export
          Length = 659

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 37/90 (41%), Gaps = 21/90 (23%)

Query: 247 RSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXXXXTYVEA 306
           RSK + + NLP DTTQ E+  +F+  G     F + K                     +A
Sbjct: 311 RSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFISEK---------------------QA 349

Query: 307 QDSISGFVVFQSHEEATEALSLNGRSILSN 336
                 FV +++ EE+ +A     ++I  N
Sbjct: 350 NTPHKAFVTYKNEEESKKAQKCLNKTIFKN 379

>SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {ON}
           similar to uniprot|P39946 Saccharomyces cerevisiae
           YOR269W PAC1 Protein involved in nuclear migration part
           of the dynein/dynactin pathway targets dynein to
           microtubule tips which is necessary for sliding of
           microtubules along bud cortex synthetic lethal with bni1
           homolog of human LIS1
          Length = 470

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 7   EVELAHREDS--PKDWSQIAKFNYQFLDTE-TLEPVFEENKHVE--LGNGCTLQDAVAQL 61
           +V+++  +D+  PK W+ I +   + LD E  +E + EEN  +   LGNG T    +A++
Sbjct: 49  DVDISTTQDNLLPKKWNSIVRLQRKILDLEKKIEALTEENDSLRNSLGNGSTSLSTIAKI 108

>NCAS0G02580 Chr7 complement(461003..461677) [675 bp, 224 aa] {ON}
           Anc_2.167
          Length = 224

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 244 LQERSKVLYMNNLPPDTTQSELESWFTQFG 273
           L E S +LY++ LP    + EL  +F+QFG
Sbjct: 89  LAEYSSILYVSRLPQGFHERELSKYFSQFG 118

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 249 KVLYMNNLPPDTTQSELESWF-TQFGARPVGF 279
             LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 608 NTLYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 250 VLYMNNLPPDTTQSELESWF-TQFGARPVGF 279
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 546 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 32.0 bits (71), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 250 VLYMNNLPPDTTQSELESWF-TQFGARPVGF 279
            LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 522 TLYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>NDAI0F02720 Chr6 (668516..669196) [681 bp, 226 aa] {ON} Anc_2.167
          Length = 226

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 241 RNFLQERSKVLYMNNLPPDTTQSELESWFTQFG 273
           +N L + S ++Y++ LP    + EL  +F+QFG
Sbjct: 89  KNALADYSSIIYVSRLPHGFHEKELSKYFSQFG 121

>Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON}
           YDL224C (REAL)
          Length = 652

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 45/110 (40%), Gaps = 13/110 (11%)

Query: 176 EQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVTADDKSLVLTHPYD 235
           EQ   G P  K+PS+  +S+   P      +  +  I         +  D SL+   P  
Sbjct: 475 EQDTTGLPQQKEPSSTAASASVFPKNNETNVAGSTTI---------SQADLSLLAKVPPP 525

Query: 236 SYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFT-QFGARPVGFWTVKN 284
           +    +N        LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 526 ANPADQN---PPCNTLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 572

>Kpol_1069.8 s1069 (14170..15519) [1350 bp, 449 aa] {ON}
           (14170..15519) [1350 nt, 450 aa]
          Length = 449

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 53/132 (40%), Gaps = 25/132 (18%)

Query: 251 LYMNNLPPD-TTQSELESWFTQFGARPVGFWTVKNIVEETXXXXXXXXXXXXTYVEAQDS 309
           +Y+ NL  D  T+ +L  WF++FG        +K +  E                E  ++
Sbjct: 204 IYITNLDSDQITEQKLSEWFSKFG----DIERIKLVKNEN---------------EPGNT 244

Query: 310 ISGFVVFQSHEEATEAL-----SLNGRSILSNIANTKQPRVIEHIVEIQPSSARVLDRAQ 364
              F+ F S + AT+AL     +L G +I   +AN K     + +  I  S+ R  D   
Sbjct: 245 SYAFISFTSSDSATKALELHKETLEGNTITVTLANKKSYLERQEVKRIIYSNRRQNDDLM 304

Query: 365 EILSPFPQSKNK 376
             L P     +K
Sbjct: 305 ISLYPLSDKTSK 316

>ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL224C
           (WHI4) and YNL197C (WHI3)
          Length = 729

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 250 VLYMNNLPPDTTQSELESWF-TQFGARPVGF 279
            LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 608 TLYVGNLPPDATEQELRQLFSSQKGFRRLSF 638

>NCAS0C05920 Chr3 (1218910..1219773) [864 bp, 287 aa] {ON} Anc_4.7
           YHL034C
          Length = 287

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 21/128 (16%)

Query: 246 ERSK-VLYMNNLPPDTTQSELESWFTQFGARP-VGFWTVKNIVEETXXXXXXXXXXXXTY 303
           ERSK  LY+NNLP   T+ EL      FG +P +     + + +ET             +
Sbjct: 168 ERSKDTLYVNNLPYSATKEELAEL---FGTKPELVVLPKRRMRDET--------TKKVVF 216

Query: 304 VEAQDSISGFVVFQS-------HEEATEALSLNGRSILSNIANTKQPRVIEHIVEIQPSS 356
            E  +    F+ F++         E  +  +L  R ++ ++A  K P+  EH+ E  P +
Sbjct: 217 SETLNRGIAFITFENLSGDIADKREEFQGKTLEERELVVDVAVVK-PKREEHVEEAHPDA 275

Query: 357 ARVLDRAQ 364
               + AQ
Sbjct: 276 EESHEEAQ 283

>YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}
           WHI4Putative RNA binding protein and partially redundant
           Whi3p homolog that regulates the cell size requirement
           for passage through Start and commitment to cell
           division
          Length = 649

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 250 VLYMNNLPPDTTQSELESWFT-QFGARPVGFWTVKN 284
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 534 TLYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 569

>Skud_4.30 Chr4 complement(50997..52952) [1956 bp, 651 aa] {ON}
           YDL224C (REAL)
          Length = 651

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 1/36 (2%)

Query: 250 VLYMNNLPPDTTQSELESWFT-QFGARPVGFWTVKN 284
            LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 535 TLYVGNLPPDATEQELRQLFSNQPGFRRLSFRNKMN 570

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,035,605
Number of extensions: 2327372
Number of successful extensions: 8346
Number of sequences better than 10.0: 69
Number of HSP's gapped: 8524
Number of HSP's successfully gapped: 149
Length of query: 557
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 442
Effective length of database: 40,294,809
Effective search space: 17810305578
Effective search space used: 17810305578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)