Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01254g7.350ON38138118970.0
Kwal_56.246427.350ON38138118060.0
SAKL0F11374g7.350ON38338316490.0
NCAS0A141607.350ON45138016410.0
KLLA0D12342g7.350ON38438016200.0
Kpol_530.317.350ON38037616030.0
Ecym_47237.350ON38137915830.0
CAGL0L01111g7.350ON38138115730.0
YDL168W (SFA1)7.350ON38637415730.0
Suva_4.787.350ON38537815720.0
Skud_4.897.350ON38537815710.0
TDEL0C019807.350ON38538015690.0
TBLA0E00390singletonON38338015620.0
Smik_4.707.350ON38637815590.0
TPHA0F029707.350ON38137715420.0
ZYRO0F11704g7.350ON38237915310.0
ACL148C7.350ON38137814980.0
KAFR0B008807.350ON38137814750.0
NDAI0A018907.350ON42238013900.0
KNAG0C037907.350ON38237813710.0
SAKL0A00880gsingletonON38837711131e-151
SAKL0B00814g8.16ON3543922133e-18
NCAS0I023503.118ON3513872054e-17
Suva_4.3943.118ON3513912011e-16
KLLA0D19929gsingletonON3863472012e-16
Kwal_55.19574singletonON3562001974e-16
KLLA0B00451gsingletonON3863741975e-16
SAKL0C10164g3.118ON3513831957e-16
TBLA0I011402.480ON3773801941e-15
KLTH0G18986g8.16ON3543661931e-15
CAGL0J01441g2.480ON3723811932e-15
KLLA0F21010g3.118ON3503951894e-15
KLTH0D00616g7.3ON3823961896e-15
Ecym_53313.118ON3483871877e-15
AER032W3.118ON3513861861e-14
YBR145W (ADH5)3.118ON3513801851e-14
YLR070C (XYL2)8.16ON3562001833e-14
KLTH0G15686g3.118ON3513901824e-14
TPHA0G032102.480ON3773801824e-14
Skud_20.2singletonON3572001815e-14
Skud_4.2singletonON3572001815e-14
SAKL0F06270gna 1ON3513831806e-14
KNAG0K020003.118ON3503921806e-14
KLLA0B09064gna 2ON3743811781e-13
Skud_2.2723.118ON3513841771e-13
CAGL0I07843g3.118ON3523901762e-13
KLTH0D05588g2.480ON3893801763e-13
Smik_2.2843.118ON3513911753e-13
Smik_48.1singletonON3572351735e-13
NCAS0I01720singletonON3513801719e-13
KLLA0F00506g7.3ON3852051711e-12
YOL086C (ADH1)3.118ON3483901701e-12
Skud_13.2402.480ON3753801711e-12
SAKL0B08184gna 2ON3733741711e-12
KAFR0A007902.480ON3773841711e-12
KAFR0G014203.118ON3513901701e-12
NDAI0H021602.480ON3813801701e-12
YDL246C (SOR2)singletonON3572351692e-12
YJR159W (SOR1)na 3ON3572041682e-12
YMR083W (ADH3)2.480ON3753801682e-12
Skud_15.683.118ON3483831673e-12
NDAI0A069303.118ON3513871673e-12
Smik_15.713.118ON3483901673e-12
Suva_12.260singletonON3573681664e-12
NCAS0A077802.480ON3733831664e-12
KLLA0F18260gsingletonON3482641655e-12
Skud_13.477na 4ON3483871655e-12
Smik_13.2662.480ON3753801656e-12
TBLA0E03430singletonON3513901646e-12
Ecym_73912.480ON3753851657e-12
Smik_13.520na 4ON3483021647e-12
CAGL0D00198g7.3ON3833271647e-12
ZYRO0B05940g3.118ON3793911647e-12
Suva_15.813.118ON3483871647e-12
TPHA0M007303.118ON3503951647e-12
KLLA0F13530g2.480ON3753801649e-12
YAL060W (BDH1)7.3ON3822161631e-11
Kwal_26.77992.480ON3873801631e-11
YMR303C (ADH2)na 4ON3483871612e-11
Suva_10.1548.16ON3562021612e-11
AAR084WsingletonON3853021612e-11
Suva_13.494na 4ON3483021602e-11
Smik_1.67.3ON3822181612e-11
SAKL0E02838g2.480ON3772641603e-11
TBLA0E034403.118ON3513831593e-11
Suva_13.2612.480ON3753801603e-11
Kpol_1058.118.16ON3531881593e-11
Kwal_26.6684singletonON3563651567e-11
Kwal_56.231983.118ON3513901551e-10
KLTH0E05588gna 1ON3483831551e-10
TDEL0D050503.118ON3513021551e-10
Skud_1.37.3ON3822161551e-10
ABL033C2.480ON3733851541e-10
ZYRO0G03388g2.480ON3703801541e-10
SAKL0D14872g7.3ON3832181542e-10
TDEL0A025602.480ON3733871532e-10
Kpol_1036.193.118ON3533901522e-10
TBLA0A042907.3ON3952171523e-10
Kwal_26.67397.3ON3822221497e-10
ZYRO0C12562gna 1ON3483831488e-10
NDAI0H020507.3ON3851411489e-10
KAFR0I001707.3ON3811801481e-09
Suva_1.77.3ON3822181471e-09
ZYRO0G03410gsingletonON3733691471e-09
Kwal_56.229853.253ON3461581461e-09
KNAG0K01040singletonON3912431461e-09
NCAS0A076607.3ON3861431434e-09
Kpol_1049.187.2ON3862191424e-09
KAFR0L02010singletonON3512641399e-09
TDEL0F03190na 1ON3513921391e-08
Kwal_55.20564singletonON2162301361e-08
Kpol_431.82.480ON3802491381e-08
TDEL0H044607.3ON3822761381e-08
KLTH0A00418gsingletonON3562611372e-08
ABR229C8.16ON3533601362e-08
NCAS0A076707.2ON4392171373e-08
SAKL0D14894g7.2ON3852181363e-08
KLLA0D05511g8.16ON3542031354e-08
Smik_2.1703.253ON3342201344e-08
KAFR0I001607.2ON3852551345e-08
ZYRO0F02552g8.16ON3511971336e-08
KNAG0E025902.480ON3742641336e-08
NCAS0J003008.16ON3571081327e-08
KAFR0L02000singletonON3612971311e-07
YBR046C (ZTA1)3.253ON3342201301e-07
YAL061W (BDH2)7.2ON4172171292e-07
Suva_1.67.2ON4172071274e-07
TDEL0C003908.16ON3532691231e-06
Suva_4.2793.253ON3341581221e-06
TDEL0D037203.253ON3351561212e-06
KLTH0C07854g3.253ON3582571212e-06
Smik_1.57.2ON4172171203e-06
Skud_1.27.2ON4172171203e-06
KNAG0I00120singletonON3811521194e-06
KAFR0C005803.253ON3342321175e-06
KLLA0A10549g3.253ON3531581132e-05
KNAG0D00110singletonON3623401132e-05
NDAI0H02950singletonON3633401113e-05
ZYRO0A03366g3.253ON3492231104e-05
NCAS0C03020singletonON3623611104e-05
ABL090W3.253ON3341531079e-05
NDAI0A063203.253ON3491791051e-04
Kwal_47.17532na 5ON3733021052e-04
KLLA0F00638gna 6ON382154970.002
KLTH0E07964gna 5ON374235950.003
TPHA0H03100singletonON392281950.004
Skud_86.1singletonON8959860.005
TPHA0J00170singletonON361296900.011
NDAI0G04880singletonON361344900.013
NCAS0D01220na 7ON362350900.013
CAGL0H06853gsingletonON360366870.028
CAGL0M14047gna 8ON359365860.042
TDEL0A00140singletonON405152850.050
NDAI0A08470singletonON363350840.059
NDAI0H020607.2ON399246840.067
KLLA0F00528g7.2ON381227830.10
SAKL0H22088gna 5ON376312820.11
YMR318C (ADH6)na 8ON360347820.11
KNAG0E042007.2ON385317810.16
Suva_13.513na 8ON360347760.55
Smik_13.535na 8ON360359760.59
Suva_6.13singletonON6859690.64
SAKL0H00374gsingletonON428367760.76
Smik_2.3singletonOFF21636731.1
KAFR0A08730singletonON360341741.2
Skud_13.494na 8ON360355731.5
CAGL0H09944g3.253ON333207702.9
KLTH0C10538gsingletonON273156694.1
NDAI0K009208.757ON171886704.7
TPHA0A00140singletonON362364694.8
NDAI0G005201.450ON57579686.2
KLTH0F01056g1.29ON77155679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01254g
         (381 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   735   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   700   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   639   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   636   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   628   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   622   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   614   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   610   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   610   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   610   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   609   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   608   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      606   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   605   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   598   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   594   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   581   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   572   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    540   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   532   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   433   e-151
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    87   3e-18
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     84   4e-17
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    82   1e-16
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    82   2e-16
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    80   4e-16
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    80   5e-16
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    80   7e-16
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    79   1e-15
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    79   1e-15
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    79   2e-15
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    77   4e-15
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    77   6e-15
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    77   7e-15
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    76   1e-14
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    76   1e-14
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    75   3e-14
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    75   4e-14
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    75   4e-14
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     74   5e-14
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    74   5e-14
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    74   6e-14
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    74   6e-14
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    73   1e-13
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    73   1e-13
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    72   2e-13
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    72   3e-13
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    72   3e-13
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    71   5e-13
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               70   9e-13
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    70   1e-12
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    70   1e-12
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    70   1e-12
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    70   1e-12
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    70   1e-12
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    70   1e-12
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     70   1e-12
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    70   2e-12
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    69   2e-12
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    69   2e-12
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    69   3e-12
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    69   3e-12
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    69   3e-12
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    69   4e-12
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    69   4e-12
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    68   5e-12
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    68   5e-12
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    68   6e-12
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               68   6e-12
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    68   7e-12
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    68   7e-12
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    68   7e-12
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    68   7e-12
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    68   7e-12
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    68   7e-12
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    68   9e-12
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    67   1e-11
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    67   1e-11
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    67   2e-11
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    67   2e-11
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    67   2e-11
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    66   2e-11
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     67   2e-11
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    66   3e-11
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    66   3e-11
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    66   3e-11
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    66   3e-11
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    65   7e-11
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    64   1e-10
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    64   1e-10
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    64   1e-10
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     64   1e-10
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    64   1e-10
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    64   1e-10
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    64   2e-10
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    64   2e-10
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    63   2e-10
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    63   3e-10
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    62   7e-10
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    62   8e-10
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    62   9e-10
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    62   1e-09
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     61   1e-09
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    61   1e-09
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    61   1e-09
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    61   1e-09
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    60   4e-09
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    59   4e-09
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              58   9e-09
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    58   1e-08
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    57   1e-08
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    58   1e-08
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    58   1e-08
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    57   2e-08
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    57   2e-08
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    57   3e-08
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    57   3e-08
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    57   4e-08
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    56   4e-08
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    56   5e-08
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    56   6e-08
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    56   6e-08
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       55   7e-08
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              55   1e-07
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    55   1e-07
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    54   2e-07
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     54   4e-07
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    52   1e-06
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    52   1e-06
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    51   2e-06
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    51   2e-06
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     51   3e-06
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      51   3e-06
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  50   4e-06
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    50   5e-06
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    48   2e-05
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   48   2e-05
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    47   3e-05
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    47   4e-05
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    47   4e-05
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    46   9e-05
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    45   1e-04
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    45   2e-04
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    42   0.002
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    41   0.003
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    41   0.004
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    38   0.005
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                39   0.011
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    39   0.013
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               39   0.013
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    38   0.028
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    38   0.042
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 37   0.050
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             37   0.059
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    37   0.067
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    37   0.10 
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    36   0.11 
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    36   0.11 
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    36   0.16 
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    34   0.55 
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    34   0.59 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    31   0.64 
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    34   0.76 
Smik_2.3 Chr2 complement(6099..6290,6294..6323,6327..6398,6402.....    33   1.1  
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    33   1.2  
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    33   1.5  
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    32   2.9  
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    31   4.1  
NDAI0K00920 Chr11 (205240..210396) [5157 bp, 1718 aa] {ON} Anc_8...    32   4.7  
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 31   4.8  
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    31   6.2  
KLTH0F01056g Chr6 complement(80904..83219) [2316 bp, 771 aa] {ON...    30   9.8  

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/381 (95%), Positives = 363/381 (95%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG
Sbjct: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
           AFPSIL                  KAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG
Sbjct: 61  AFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240
           GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT
Sbjct: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240

Query: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300
           DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA
Sbjct: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360
           AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360

Query: 361 NSAFEDLHHGDCLRTVLDLSK 381
           NSAFEDLHHGDCLRTVLDLSK
Sbjct: 361 NSAFEDLHHGDCLRTVLDLSK 381

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/381 (89%), Positives = 355/381 (93%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           MSEGKPITC AAVAYEAGKPLT+EEIVVDPPKAHEVR+K+ YTAVCHTDAYTLSGVDPEG
Sbjct: 1   MSEGKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEG 60

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
           AFPSIL                  K GDHVIALYTAECKECKFCKSGKTNLCGSVRATQG
Sbjct: 61  AFPSILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120

Query: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGT+RFHNKKGED+LHFMGCSTFSQYTV+ADVSVVAIDPKAPLDKTCLLGCGVTT
Sbjct: 121 KGVMPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTT 180

Query: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240
           GYGAAVKTA+VQKGDTVA+FGAGTVGLSVVQGA VRGAS+IIVVDINDQKKQW+ +FGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGAT 240

Query: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300
           DFVNPSK LKDG+TIVD LVEMTDGGLD+TFDCTGNTDVMRSALEACHKGWG+SIIIGVA
Sbjct: 241 DFVNPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360
           AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+SDYMDGKLKVDEFITHRRGFTDI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDI 360

Query: 361 NSAFEDLHHGDCLRTVLDLSK 381
           NSAFEDLHHGDCLRTVLDL K
Sbjct: 361 NSAFEDLHHGDCLRTVLDLLK 381

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/383 (83%), Positives = 345/383 (90%), Gaps = 2/383 (0%)

Query: 1   MSE--GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP 58
           MSE  GKPITC AAVAYEAGKPLTVEEI+V+PPKAHEVRI++ YTAVCHTDAYTLSGVDP
Sbjct: 1   MSETVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDP 60

Query: 59  EGAFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRAT 118
           EGAFPSIL                  K GDHV+ALYTAEC++CKFC SGKTNLCGSVRAT
Sbjct: 61  EGAFPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRAT 120

Query: 119 QGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGV 178
           QGKGVMPDGTSRF  K GE +LHFMGCSTFSQYTVVADVSVVA+D +APLD+ CLLGCGV
Sbjct: 121 QGKGVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGV 180

Query: 179 TTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238
           TTGYGAA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGAS+IIVVDINDQKKQW+ DFG
Sbjct: 181 TTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFG 240

Query: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIG 298
           ATDFVNPSK LK+G+TIV KL+E+TDGGLDFTFDCTGNT VMR ALEACHKGWGQSIIIG
Sbjct: 241 ATDFVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIG 300

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFT 358
           VAAAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDG+LKVDEFITHRR FT
Sbjct: 301 VAAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFT 360

Query: 359 DINSAFEDLHHGDCLRTVLDLSK 381
           +IN+AF+DLHHGDCLRTVLDLSK
Sbjct: 361 EINAAFDDLHHGDCLRTVLDLSK 383

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/380 (83%), Positives = 340/380 (89%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           ++GKPITCTAAVAY AGKPLTVE+IVVDPPKAHEVRIK+EYTAVCHTDAYTLSG+DPEGA
Sbjct: 72  TQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPEGA 131

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSIL                  K GDHVIALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 132 FPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQGK 191

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTSRFHN+KGE LLHFMGCSTFSQYTVVADVSVVA+DPKAPLD   LLGCGVTTG
Sbjct: 192 GVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVTTG 251

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVDIN+ KKQWS DFGATD
Sbjct: 252 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGATD 311

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           FVNP + LK+G+TIV KL+EMTDGGL++TFDCTGN  VMR ALEACHKGWG+SIIIGVA 
Sbjct: 312 FVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGVAG 371

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +GKLKVDEFITHRR FT+IN
Sbjct: 372 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTEIN 431

Query: 362 SAFEDLHHGDCLRTVLDLSK 381
            AFEDLHHGDCLRTVLDL+K
Sbjct: 432 DAFEDLHHGDCLRTVLDLAK 451

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/380 (79%), Positives = 330/380 (86%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           + GKPI C AAVAYEAGKPLTVE+I+VD PKAHEVR++V +TAVCHTDAYTLSGVDPEGA
Sbjct: 5   TAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVDPEGA 64

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSIL                  K GDHV+ LYTAEC +CKFCKS KTNLCGSVRATQGK
Sbjct: 65  FPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRATQGK 124

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGT+RFHN KGE LLHFMGCSTFSQYTVVADVS+V IDP APL   CLLGCGVTTG
Sbjct: 125 GVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCGVTTG 184

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAAVKTA+VQ+GDTVA+FGAGTVGLSVVQGA  RGASKIIVVD+NDQKKQWS+DFGAT 
Sbjct: 185 YGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDFGATG 244

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           FVNP K LK+G+TIV KL++MTDGGLDFTFDCTGN  VMR ALEACHKGWGQSIIIGVAA
Sbjct: 245 FVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIIIGVAA 304

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQL+TGRVWKGSAFGGIKGRSEMG LV+ Y  G LKVD+FITH+R FT+IN
Sbjct: 305 AGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPFTEIN 364

Query: 362 SAFEDLHHGDCLRTVLDLSK 381
           +AFEDLHHGDCLRTVLDL+ 
Sbjct: 365 NAFEDLHHGDCLRTVLDLAN 384

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/376 (80%), Positives = 324/376 (86%), Gaps = 1/376 (0%)

Query: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63
           GKPITC AAVAYEA KPL VEEIVVDPPKAHEVRIK+  TAVCHTDAYTLSGVDPEG FP
Sbjct: 5   GKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEGLFP 64

Query: 64  SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +L                  K GDHV+ALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 65  CVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGT RFHNKKGE L HFMGCSTFS+YTVVADVSVVAIDP APLD  CLLGCGVTTGYG
Sbjct: 125 MPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTTGYG 184

Query: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVDIN+ KK+WS +FGATDFV
Sbjct: 185 AAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGATDFV 244

Query: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
           NPS+ L +GQ IV KLVEMTDGGLDFTFDCTGN +VMR ALEACHKGWGQSIIIGVAAAG
Sbjct: 245 NPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVAAAG 303

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363
           KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFIT+RR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEINDA 363

Query: 364 FEDLHHGDCLRTVLDL 379
           FE+LHHG+CLRTVL  
Sbjct: 364 FEELHHGNCLRTVLSF 379

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/379 (78%), Positives = 321/379 (84%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           ++ GK I C AA+AY AG PL +E I VDPPKAHEVRIK+ +TA+CHTDAYTLSGVDPEG
Sbjct: 3   ITAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEG 62

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
            FPSIL                  K GDHVI LYTAEC+ECKFC SGKTNLCGSVRATQG
Sbjct: 63  IFPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQG 122

Query: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KG+MPDGTSRF N KGE + HFMGCSTFS+YTVVADVSVVAID KAPLDK CLLGCGVTT
Sbjct: 123 KGLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTT 182

Query: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240
           GYGAAVKTADVQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVDIND KK+WS DFGAT
Sbjct: 183 GYGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGAT 242

Query: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300
           DF+NP+K L DG+TIV KL++MTDGGLD TFDCTGNT VMR ALEACHKGWGQSIIIGVA
Sbjct: 243 DFINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVA 302

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360
           AAG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMG L+SDY  GKLKVDEF+TH R F++I
Sbjct: 303 AAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEI 362

Query: 361 NSAFEDLHHGDCLRTVLDL 379
           N    DLHHGDCLRTVL+ 
Sbjct: 363 NDGLTDLHHGDCLRTVLNF 381

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/381 (76%), Positives = 322/381 (84%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           M+EGKPI C AAVAYEAGKP  VE+IVVDPPKAHEVRIK+  TAVCHTDAYTLSG DPEG
Sbjct: 1   MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEG 60

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
            FP +L                  K GDHVIALYTAEC++CKFC SGKTNLCG+VRATQG
Sbjct: 61  LFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQG 120

Query: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGTSRFHNKKGE L HFMGCSTFS+YTVVADVSVVAID  APL+  CLLGCGVTT
Sbjct: 121 KGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTT 180

Query: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240
           GYGAAVKTA+VQKGDTVA+FG GTVGLSV+QGAH RGAS+II +D NDQKK +   FGAT
Sbjct: 181 GYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGAT 240

Query: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300
           DF+NP+K LK+ +TIV KL+EMTDGGLD TFDCTGN +VMRSALEACHKGWGQS+IIGVA
Sbjct: 241 DFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVA 300

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360
           AAG+EISTRPFQLVTGRVWKGSAFGG+KGRSEM GL+  Y  G+LKVDEFITHRR F +I
Sbjct: 301 AAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEI 360

Query: 361 NSAFEDLHHGDCLRTVLDLSK 381
           N AF+DLH+G CLRTVL  SK
Sbjct: 361 NEAFDDLHNGLCLRTVLSFSK 381

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/374 (78%), Positives = 321/374 (85%)

Query: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C AAVAY+A KPL+VEEI VD PKAHEVRIK+EYTAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +L                  K GDHVIALYTAEC +CKFC SGKTNLCG+VRATQGKGV
Sbjct: 67  CVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGT+RFHN KGED+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD  CLLGCGVTTG+G
Sbjct: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFG 186

Query: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AA+KTA+VQKGDTVA+FG GTVGLSV+QGA +RGASKII +DIN++KKQ+   FGATDFV
Sbjct: 187 AALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQFGATDFV 246

Query: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
           NP + L   QTIV+KL+EMTDGGLDFTFDCTGNT +MR ALEACHKGWGQSIIIGVAAAG
Sbjct: 247 NPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQA 366

Query: 364 FEDLHHGDCLRTVL 377
           FEDLH+GDCLRTVL
Sbjct: 367 FEDLHNGDCLRTVL 380

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/378 (77%), Positives = 320/378 (84%)

Query: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C AA+AY+A KPL+VEEI VDPPKAHEVRIK+EYTAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            IL                  K GDHVIALYTAEC +CKFC SGKTNLC +VRATQG+G+
Sbjct: 67  CILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGRGI 126

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPD T+RFHN KGED+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD   LLGCGVTTGYG
Sbjct: 127 MPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCGVTTGYG 186

Query: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AAVKTA+VQKGDTVA+FG GTVGLSV+QGA  RGASKII +DIN++KKQ+  DFGATDF+
Sbjct: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDFGATDFI 246

Query: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
           NP + L  GQTIV+KL+E TDGGLDFTFDCTGNT +MR ALEACHKGWGQSIIIGVAAAG
Sbjct: 247 NPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPFKEINQA 366

Query: 364 FEDLHHGDCLRTVLDLSK 381
           FEDLH GDCLRTVL   K
Sbjct: 367 FEDLHQGDCLRTVLKFDK 384

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/378 (76%), Positives = 323/378 (85%)

Query: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C AAVAY A K L+VEEI VDPPKAHEVRIK+E+TAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            IL                  K GDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 67  CILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGT+RFHN KGED+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD  CLLGCGVTTGYG
Sbjct: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGYG 186

Query: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AA+KTA+VQ+GDTVA+FG GTVGLSV+QGA  RGASKII VDIN++K+Q+S +FGATDF+
Sbjct: 187 AAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNFGATDFI 246

Query: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
           NP + L + QTIV+KL++MTDGGLDFTFDCTGNT++MR ALEACHKGWGQSIIIGVAAAG
Sbjct: 247 NPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPFKEINQA 366

Query: 364 FEDLHHGDCLRTVLDLSK 381
           FEDLH+GDCLRTVL   +
Sbjct: 367 FEDLHNGDCLRTVLRFQE 384

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/380 (79%), Positives = 331/380 (87%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           +EGK ITC AAVAYEAGKPLTVEEI V+ P+AHEVRIK+EYTAVCHTDAYTLSGVDPEGA
Sbjct: 6   TEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPEGA 65

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSIL                  K GDHVIALYTAEC++CKFCKSGKTNLC SVRATQGK
Sbjct: 66  FPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQGK 125

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTSRF N+KGE+L HFMGCSTFSQYTVVADVSVVA+DP APL+  CLLGCGVTTG
Sbjct: 126 GVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVTTG 185

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAA KTA+VQKGDTVA+FGAGTVGLSV+QGA VRGAS+II+VDINDQK+++  +FGATD
Sbjct: 186 YGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGATD 245

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           F+NP   LKDGQTIV+KL+EMTDGGLD+TFDCTGNT VMR ALEACHKGWG S+IIGVAA
Sbjct: 246 FINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGVAA 305

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           A +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+ R FT+IN
Sbjct: 306 AEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTEIN 365

Query: 362 SAFEDLHHGDCLRTVLDLSK 381
            AFEDLH GDCLRTVLDL K
Sbjct: 366 KAFEDLHAGDCLRTVLDLKK 385

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/380 (76%), Positives = 321/380 (84%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           ++GKPI C AAVAY+A +PLTVEEI+V+PP+AHEVRIK+ +TAVCHTDAYTLSGVDPEGA
Sbjct: 4   TQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPEGA 63

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FP +L                  K GDHVIALYTAEC  CKFCKSGKTNLCGSVR TQGK
Sbjct: 64  FPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQGK 123

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTSRF N KGE LLHFMGCSTFSQYTVVADVSVVAI+  APL   CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVTTG 183

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAA+KTA+VQK DTVA+FGAGTVGLSVVQGA  RGASKII+VD+N +K+ +S  FGATD
Sbjct: 184 YGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGATD 243

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           F+NP   LK G+TIV KLVEMTDGGLD TFDCTGN  VMR ALE CHKGWGQSIIIGVAA
Sbjct: 244 FINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGG+KGRSEMGGL+  Y  G LKVD+FIT++R FT+IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTEIN 363

Query: 362 SAFEDLHHGDCLRTVLDLSK 381
           +AFEDLHHGDCLRTVLDL K
Sbjct: 364 AAFEDLHHGDCLRTVLDLEK 383

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/378 (77%), Positives = 320/378 (84%)

Query: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63
           GKPI C AAVAY+A KP +VEEI VD PKAHEVRIK+EYTAVCHTDAYTLSG DPEG FP
Sbjct: 7   GKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66

Query: 64  SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            IL                  K GDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 67  CILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGT+RFHN KG+D+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD +CLLGCGVTTGYG
Sbjct: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186

Query: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AAVKTA+VQKGDTVA+FG GTVGLSV+QGA +RGASKII VDIN+ KK++   FGATDF+
Sbjct: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246

Query: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
           NP + L   QTIV+KLVEMTDGGLDFTFDCTGNT +MR ALEACHKGWGQSIIIGVAAAG
Sbjct: 247 NPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIIIGVAAAG 306

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363
           +EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRR F +IN A
Sbjct: 307 EEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHA 366

Query: 364 FEDLHHGDCLRTVLDLSK 381
           FEDLH+GDCLRTVL   +
Sbjct: 367 FEDLHNGDCLRTVLKFDE 384

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/377 (77%), Positives = 320/377 (84%), Gaps = 1/377 (0%)

Query: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63
           GKPITCTAA+AYEA KPLTV EIVVDPPKAHEVRIK+  TAVCHTDAY+LSGVDPEG FP
Sbjct: 5   GKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVDPEGLFP 64

Query: 64  SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
            +L                  K GDHVIALYTAEC +CKFC SGKTNLCGSVRATQGKGV
Sbjct: 65  CVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRATQGKGV 124

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           MPDGT+RFH+K G+ + HFMGCSTFSQYTVVADVS+VA D     + T LLGCGVTTGYG
Sbjct: 125 MPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCGVTTGYG 184

Query: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AA+KTA++QKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVD+N+ KK WS +FGATDFV
Sbjct: 185 AAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEFGATDFV 244

Query: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
           NP K LKD + IV KL+EMTDGGLDFTFDCTGN +VMR+ALEACHKGWGQSIIIGVAAAG
Sbjct: 245 NP-KELKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIIIGVAAAG 303

Query: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363
           +EI+TRPFQLVTGRVW+GSAFGGIKGRSEMGGL+ DY  G LKVDEFIT RR FT+IN+A
Sbjct: 304 QEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPFTEINAA 363

Query: 364 FEDLHHGDCLRTVLDLS 380
           FEDLH+G CLRTVLD S
Sbjct: 364 FEDLHNGSCLRTVLDTS 380

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/379 (78%), Positives = 327/379 (86%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           +EGKP+T  AAVAYEAGKPL+VEEI VDPPKAHEVRI+V+ TAVCHTDAYTLSG DPEGA
Sbjct: 3   TEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEGA 62

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSIL                  K GDHV+ALYTAEC +CKFCKSGKTNLCGSVRATQGK
Sbjct: 63  FPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQGK 122

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTSRF NKKGE LLHFMGCSTFS+YTVVADVSVVA+DPKAPL+  CLLGCGVTTG
Sbjct: 123 GVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTTG 182

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAAVKTA+VQKGDTVAIFGAGTVGLSV QGA  RGAS+II+VDIND KK++  +FGATD
Sbjct: 183 YGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGATD 242

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           F+NP+  L++GQTIV+KL+EMTDGGLDFTFDCTGN  VMR ALEACHKGWG S++IGVAA
Sbjct: 243 FINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVAA 302

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           +G+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKVDEFIT+RR F  IN
Sbjct: 303 SGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQIN 362

Query: 362 SAFEDLHHGDCLRTVLDLS 380
            AFEDLH GD LRTVL+ +
Sbjct: 363 EAFEDLHAGDSLRTVLNYT 381

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/378 (75%), Positives = 321/378 (84%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           ++GKPI CTAAVAY AG+PL +E++ VDPPKAHEVRIK+  +A+CHTDAYTLSG DPEG 
Sbjct: 4   TQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPEGL 63

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FP IL                  K GDHV+ LYTAEC++CKFC SGKTNLCG+VRATQGK
Sbjct: 64  FPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQGK 123

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTSRF N KGE L HFMGCSTFS+YTVVADVSVVA+D +APL+  CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVTTG 183

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAAVKTADVQ+GDTVA+FGAGTVGLSVVQGA  R AS+IIVVDIND K++W+  FGATD
Sbjct: 184 YGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGATD 243

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           F+NP   LK+G+TIV +L+EMTDGGLD TFDCTGNT VMR ALEACHKGWGQSIIIGVAA
Sbjct: 244 FINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLV DY++G LKV EF+TH+R F +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEEIN 363

Query: 362 SAFEDLHHGDCLRTVLDL 379
           S FEDLHHGDCLRTVL L
Sbjct: 364 SGFEDLHHGDCLRTVLSL 381

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/378 (73%), Positives = 312/378 (82%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           ++GK I C AAVAYEA KPL V++++VD PKAHEVRIK+  TA+CHTDAYTLSGVDPEG 
Sbjct: 4   TQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPEGL 63

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FP IL                  K GDHVI LYTAEC++CKFCKSGKTNLCG+VR TQGK
Sbjct: 64  FPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQGK 123

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
           GVMPDGTSRFH  +G+D+ HFMGCSTFS+YTVVADVSVVAID K  L+   LLGCGVTTG
Sbjct: 124 GVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVTTG 183

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           +GAAVK A+VQKGDTVA+FGAGTVGLSVVQGA +RG SK+IVVDIND+KKQ+S DFGATD
Sbjct: 184 FGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGATD 243

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           FVNP   LKDG+TIV+KL+ MTDGGLD+TFDCTGN  VMR+ALEACHKGWGQS IIGVAA
Sbjct: 244 FVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGVAA 303

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVW+G+AFG IKGR++M  L+ DY  G LK+DEFITHRR F +IN
Sbjct: 304 AGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDEIN 363

Query: 362 SAFEDLHHGDCLRTVLDL 379
             FEDLH G CLRTVL  
Sbjct: 364 DGFEDLHMGTCLRTVLKF 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/380 (70%), Positives = 291/380 (76%), Gaps = 46/380 (12%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           ++GKPITCTAAVAYEAGKPLTVE+IVVDPPKAHEVRIK++YTAVCHTDAYTLSGVDPEGA
Sbjct: 89  TQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVDPEGA 148

Query: 62  FPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGK 121
           FPSIL                  K GDHVIALYTAEC ECKFCKSG              
Sbjct: 149 FPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGX------------- 195

Query: 122 GVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTG 181
                                                  A+D  AP+D  CLLGCGVTTG
Sbjct: 196 ---------------------------------XXXXXXAVDKNAPMDSICLLGCGVTTG 222

Query: 182 YGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
           YGAA+KTA+VQKGDTVA+FGAGTVGLSVVQGA  RGASKIIVVD+NDQKKQWS+DFGATD
Sbjct: 223 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDFGATD 282

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           F+NP   LK+G+TIV KL+EMTDGGL++TFDCTGNT VMR ALEACHKGWG+SIIIGVAA
Sbjct: 283 FINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIIIGVAA 342

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY +G LKVDEFITHRR FT+IN
Sbjct: 343 AGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPFTEIN 402

Query: 362 SAFEDLHHGDCLRTVLDLSK 381
           +AFEDLHHGDCLRTVLDLSK
Sbjct: 403 NAFEDLHHGDCLRTVLDLSK 422

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/378 (71%), Positives = 298/378 (78%), Gaps = 1/378 (0%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPK-AHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           +EG+ ITCTAAVAY AGKPLTVE+I V+ P  A       ++  + H   +++       
Sbjct: 4   TEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSEVR 63

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG 120
                                   K GDHVIALYTAECKECK CKSGKTNLC +VRATQG
Sbjct: 64  CVSLCFGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRATQG 123

Query: 121 KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT 180
           KGVMPDGTSRF N KGE LLHFMGCSTF++YTVVADVSVVAID  APL+K CLLGCGVTT
Sbjct: 124 KGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCGVTT 183

Query: 181 GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT 240
           GYGAA+KTA+VQKGDTVA+FGAGT+GLSVVQGA  R ASKIIVVDIND KK+++ DFGAT
Sbjct: 184 GYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDFGAT 243

Query: 241 DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA 300
           DFVNP   LKDGQTIV+KLVEMTDGGLDFTFD TGN  VMR ALEACHKGWGQSIIIGVA
Sbjct: 244 DFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIIIGVA 303

Query: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360
           AAGKEISTRPFQLVTGRVWKGSAFGG+KGRSEMG L+ DY  G LK+DEFIT++R F +I
Sbjct: 304 AAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPFKEI 363

Query: 361 NSAFEDLHHGDCLRTVLD 378
           N  FEDLHHGDCLRTVL+
Sbjct: 364 NEGFEDLHHGDCLRTVLN 381

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  433 bits (1113), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 205/377 (54%), Positives = 269/377 (71%), Gaps = 3/377 (0%)

Query: 3   EGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAF 62
           EG+PI CTAAVAY   KPL +E+I+VDPP+ HEVR+KV  TA+C TD +TL G++PEG F
Sbjct: 5   EGEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKF 64

Query: 63  PSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKG 122
           P +L                  K GDHV+ LY  EC  C  CKS K+NLC  ++ATQ +G
Sbjct: 65  PCVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQG 124

Query: 123 VMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGY 182
           VMP G+SR HN + + L HFMGCS+FSQY VV+D+S V I   APLDK CLLGCGVTTG+
Sbjct: 125 VMPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGF 184

Query: 183 GAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
           GA +    V+ GD VA+FG+GTVGLSVVQ        ++IVVD+ D K++W+L FGATDF
Sbjct: 185 GAPIAKG-VKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDF 243

Query: 243 VNPSKGLKDGQTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
           +NP K +   ++++  L++ + G G DFTFDCTG+T VMR+ALE+C KGWG S+IIG+A 
Sbjct: 244 INPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAG 302

Query: 302 AGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           AG+EIST P+ L+ GR W+G AFGG+KGRSE+  LV  YM+ ++K+DE+IT++R   +IN
Sbjct: 303 AGEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEIN 362

Query: 362 SAFEDLHHGDCLRTVLD 378
            A ++L  G  L+TVLD
Sbjct: 363 EALKELEDGLVLKTVLD 379

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 111/392 (28%), Positives = 169/392 (43%), Gaps = 61/392 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVV----DPPKAHEVRIKVEYTAVCHTDA-YTLSGVDPEG 60
           P T  A V  + G  +T E+I V    DP   H V++ ++ T +C +D  Y  +G    G
Sbjct: 2   PETHKAVVLQKQGL-ITFEDIPVPQIEDP---HYVKLAIKKTGICGSDVHYYKTGAI--G 55

Query: 61  AF----PSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVR 116
            F    P +L                  K GD V        +  K  KSG  NLC S+ 
Sbjct: 56  NFVVKDPMVLGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMA 115

Query: 117 ATQGKGVMPDGTSRFHNKKGEDLLHFMGCS-TFSQYTVVADVSVVAIDPKAPLDKTCLLG 175
                 +  DGT   +    ED L  +  S +F +   V  +SV                
Sbjct: 116 FAATPPI--DGTLLKYYLSPEDFLVKLPDSVSFEEGACVEPLSV---------------- 157

Query: 176 CGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSL 235
            GV      A K ADV+ G  V +FGAG VGL     +   GA+ ++ VD+ D K + + 
Sbjct: 158 -GVH-----ANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTN 211

Query: 236 DFGATDFVNPSKGLKDGQTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQS 294
           +FGAT  VN SK  K    +V ++  +  G   +  F+C+G    +R+ ++AC  G G+ 
Sbjct: 212 EFGATQTVNSSK-FKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAG-GRY 269

Query: 295 IIIGVAAAG-----KEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVD 348
           + +G+          E+ ++  Q++ T R   G     +K  SE          GK+ V 
Sbjct: 270 VQVGMGKDNVNFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVK 319

Query: 349 EFITHRRGFTDINSAFE-DLHHG-DCLRTVLD 378
             ITHR  F D   A+E ++ HG D ++T++D
Sbjct: 320 PLITHRFKFQDAIKAYEFNIEHGEDVVKTIID 351

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 93/387 (24%), Positives = 160/387 (41%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A +    G  L  ++I V  PK++E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHA-------- 118

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I P + L +   + C   T Y 
Sbjct: 119 --------------DLSGYTHDGSFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI GA G +G   +Q A   G  +++ +D  D+K +   D G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K  KD   IV  +++ T+GG     + + +   + ++++ C    G ++++G+   
Sbjct: 223 IDFTK-TKD---IVGDIIKATNGGAHGVINVSVSEQAIDASVKYCRAN-GTAVLVGM-PG 276

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEF-------ITHRR 355
           G ++ +  F  V            +K  S +G  V +  D +  +D F         H  
Sbjct: 277 GAQVKSDVFNQV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPIHIA 324

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
             +D+   FE +  G  + R V+D SK
Sbjct: 325 KLSDVPEIFEKMEKGQIVGRYVVDCSK 351

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 97/391 (24%), Positives = 156/391 (39%), Gaps = 53/391 (13%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EG 60
           S+  P +  A V YE    L  ++I V  PKA+E+ + V+Y+ VCH+D +   G  P + 
Sbjct: 3   SQAIPESQKAIVFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDWPFQL 62

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
            FP I                   K GD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 120 GKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVT 179
                 DGT   H+             TF +Y     V    +     L +   + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHLPENVDLAEVAPILCAGV 160

Query: 180 TGYGAAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238
           T Y  A+K A++  G  V I GA G +G   +Q A   G  ++I +D  + KKQ     G
Sbjct: 161 TVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLFEGLG 218

Query: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIG 298
              F++ +K     + IV  +++ TDGG     + + +   + ++   C    G  +++G
Sbjct: 219 GEVFIDFTK----EKDIVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITH----- 353
           + A     S    Q+V             K  S +G  V +  D +  +D F  H     
Sbjct: 274 MPAHAYCKSDVFNQVV-------------KSISIVGSCVGNRADTREALDFFARHLVKSP 320

Query: 354 --RRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
               G +D+   FE + +G  + R V+D SK
Sbjct: 321 IRLAGLSDVPEIFEKMENGSIVGRYVVDTSK 351

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/347 (24%), Positives = 143/347 (41%), Gaps = 48/347 (13%)

Query: 38  IKVEYTAVCHTDAYTLSGVDPE---------GAFP-SILXXXXXXXXXXXXXXXXXXKAG 87
           IK+ +T++C TD     G +PE         G+F   IL                  K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 88  DHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCST 147
           D VI    + C  C+ C     + C     T G G                +L +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 148 FSQY--TVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTV 205
            ++Y  T  AD S+ ++      +   +L   + T +   V+  +V+ GDTVAI GAG V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 206 GLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDG 265
           G+  V  + +   S +IVVDI+D +   + + G+T  +N +K     +  V K++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAK-----EDAVSKILEYTNG 274

Query: 266 -GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVW--KGS 322
            G+D   +  G     ++  + C +     I  G   A   +  +P      ++W    +
Sbjct: 275 RGVDCVMEAVG----AQATWDICQR----VIKEGGHLANVGVHGKPVNFEIDKLWIKNLT 326

Query: 323 AFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHH 369
              G+   +  G L+     GKLK +  +TH   F +++  +    H
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYNIFKH 373

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 102/200 (51%), Gaps = 19/200 (9%)

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPS 246
           K A V+ G TV +FGAG VGL     A   GAS ++ VD+ DQK + + +FGAT  +N +
Sbjct: 163 KLAKVRFGQTVVVFGAGPVGLLTGAVAKAFGASDVVFVDVFDQKLERAKNFGATHVINST 222

Query: 247 KGLK-DGQTIVDKLVEMTDGGL-DFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGK 304
           K  K D Q + D++ ++  G L D  F+C+G    + + ++A   G G  + IG+   GK
Sbjct: 223 KLPKNDPQALADEVEKLLGGALADVVFECSGAESCIDAGVKATKNG-GTMVQIGM---GK 278

Query: 305 EISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
                P   V+G+          ++G  K   +   LVS    G++ V + ITHR  F D
Sbjct: 279 NYVNFPIAEVSGKEMTLVGCFRYSYGDYK---DAVNLVS---TGRVDVKKLITHRFSFED 332

Query: 360 INSA--FEDLHHGDCLRTVL 377
              A  F   H G+ ++T++
Sbjct: 333 AAKAYDFNIAHGGEVVKTII 352

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 80.5 bits (197), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 148/374 (39%), Gaps = 49/374 (13%)

Query: 12  AVAYEAGKPLTVEEIVVDPPKAHEVR---IKVEYTAVCHTDAYTLSGVDPE--------- 59
           A+ Y     L  E+  +  PK  + R   IK+  T++C TD     G  PE         
Sbjct: 33  AMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNE 90

Query: 60  GAFP-SILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRAT 118
           G+F   +L                  K GD VI      C  C+ C  G    C +    
Sbjct: 91  GSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHCMN-DGG 149

Query: 119 QGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGV 178
              G   DGT   + +                 T  AD S+ A+      +   LL   +
Sbjct: 150 WALGYSIDGTQAEYVR-----------------TPFADTSLYALPEGLSDENAVLLSDAL 192

Query: 179 TTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238
            T +   V+  +V+ GD+VAI GAG VG+  V  + +   S +IVVD++D + + + + G
Sbjct: 193 PTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEMG 252

Query: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIII 297
           AT  +N  K     +  V K++E+T+G G+D   +  G     +   + C     Q I  
Sbjct: 253 ATHTINSGK-----EDAVAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QIIKE 299

Query: 298 GVAAAGKEISTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRR 355
           G   A   +  +P      ++W    +   G+   +    L+ +   GKL+ D+ ++H  
Sbjct: 300 GGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHC 359

Query: 356 GFTDINSAFEDLHH 369
            F D+ + +    H
Sbjct: 360 NFKDMANNYNIFKH 373

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 159/383 (41%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G  L  ++I V  PK++E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKAVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F QY     V    I P   L +   + C   T Y 
Sbjct: 116 -PDA----------DLSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI GA G +G   +Q A   G  +++ +D  D+K     + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALFKELGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++ +K  KD   +V  +V+ T+GG         N  V  +A+EA     +  G  +++G+
Sbjct: 223 IDFTK-TKD---VVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
               K  S    Q+V      GS  G    R++    +  +  G +K    +    G ++
Sbjct: 275 PGGAKCKSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIMVV---GLSE 328

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           + S +E +  G  + R V+D SK
Sbjct: 329 LPSIYEKMEKGAIVGRYVVDTSK 351

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 98/380 (25%), Positives = 149/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T  A V YE G PL    I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 92

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD+  I      C  C+ C+ G  + C           
Sbjct: 93  VGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNC----------- 141

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 142 -----------EQADLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILCAGVTVY- 189

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTADV+ G  VAI GA G +G   VQ A   G  +++ +D  D+KK+     G   F
Sbjct: 190 KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFHSLGGDIF 248

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           V+ +K      +IV  + ++T+GG     + + +      + E      G  +++G+ A 
Sbjct: 249 VDFTK----THSIVKDIQDVTNGGPHGVINVSVSELATSMSTEYVRPA-GTVVLVGLPAN 303

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 304 SYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFQRGLVKSPIKIV---GLSELPM 357

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            +E +     L R VLD SK
Sbjct: 358 VYELMAQNKILGRYVLDTSK 377

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 96/366 (26%), Positives = 156/366 (42%), Gaps = 56/366 (15%)

Query: 27  VVDPPKAHEVRIKVEYTAVCHTDA-YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXX 81
           + DP   H V+++++ T +C +D  Y ++G    G F    P IL               
Sbjct: 26  ITDP---HYVKLQIKKTGICGSDVHYYVAGAI--GDFVVKKPMILGHESSGLVVEVGSEV 80

Query: 82  XXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGED-LL 140
              + GD V        +     K+G+ NLC  ++      +  DGT   +    ED L+
Sbjct: 81  SRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYYLAPEDFLV 138

Query: 141 HFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIF 200
                 ++ +  +V  +SV                 GV      A K A V     VA+F
Sbjct: 139 KLPDHVSYEEGALVEPLSV-----------------GVH-----ANKLAGVAFNQRVAVF 176

Query: 201 GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLV 260
           GAG VGL     A   GAS+++ +D+ + K   S +FG T FVN S  +KD   +V K +
Sbjct: 177 GAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVN-SANIKDEDDLV-KEI 234

Query: 261 EMTDGGL--DFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRV 318
           E   GG   D  FDCTG    +R+ ++ C+ G G  + +G+   G +    P   +  + 
Sbjct: 235 ERVLGGARPDVVFDCTGAEICIRTGIKVCNSG-GTYVQVGM---GHDDVNFPIGAIGAKE 290

Query: 319 WK-----GSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFE-DLHHG-D 371
            K       AFG  +   ++         G + V   +THR  F D  +A+E ++ HG +
Sbjct: 291 LKVLGCFRYAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSE 344

Query: 372 CLRTVL 377
            ++T++
Sbjct: 345 VIKTII 350

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 90/381 (23%), Positives = 158/381 (41%), Gaps = 41/381 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P +    + YE G  L  +++ V  PK +E+ I V Y+ VCHTD +   G  P GA  P 
Sbjct: 28  PQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPL 87

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD+  I      C  C+FC+ G  + C           
Sbjct: 88  VGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA-------- 139

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     +    I     L +   + C   T Y 
Sbjct: 140 --------------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAGVTVY- 184

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K +DV+ G  VAI G AG +G   VQ A   G  +++ +D  D+K++     G   F
Sbjct: 185 KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESLGGNHF 243

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           V+ +K  KD   +V ++ E+T+GG     + + +   +  ++E   +  G  +++G+  A
Sbjct: 244 VDFTK-TKD---LVSEIQEITEGGPHGVINVSVSEKAIGQSVEYV-RPCGTVVLVGL-PA 297

Query: 303 GKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           G  + +  F  V   +  KGS  G    R++    +  +  G++K    +    G +++ 
Sbjct: 298 GATVKSDVFNHVIKSINIKGSYVG---NRADTREAIDFFAKGQVKSPIKVV---GLSELP 351

Query: 362 SAFEDLHHGDCL-RTVLDLSK 381
             ++ +     + R V+D S+
Sbjct: 352 EVYKLMEANKIIGRYVVDTSR 372

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 98/395 (24%), Positives = 156/395 (39%), Gaps = 59/395 (14%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-E 59
           M+   P T    + YE G  L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P  
Sbjct: 1   MAASIPETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLP 60

Query: 60  GAFPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
              P +                   K GD   I      C  C++C+    + C      
Sbjct: 61  TKLPLVGGHEGAGVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC------ 114

Query: 119 QGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGV 178
                 P+           DL  +    +F QY     V    I     L +   + C  
Sbjct: 115 ------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAG 158

Query: 179 TTGYGAAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDF 237
            T Y  A+K+A+++ GD VAI G AG +G   VQ A   G  +++ +D  ++K +   D 
Sbjct: 159 VTVY-KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDL 216

Query: 238 GATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQS 294
           G   F++ +K     + I ++++E T GG         N  V   A+E      +  G  
Sbjct: 217 GGEYFIDFTK----SKNIPEEVIEATKGGAHGVI----NVSVSEFAIEQSTNYVRSNGTV 268

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEF---- 350
           +++G+    K  S    Q+V             K  S +G  V +  D +  +D F    
Sbjct: 269 VLVGLPRDAKCKSDVFNQVV-------------KSISIVGSYVGNRADTREAIDFFSRGL 315

Query: 351 ---ITHRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
                H  G +++ S +E +  G  + R V+D SK
Sbjct: 316 VKAPIHVVGLSELPSIYEKMEKGAIVGRYVVDTSK 350

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 95/396 (23%), Positives = 155/396 (39%), Gaps = 83/396 (20%)

Query: 12  AVAYEAGKPLTVEEIVVDPPKAHE--VRIKVEYTAVCHTD----------------AYTL 53
           A+AY   K +   + +  P  +HE  V I V +  VC +D                 + +
Sbjct: 3   ALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTHAM 62

Query: 54  SGVDPEGAFPSILXXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKE------------- 100
           SG       P  +                  K GDHV+      C++             
Sbjct: 63  SG----QGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREG 118

Query: 101 -CKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHF--MGCST--FSQYTVVA 155
            C  CK+G  N C                           L F  +GC +  F++  V++
Sbjct: 119 LCIACKTGNPNCCTD-------------------------LGFCGLGCQSGGFAEKIVLS 153

Query: 156 DVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHV 215
           + +VV I    PLD   L+     + +  AV+ + +Q G T  + GAG +GL+ V     
Sbjct: 154 ERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQS 211

Query: 216 RGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDG--GLDFTFDC 273
            GA  IIV +  D ++Q +   GA  F NP+   + G  +++ L ++  G  G +F++DC
Sbjct: 212 HGAGTIIVSEPADTRRQKAEALGAQTF-NPT---EHGDNVIEALRKLAPGGEGFNFSYDC 267

Query: 274 TGNTDVMRSALEACHKGWGQSIIIGVAAAG-KEISTRPFQLVTG-RVWKGSAFGGIKGRS 331
            G ++   + L   H    + + + +A  G K I   P  + T  R   GS     +   
Sbjct: 268 CGTSETFSAGL---HTLTPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQDFE 324

Query: 332 EMGGLVSDYMD-GKLKVDEFITHRRGFTDINSAFED 366
           E    V D MD GK+ +++  T   G   I + FE+
Sbjct: 325 E----VVDAMDKGKIDINKVKTMITGRERIENGFEN 356

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 76.6 bits (187), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 93/387 (24%), Positives = 154/387 (39%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G  L   +I V  PK  E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC----------- 112

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 113 -PDA----------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A +Q G+ VAI GA G +G   VQ A   G  +I+ +D  ++KK+   + G   F
Sbjct: 161 KALKSARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++      + + +V +++++T+GG     + + +   + ++ E C    G  +++G+  A
Sbjct: 220 ID----FAESKDVVAEVIKVTNGGAHGVINVSVSEAAIAASAEYCRSN-GTVVLVGL-PA 273

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------THRR 355
           G ++ +  F  V            +K  S +G  V +  D +  +D F            
Sbjct: 274 GAQMRSEVFSHV------------VKSISVVGSYVGNRADSREAIDFFTRGLVSAPIKVV 321

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
           G + +   +E +  G    R V+D SK
Sbjct: 322 GLSQLAEVYEKMEKGMIAGRYVVDTSK 348

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 53/386 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G PL   +I V  PKA E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PRTQKAVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ GD VAI GA G +G   +Q A   G  +++ +D  ++K+Q     G   F
Sbjct: 164 KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++     +  + IV  +V+ T+GG     + + +   + S+ E      G  +++G+   
Sbjct: 223 ID----FRKSKDIVADVVKATNGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGL-PG 276

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------THRR 355
           G +  +  F  V            +K  S +G  V +  D +  +D F            
Sbjct: 277 GAKCKSDVFSHV------------VKSISIVGSYVGNRADTREALDFFARGLVKSPIQVV 324

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLS 380
           G +++   +E +  G  + R V+D S
Sbjct: 325 GLSELPQIYEKMEKGAVVGRYVVDTS 350

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 151/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P    A V YE    L  +++ V  PK +E+ + V+Y+ VCH+D +   G  P +  FP 
Sbjct: 7   PEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           I                   K GD   I      C  C++C+ G  + C  +        
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL-------- 118

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             DGT   H+             TF +Y     V    I P   L +   + C   T Y 
Sbjct: 119 --DGTGFTHD------------GTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K A+V  G  V I GA G +G   +Q A   G  ++I +D  + K++     G   F
Sbjct: 164 KALKRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++      + + IV  +++ T+GG     + + +   + ++   C    G  +++G+ A 
Sbjct: 223 ID----FTEEKDIVGAIIKATNGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVGMPAH 277

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S    Q+V      GS  G    R++    +  +  G +K      H  G +D+  
Sbjct: 278 AYCNSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLSDVPE 331

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            F  +  G+ + R V++ SK
Sbjct: 332 IFAKMEKGEIVGRYVVETSK 351

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/200 (32%), Positives = 102/200 (51%), Gaps = 15/200 (7%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
           A K A ++ G    +FGAG +GL   + A V GA+ ++ VD+ + K + +  FGAT  VN
Sbjct: 163 ANKLAKIKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN 222

Query: 245 PSKGLKDGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
            S  L  G T VD +++   G  G D  F+C+G    +R+ +E C  G G  + +G+   
Sbjct: 223 -SGDLPHGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAG-GTIVQVGM--- 276

Query: 303 GKEISTRPFQLV-TGRVWKGSAFGGIKG-RSEMGGLVSDYMDGKLKVDEFITHRRGFTDI 360
           G+E    P  ++ T  +     F   +G  S+   LVS     KL +  FITHR  F D 
Sbjct: 277 GQEEIQFPISIIPTKELTFQGCFRYCQGDYSDSIELVSSR---KLSLKPFITHRYSFKDA 333

Query: 361 NSAFEDLHHG--DCLRTVLD 378
             AFE+  H   + ++T+++
Sbjct: 334 VEAFEETSHHPLNNIKTIIE 353

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 96/390 (24%), Positives = 154/390 (39%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  ++I V  PKA+E+ + V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKGVIFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDWPLPVKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C+ G  + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I   A L +   + C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQQYATADAVQAAKIPAGADLAEIAPILCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++Q GD VAI G AG +G   VQ A   G  +++ +D  ++K+Q     G   F
Sbjct: 164 KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLFRQLGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++     +  + I  ++++ T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 ID----FRTCKDIEGEIIKATNGGAHGVI----NVSVSEAAIESSTNYVRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
            A  K  S    Q+V             K  S +G  V +  D +  +D F+        
Sbjct: 275 PAGAKCKSDVFNQVV-------------KSISIVGSYVGNRADTREALDFFVRGLVRSPI 321

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
              G + +   FE +  G  + R V+D S 
Sbjct: 322 KVVGLSTLPEIFEKMEKGQIVGRYVVDTSN 351

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 96/380 (25%), Positives = 150/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE   PL  ++I V  PK++E+ I VEY+ VCHTD +   G  P     P 
Sbjct: 33  PKTQKGVIFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPL 92

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C++G    C           
Sbjct: 93  VGGHEGAGVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANC----------- 141

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    I     L     + C   T Y 
Sbjct: 142 -----------EHADLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY- 189

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTAD++ GD VAI G AG +G   VQ A   G  ++I +D  + KK+     G   F
Sbjct: 190 KALKTADLKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVF 248

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + IV  + E T GG     + + +   +  +++      G  +++G+ A 
Sbjct: 249 IDFTK----SKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQYIRPT-GTVVVVGMPAN 303

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S    Q+V     KGS  G    R++    +  +  G +K    +    G +++  
Sbjct: 304 AVVKSDVFNQVVKSIQIKGSYVG---NRADTREALDFFTRGLVKSPIKVV---GLSELPK 357

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            +E +  G  L R V+D SK
Sbjct: 358 VYELMETGKILGRYVVDTSK 377

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (48%), Gaps = 19/200 (9%)

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPS 246
           K A V+ G  V +FGAG VGL     AH  GAS +I VD+ D + Q + DFGA+   N S
Sbjct: 164 KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSS 223

Query: 247 K-GLKDGQTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGK 304
           K  + + Q + D++ ++  G   D  F+C+G  DV   A     K  G  + +G+   GK
Sbjct: 224 KFSVDEAQQLADEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GK 279

Query: 305 EISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
             +  P   V+G+  +       +FG  +        V+    GK+ V   ITHR  F D
Sbjct: 280 NYTNFPIAEVSGKEMRLIGCFRYSFGDYR------DAVNLVASGKVNVKPLITHRFKFED 333

Query: 360 INSAFED--LHHGDCLRTVL 377
              A++    H GD ++T++
Sbjct: 334 AAKAYDYNIAHGGDVVKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (48%), Gaps = 19/200 (9%)

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPS 246
           K A V+ G  V +FGAG VGL     AH  GAS +I VD+ D + Q + DFGA+   N S
Sbjct: 164 KLAGVRFGTRVVVFGAGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSS 223

Query: 247 K-GLKDGQTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGK 304
           K  + + Q + D++ ++  G   D  F+C+G  DV   A     K  G  + +G+   GK
Sbjct: 224 KFSVDEAQQLADEVEKLLGGHHADVVFECSG-ADVCIDAGVKTTKVGGTMVQVGM---GK 279

Query: 305 EISTRPFQLVTGRVWK-----GSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
             +  P   V+G+  +       +FG  +        V+    GK+ V   ITHR  F D
Sbjct: 280 NYTNFPIAEVSGKEMRLIGCFRYSFGDYR------DAVNLVASGKVNVKPLITHRFKFED 333

Query: 360 INSAFED--LHHGDCLRTVL 377
              A++    H GD ++T++
Sbjct: 334 AAKAYDYNIAHGGDVVKTII 353

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 95/383 (24%), Positives = 158/383 (41%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G  L  ++I V  PK++E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI GA G +G   +Q A   G  +++ +D  ++K     + G   F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALFKELGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++ +K  KD   +V  +V+ T+GG         N  V  +A+EA     +  G  +++G+
Sbjct: 223 IDFTK-TKD---VVKAVVDATNGGAHGVI----NVSVSEAAIEASTVYCRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
               K  S    Q+V      GS  G    R++    +  +  G +K    +    G ++
Sbjct: 275 PGGAKCKSDVFNQVVKSTTIVGSYVG---NRADTREALDFFARGLVKSPIKVV---GLSE 328

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           + S +E +  G  + R V+D SK
Sbjct: 329 LPSIYEKMEKGAIVGRYVVDTSK 351

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 93/392 (23%), Positives = 153/392 (39%), Gaps = 53/392 (13%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           MS   P T    +    G PL  +EI V  PKA+E+ I V+Y+ VCHTD +   G  P  
Sbjct: 1   MSSSIPETQMGVIFESNGGPLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLP 60

Query: 61  A-FPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
              P +                     GD+  I      C  C+ C+    + C      
Sbjct: 61  VKLPLVGGHEGAGIVVAMGDSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQA--- 117

Query: 119 QGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGV 178
                              DL  +    +F QY     V    I     L +   + C  
Sbjct: 118 -------------------DLSGYTHDGSFQQYATADAVQAAKIPHGTDLAEVAPILCAG 158

Query: 179 TTGYGAAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDF 237
            T Y  A+K+A+++ GD VAI GA G +G   +Q A   G  +++ +D  ++K +     
Sbjct: 159 VTVY-KALKSANLKAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKL 216

Query: 238 GATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIII 297
           G   F++ +K  KD   ++ +++E+TDGG     + + +   + ++   C    G  +++
Sbjct: 217 GGEYFIDFTK-CKD---VIAEILEVTDGGAHGVINVSVSEAAIEASTRYCRAN-GTVVLV 271

Query: 298 GVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI------ 351
           G+ A     S    Q+V             K  S +G  V +  D +  +D F       
Sbjct: 272 GLPANAYCKSEVFSQVV-------------KSISIVGSYVGNRADTRQALDFFARGLVKS 318

Query: 352 -THRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
             H    +D+   F+ +  G  + R V+D SK
Sbjct: 319 PIHIAPLSDLPEIFDKMAKGQIVGRYVVDTSK 350

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 156/381 (40%), Gaps = 41/381 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 30  PETQKGVIFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 89

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                     GD   I      C  C++C+    + C           
Sbjct: 90  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 138

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 139 -PDA----------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 186

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ GD VAI G AG +G   VQ A   G  +++ +D  ++K +     G   F
Sbjct: 187 KALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAF 245

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           V+ +K  KD   +V ++ E+T+GG     + + +   M ++ +      G  +++G+  A
Sbjct: 246 VDFTK-TKD---MVAEIQEITNGGPHGVINVSVSEAAMNASTQFVRPT-GTVVLVGL-PA 299

Query: 303 GKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDIN 361
           G  I +  F  V   +  KGS  G    R++    ++ + +G +     +    G +++ 
Sbjct: 300 GAVIKSEVFSHVVKSINIKGSYVG---NRADTREAINFFANGHVHSPIKVV---GLSELP 353

Query: 362 SAFEDLHHGDCL-RTVLDLSK 381
             +E +  G  L R V+D S 
Sbjct: 354 KVYELMEQGKILGRYVVDTSN 374

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 92/384 (23%), Positives = 153/384 (39%), Gaps = 39/384 (10%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EG 60
           S+  P T  A V YE    L  +++ V  PK +E+ + V+Y+ VCH+D +   G  P + 
Sbjct: 3   SQVVPKTQKAIVFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
            FP I                   K GD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 120 GKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVT 179
                 DGT   H+             TF +Y     V    I     L +   + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVDLAEVAPILCAGI 160

Query: 180 TGYGAAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238
           T Y  A+K A++  G  V I GA G +G   VQ A   G  ++I +D  + K++   +  
Sbjct: 161 TVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLFEELH 218

Query: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIG 298
              F++ +K     + +V  +++ TDGG     + + +   + ++   C    G  +++G
Sbjct: 219 GEIFIDFTK----EKDVVGAVIKATDGGSHGVINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFT 358
           + A     S    Q+V      GS  G    R++    +  +  G +K      H  G +
Sbjct: 274 MPAHAYCKSDVFNQVVKSISIVGSCVG---NRADTREALDFFARGLIKSP---IHLAGLS 327

Query: 359 DINSAFEDLHHGDCL-RTVLDLSK 381
           D+   F  +  G  + R V+D SK
Sbjct: 328 DVPEIFGKMERGQIVGRYVVDTSK 351

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 95/390 (24%), Positives = 153/390 (39%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 8   PETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPL 67

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+    + C           
Sbjct: 68  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC----------- 116

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 117 -PEA----------DLSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY- 164

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  G+ VAI G AG +G   VQ A   G  +I+ +D  D+KK    + G   F
Sbjct: 165 KALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIF 223

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           V+ +K     + +   ++  T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 224 VDFTK----SKNVEQDILVATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGL 275

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
            A  K  S+  F  V            +K  S +G  V +  D +  +D F         
Sbjct: 276 PANAK-CSSDVFNHV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPI 322

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
              G +++   +E +  G  + R V+D SK
Sbjct: 323 KIAGLSELPEIYEKMEKGQIVGRYVVDTSK 352

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 147/380 (38%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P      + YE G  L  +++ V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 45  PSMQKGVIFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPL 104

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD+  I      C  C+ C+ G    C           
Sbjct: 105 VGGHEGAGVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNC----------- 153

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 154 -----------EHADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY- 201

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTADV+ G  VAI G AG +G   VQ A   G  +++ +D  + KK+   D G   F
Sbjct: 202 KALKTADVRPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETF 260

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++     +  + +V  + E T GG     + + +   +  + E   +  G  +++G+ A 
Sbjct: 261 ID----FRTTKDMVGAIQEATQGGPHAVINVSVSEAAISMSTEYV-RPTGSVVLVGLPAN 315

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 316 AYVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFARGLVKAPIKII---GLSELPE 369

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
           A++ +  G  L R V+D  K
Sbjct: 370 AYKLMEAGKILGRYVVDTEK 389

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 90/391 (23%), Positives = 153/391 (39%), Gaps = 53/391 (13%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EG 60
           S+  P T  A V YE    L  +++ V  PK +E+ + V+Y+ VCH+D +   G  P + 
Sbjct: 3   SQAIPKTQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQL 62

Query: 61  AFPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
            FP I                   K GD   I      C  C++C+ G  + C  +    
Sbjct: 63  KFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL---- 118

Query: 120 GKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVT 179
                 DGT   H+             TF +Y     V    I     L +   + C   
Sbjct: 119 ------DGTGFTHD------------GTFQEYATADAVQAAHIPQNVNLAEVAPILCAGI 160

Query: 180 TGYGAAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238
           T Y  A+K A++  G  V I GA G +G   +Q A   G  ++I +D  + K++     G
Sbjct: 161 TVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLFEKLG 218

Query: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIG 298
              F++ +K     + +   +++ T+GG     + + +   + ++   C    G  +++G
Sbjct: 219 GEIFIDFTK----ERDVAGAVIKATNGGSHGIINVSVSEAAIEASTRYCRPN-GTVVLVG 273

Query: 299 VAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI------- 351
           + A     S    Q+V             K  S +G  V +  D +  +D F        
Sbjct: 274 MPAHAHCKSDVFNQVV-------------KSISIVGSCVGNRADTREALDFFARGLIESP 320

Query: 352 THRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
            H  G +D+   F  +  G+ + R V+D S+
Sbjct: 321 IHLAGLSDVPEIFGKMEKGEIVGRYVVDTSR 351

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 103/235 (43%), Gaps = 37/235 (15%)

Query: 166 APLDKTCLLGCGVTTGYGAAV----------KTADVQKGDTVAIFGAGTVGLSVVQGAHV 215
           +P D    L  GV+   GA V          K A V+    V +FGAG VGL     A  
Sbjct: 133 SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFSTRVVVFGAGPVGLLTGAVARA 192

Query: 216 RGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGG--LDFTFDC 273
            GAS ++ VD+ D K Q + DFGAT+  N SK   D    +   VE   GG   D  F+C
Sbjct: 193 FGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVEKLLGGNHADVVFEC 252

Query: 274 TGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKG--RS 331
           +G  DV   A     K  G  + +G+   GK  +  P   V+G+  K      + G  R 
Sbjct: 253 SG-ADVCIDAGVKVTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMK------LIGCFRY 302

Query: 332 EMGGLVSDYMD-------GKLKVDEFITHRRGFTDINSAFED--LHHGDCLRTVL 377
             G    DY D       GK+ V   ITHR  F D   A++    H GD ++T++
Sbjct: 303 SFG----DYRDAVNLVATGKVNVKPLITHRFKFEDAAKAYDYNISHGGDVVKTII 353

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 157/380 (41%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A +    G PL  ++I V  PK++E+ + ++Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  +      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PNA----------DLSGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI GA G +G   +Q A+  G  +++ +D  D K +         F
Sbjct: 164 KALKSANLRAGEWVAISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K  KD   ++ ++ ++T+GG     + + +   + ++ + C    G  +++G+   
Sbjct: 223 IDFTK-TKD---VISEVNKVTNGGAHGVINVSVSEAAIEASTKYCRAN-GTVVLVGLPGG 277

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
            K  S    Q+V      GS  G    R++    +  +  G +K      H    + + +
Sbjct: 278 AKCKSDVFNQVVKSMTIVGSYVG---NRADTREALDFFTRGLVKAP---IHVAPLSTLPT 331

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            FE +  G  + R V+D S+
Sbjct: 332 IFEKMEKGQIVGRYVVDTSR 351

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 89/205 (43%), Gaps = 39/205 (19%)

Query: 85  KAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           KAGDHV+   T  C               EC  C+ G  N C  +    G GV   G   
Sbjct: 90  KAGDHVVVEATGTCLDHYTWPNAAHAKDAECAACQRGFYNCCAHL-GFMGLGVHSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  VV++  VV I    PLD   L+     + +  AV+ + 
Sbjct: 146 -----------------FAEKVVVSEKHVVKIPNTLPLDVAALVEPISVSWH--AVRISK 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
           +QKG +  + GAG +GL+ +      GASKI+V +  + ++  +   G   F +PS+  +
Sbjct: 187 LQKGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRRNQAAKLGVETF-DPSEHKE 245

Query: 251 DGQTIVDKLVEMTDGGLDFTFDCTG 275
           D   I+ KL    + G DF +DC+G
Sbjct: 246 DAVNILKKLAPGGE-GFDFAYDCSG 269

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 95/390 (24%), Positives = 152/390 (38%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE+   L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  G  VAI G AG +G   VQ A   G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++ +K     + IV  +++ TDGG         N  V  +A+EA     +  G ++++G+
Sbjct: 220 IDFTK----EKDIVGAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
            A  K  S    Q+V             K  S +G  V +  D +  +D F         
Sbjct: 272 PAGAKCCSDVFNQVV-------------KSISIVGSYVGNRADTREALDFFARGLVKSPI 318

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
              G + +   +E +  G  + R V+D SK
Sbjct: 319 KVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 348

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 92/380 (24%), Positives = 153/380 (40%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 31  PKTQKGVIFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPL 90

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F Q+     +    I P   L +   + C   T Y 
Sbjct: 140 -PEA----------DLSGYTHDGSFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K A+++ GD VAI G AG +G   VQ A   G  +++ +D  ++K++     G   F
Sbjct: 188 KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVF 246

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K  KD   +V  + E T GG     + + +   +  + E   +  G  +++G+ A 
Sbjct: 247 IDFTK-TKD---MVSDIQEATKGGPHGVINVSVSEAAISLSTEYV-RPTGTVVLVGLPAN 301

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 302 SYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFTRGLIKSPIKIV---GLSELPK 355

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            ++ +  G  L R V+D +K
Sbjct: 356 VYDLMEQGKILGRYVVDTNK 375

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 90/374 (24%), Positives = 150/374 (40%), Gaps = 41/374 (10%)

Query: 13  VAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPSILXXXXX 71
           + YE G  L  E+I V  PK +E+ I V+Y+ VCHTD +   G  P     P +      
Sbjct: 36  IFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 95

Query: 72  XXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
                        K GD   I      C  C++C+    + C                  
Sbjct: 96  GVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHA--------------- 140

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                  DL  +    +F QY     V    I     L +   + C   T Y  A+K+A+
Sbjct: 141 -------DLSGYTHDGSFQQYATADYVQAARIPEGTDLAEVSPILCAGVTVY-KALKSAN 192

Query: 191 VQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGL 249
           ++ GD VAI G AG +G   VQ A   G  +++ +D   +K +     G   F++ +K  
Sbjct: 193 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELVKKLGGEVFIDFTK-- 249

Query: 250 KDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTR 309
              + +V+ + E T+GG     + + +   M ++ +      G  +++G+  AG  I + 
Sbjct: 250 --HKNLVEAVQEATNGGPHGVINVSVSEAAMTASTQFVRPT-GTVVLVGL-PAGAVIKSE 305

Query: 310 PFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLH 368
            F  V   +  KGS  G    R++    +  +  G +K      H  G +++   +E + 
Sbjct: 306 VFSHVVKSINIKGSYVG---NRADTREAIDFFARGMVKSP---IHVVGLSELPKVYELME 359

Query: 369 HGDCL-RTVLDLSK 381
            G  L R V+D +K
Sbjct: 360 KGKILGRYVVDTAK 373

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 92/384 (23%), Positives = 152/384 (39%), Gaps = 44/384 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P      + YE G PLT +++ V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 30  PKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLPVKLPL 89

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   I      C  C+ C+ G  + C           
Sbjct: 90  VGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNC----------- 138

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY          I     L +   + C   T Y 
Sbjct: 139 -----------EHADLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAGVTVY- 186

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTA +Q G+ VAI GA G +G   +Q A   G  +++ +D  + K +   + G   F
Sbjct: 187 KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKELGGETF 245

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++ +K  K+ + ++  + E T GG         N  V  +A+ A     +  G  +I+G+
Sbjct: 246 IDFTK-YKNNEAMIKDIQEATKGGPQGVI----NVSVSEAAISASTQYVRPTGTVVIVGM 300

Query: 300 AAAGKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFT 358
             AG  + +  F  V   +  KGS  G    R++    +  +  G +K    +    G +
Sbjct: 301 -PAGAYVKSDVFSHVVKSISIKGSYVG---NRADTREAIDFFSRGLVKSPITVV---GLS 353

Query: 359 DINSAFEDLHHGDCL-RTVLDLSK 381
           ++   +E +     L R V+D SK
Sbjct: 354 ELPKIYELMEKNKILGRYVVDTSK 377

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/390 (24%), Positives = 153/390 (39%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKGVIFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDWPLDVKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  G+ VAI GA G +G   +Q A   G  +I+ +D  D+K     + G   F
Sbjct: 164 KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALFKELGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++ +K  KD   I   ++E T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 IDFTK-TKD---IEAAVIEATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTCVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
              G    +  F  V            +K  S +G  V +  D +  +D F         
Sbjct: 275 -PGGAYCKSEVFSHV------------VKSISIVGSYVGNRADTREAIDFFTRGLVKAPI 321

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
           H    + +   FE +  G  + R V+D ++
Sbjct: 322 HIAPLSAVPEIFEKMEKGQIVGRYVVDCNQ 351

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 93/380 (24%), Positives = 148/380 (38%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V YE G PL  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 37  PKTQKAVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 96

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C++G  + C           
Sbjct: 97  VGGHEGSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNC----------- 145

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 146 -----------EHADLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY- 193

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K AD++ G  V I G AG +G   VQ A   G  ++I +D    K++     G   F
Sbjct: 194 KALKEADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVF 252

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + +V  + E T GG     + + +   +  + +      G  +++G+ A 
Sbjct: 253 IDFTK----SKDMVKDIQEATKGGPQGVINVSVSEAAISLSTQYVRPT-GTVVLVGLPAH 307

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 308 AYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKIV---GLSELPK 361

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            ++ +  G  L R V+D SK
Sbjct: 362 VYDLMEKGQILGRYVVDTSK 381

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 106/235 (45%), Gaps = 37/235 (15%)

Query: 166 APLDKTCLLGCGVTTGYGAAV----------KTADVQKGDTVAIFGAGTVGLSVVQGAHV 215
           +P D    L  GV+   GA V          K A V+ G  V +FGAG VGL     A  
Sbjct: 133 SPEDFLVKLPEGVSYEEGACVEPLSVGVHSNKLAGVRFGTKVVVFGAGPVGLLTGAVARA 192

Query: 216 RGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKD-GQTIVDKLVEMTDGG-LDFTFDC 273
            GA+ +I VD+ D K Q + DFGAT+  N S+   D  Q + D + ++  G   D  F+C
Sbjct: 193 FGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHADVVFEC 252

Query: 274 TGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKG--RS 331
           +G  DV   A     K  G  + +G+   GK  +  P   V+G+  K      + G  R 
Sbjct: 253 SG-ADVCIDAAVKTTKVGGTMVQVGM---GKNYTNFPIAEVSGKEMK------LIGCFRY 302

Query: 332 EMGGLVSDYMD-------GKLKVDEFITHRRGFTDINSAFED--LHHGDCLRTVL 377
             G    DY D       GK+ V   ITH+  F D   A++    H G+ ++T++
Sbjct: 303 SFG----DYRDAVNLVATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 96/204 (47%), Gaps = 27/204 (13%)

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPS 246
           K A V+ G  V +FGAG VGL     A   GA+ +I VD+ D K Q + DFGAT+  N S
Sbjct: 164 KLAGVRFGTKVVVFGAGPVGLLTGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSS 223

Query: 247 KGLKD-GQTIVDKLVEMTDGG-LDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGK 304
           +   D  Q + D + ++  G   D  F+C+G  DV   A     K  G  + +G+   GK
Sbjct: 224 QFSTDKAQDLADGVQKLLGGNHADVVFECSG-ADVCIDAAVKTTKVGGTMVQVGM---GK 279

Query: 305 EISTRPFQLVTGRVWKGSAFGGIKG--RSEMGGLVSDYMD-------GKLKVDEFITHRR 355
             +  P   V+G+  K      + G  R   G    DY D       GK+ V   ITH+ 
Sbjct: 280 NYTNFPIAEVSGKEMK------LIGCFRYSFG----DYRDAVNLVATGKVNVKPLITHKF 329

Query: 356 GFTDINSAFED--LHHGDCLRTVL 377
            F D   A++    H G+ ++T++
Sbjct: 330 KFEDAAKAYDYNIAHGGEVVKTII 353

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 92/380 (24%), Positives = 151/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 31  PKTQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F Q+     +    I     L +   + C   T Y 
Sbjct: 140 -PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K AD++ GD VAI G AG +G   VQ A   G  +++ +D  ++K++     G   F
Sbjct: 188 KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVF 246

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + +V  + E T GG     + + +   +  + E   +  G  +++G+ A 
Sbjct: 247 IDFTK----TKNMVSDIQEATKGGPHGVINVSVSEAAISLSTEYV-RPCGTVVLVGLPAN 301

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 302 AYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIV---GLSELPK 355

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            ++ +  G  L R V+D SK
Sbjct: 356 VYDLMEKGKILGRYVVDTSK 375

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 94/383 (24%), Positives = 152/383 (39%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                     GD   I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    + P   L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  G  VAI G AG +G   VQ A   G  ++I +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           V+ +K     + IV  +++ T+GG         N  V  +A+EA     +  G ++++G+
Sbjct: 220 VDFTK----EKDIVGAVLKATNGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
            A  K  S    Q+V      GS  G    R++    +  +  G +K    +    G + 
Sbjct: 272 PANAKCCSDVFNQVVKSISIVGSYVG---NRADTREALDFFSRGLVKSPIKVV---GLST 325

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           +   +E +  G  + R V+D SK
Sbjct: 326 LPEIYEKMEKGQIVGRYVVDTSK 348

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 94/387 (24%), Positives = 154/387 (39%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T  A +    G  L  ++I V  PK+ E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFETNGGKLEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C++C+ G  + C           
Sbjct: 67  VGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PNA----------DLSGYTHDGSFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI G AG +G   VQ A   G  +I+ +D  ++K++   + G   F
Sbjct: 164 KALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K  KD   IV  +++ T+GG     + + +   + ++ E C    G  +++G+   
Sbjct: 223 IDFTK-TKD---IVGDIIKATNGGAHGVINVSVSEAAIGASTEYCRAN-GTVVLVGLPRD 277

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEF-------ITHRR 355
            K  S    Q+V             K  S +G  V +  D +  +D F         H  
Sbjct: 278 AKCKSDVFNQVV-------------KSISIVGSYVGNRADTREALDFFSRGLVKSPIHIA 324

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
             +D+   F  +  G  + R V+D SK
Sbjct: 325 PLSDLPEIFGKMEKGQIVGRYVVDTSK 351

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 93/390 (23%), Positives = 153/390 (39%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                     GD+  I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  G  VAI G AG +G   VQ A   G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++ +K     + IV+ +++ TDGG         N  V  +A+EA     +  G ++++G+
Sbjct: 220 IDFTK----EKDIVNAVLKATDGGAHGVI----NVSVSEAAIEASTRYVRANGTTVLVGM 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
            A  K  S+  F  V            +K  S +G  V +  D +  +D F         
Sbjct: 272 PANAK-CSSDVFNQV------------VKSISIVGSYVGNRADTREALDFFARGLVKSPI 318

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
              G + +   +E +  G  + R V+D +K
Sbjct: 319 KVVGLSTLPEIYEKMEKGQIVGRYVVDTAK 348

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 94/368 (25%), Positives = 148/368 (40%), Gaps = 56/368 (15%)

Query: 26  IVVDPPKAHEVRIKVEYTAVCHTDA--YTLSGVDPEGAF----PSILXXXXXXXXXXXXX 79
           I+ DP   H V+I ++ T +C +D   Y   G+   G +    P +L             
Sbjct: 26  IIEDP---HYVKIAIKATGICGSDIHYYRSGGI---GKYILKAPMVLGHESSGQVVEVGS 79

Query: 80  XXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGED- 138
                K GD V        +     K G+ NLC  +       +  DGT   +    ED 
Sbjct: 80  AVTRVKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDF 137

Query: 139 LLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVA 198
           L+      ++ +   V  +SV                 GV +      K A V+ G  V 
Sbjct: 138 LVKLPEGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGSRVV 175

Query: 199 IFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG-QTIVD 257
           +FGAG VGL     A   GAS ++ +D+ D K   + +FGAT   N SK   D  Q + D
Sbjct: 176 VFGAGPVGLLTGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELAD 235

Query: 258 KLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTG 316
           ++ ++  G   D  F+C+G    + + ++    G G  + IG+   GK  +  P   V+G
Sbjct: 236 EVEKLLSGHHADIVFECSGADACIDAGVKITKVG-GTMVQIGM---GKNYTNFPIAEVSG 291

Query: 317 RVWK-----GSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA--FEDLHH 369
           +  K       +FG  +   ++         GK+ V   ITHR  F D   A  F   H 
Sbjct: 292 KEMKLIGCFRYSFGDYRDAVKL------VASGKVNVKAMITHRFKFEDAAKAYDFNIAHG 345

Query: 370 GDCLRTVL 377
           G+ ++T++
Sbjct: 346 GEVVKTII 353

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 98/383 (25%), Positives = 149/383 (38%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P      + YE G PL  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 29  PKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 88

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C+SG  + C           
Sbjct: 89  VGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNC----------- 137

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    I     + +   + C   T Y 
Sbjct: 138 -----------EHADLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCAGITVY- 185

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K AD++ G  V I G AG +G   VQ A   G  ++I +D    K++     G   F
Sbjct: 186 KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSLGGEIF 244

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHK---GWGQSIIIGV 299
           V+ +K  KD   IV ++ E T GG         N  V  +A+    K     G  +++G+
Sbjct: 245 VDFTK-TKD---IVAEIQEATRGGPQGVI----NVSVSEAAISLSTKYVRPTGTVVLVGL 296

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
            A     S     +V     KGS  G    R++    +  +  G +K    I    G ++
Sbjct: 297 PAHSYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFARGLIKSPIKII---GLSE 350

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           + + ++ +  G  L R V+D SK
Sbjct: 351 LPNVYKLMEEGKILGRYVVDTSK 373

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 107/264 (40%), Gaps = 31/264 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                     GD   I      C  C++C+    + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC----------- 112

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 113 -PDA----------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY- 160

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+AD++ GD VAI GA G +G   +Q A   G  +++ +D   +K +   + G   F
Sbjct: 161 KALKSADLKAGDWVAISGACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGG 266
           V+ +      + ++ ++V+ T+GG
Sbjct: 220 VDYAV----SKDLIKEIVDATNGG 239

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 151/387 (39%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  + I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKGVIFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   +    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI G AG +G   VQ A   G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + I+  +V+ TDGG     + + +   + ++ + C    G  +++G+  A
Sbjct: 220 IDFTK----EKDIIGAVVKATDGGAHGIINVSVSEAAIEASTKYCRAN-GTVVLVGL-PA 273

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------THRR 355
           G + S+  F  V            +K  S +G  V +  D +  +D F            
Sbjct: 274 GAKCSSDVFNHV------------VKSISIVGSYVGNRADTREALDFFARGLVKSPIKVV 321

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
           G + +   +E +  G    R V+D SK
Sbjct: 322 GLSSLPEIYEKMEKGQIAGRYVVDTSK 348

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 94/380 (24%), Positives = 151/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 31  PETQKGVIFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F Q+     +    I     L +   + C   T Y 
Sbjct: 140 -PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K AD++ GD VAI G AG +G   VQ A   G  +++ +D  ++K++     G   F
Sbjct: 188 KALKEADLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVF 246

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K  KD   +V  + E T GG     + + +   +  + E      G  +++G+ A 
Sbjct: 247 IDFTK-TKD---MVSDIQEATKGGPHGVINVSVSEAAISLSTEYVRPT-GTVVLVGLPAN 301

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 302 AYVKSEVFSHVVKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIV---GLSELPK 355

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            ++ +  G  L R V+D SK
Sbjct: 356 VYDLMEKGKILGRYVVDTSK 375

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 90/390 (23%), Positives = 155/390 (39%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE+G  L  +++ V  PK +E+ I ++Y+ VCHTD +   G  P +   P 
Sbjct: 7   PKTQKAVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           I                   K GD+  +      C  C+ C+    + C           
Sbjct: 67  IGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F +Y     V    I   A L +   + C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQEYCTADAVQAARIPQGADLAEVAPILCAGVTVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+AD+  G+ VAI GA G +G   VQ A   G  +++ +D  ++KK+   + G   F
Sbjct: 164 KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMFHEMGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++     +  + +   +++ T+GG         N  V  +A+EA     +  G  +++G+
Sbjct: 223 LD----FRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEASTRYVRSNGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
            A     S    Q+V             K    +G  V +  D +  +D F+        
Sbjct: 275 PANAYCKSEVFSQVV-------------KSYKIVGSYVGNRADTREALDFFVRGLVKSPI 321

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
           H  G + +   +E +  G  + R V+D +K
Sbjct: 322 HIVGLSTLPEIYEKMEKGQIVGRYVVDTTK 351

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 157/385 (40%), Gaps = 41/385 (10%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA 61
           S G P+T  A + YE G  L  ++I V  PK +E+ + V+Y+ VCHTD +   G  P   
Sbjct: 27  SSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDWPLAT 86

Query: 62  -FPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQ 119
             P +                   + GD+  +      C  C++C++G  + C       
Sbjct: 87  KLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEA---- 142

Query: 120 GKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVT 179
                             DL  +    +F QY     V    I     L +   + C   
Sbjct: 143 ------------------DLSGYTRDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGV 184

Query: 180 TGYGAAVKTADVQKGDTVAI-FGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFG 238
           T Y  A+KTA++  G  VAI    G +G   VQ A   G  +++ +D    K       G
Sbjct: 185 TVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALFKKLG 242

Query: 239 ATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIG 298
              F++ +K     + IV  + E T+GG     + + +   +  +++   +  G  +++G
Sbjct: 243 GEVFIDFTK----SKDIVADIQEATNGGPHGAVNVSVSEAAIVQSVKYI-RPTGTVVLVG 297

Query: 299 VAAAGKEISTRPFQLVTGRV-WKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGF 357
           +  A   +++  F  V   +  KGS  G    R++M   +  +  G +K    I    G 
Sbjct: 298 L-PANSYVNSEIFSHVIKSISIKGSYVG---NRADMREAIDFFTRGLVKAPIKII---GL 350

Query: 358 TDINSAFEDLHHGDCL-RTVLDLSK 381
           +++ +A+ +L  G+ + R V+D SK
Sbjct: 351 SELPTAYHELEAGNMVGRFVVDTSK 375

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 121/302 (40%), Gaps = 32/302 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+   L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  VAI G AG +G   VQ A   G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + IV  +V+ TDGG     + + +   + ++   C    G  +++G+ A 
Sbjct: 220 IDFTK----EKDIVSAVVKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAG 274

Query: 303 GK 304
            K
Sbjct: 275 AK 276

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 131/327 (40%), Gaps = 71/327 (21%)

Query: 28  VDPPKA---HEVRIKVEYTAVCHTD----------------AYTLSGVDPEGAFPSILXX 68
           +D PK    HE+ I V +  +C TD                 + LSG+D     P  +  
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 69  XXXXXXXXXXXXXXXXKAGDHVIALYTAECKE--------------CKFCKSGKTNLCGS 114
                           K GD V+   T  C +              C  C+ G  N C +
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 115 VRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLL 174
             + QG G +  G                    F++  VV +  VV I  K PLD   L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 175 GCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWS 234
              ++  + AA + A+ ++G    + G+G +GL+++       A KI+V +    +++ +
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 235 LDFGATDFVNPSKGLKDGQTIVDKLVEMT--DGGLDFTFDCTGNTDVMRSALE-ACHKGW 291
                  F NP+      Q  ++KL E++  D G D+TFDC+G  D   +A++ AC +G 
Sbjct: 231 EKLNVVVF-NPTH--TRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKAACIQGH 287

Query: 292 GQSIIIGVAAAG-KEISTRPFQLVTGR 317
               I+ VA  G K ++  P  +  G 
Sbjct: 288 ----IVNVAIWGPKPVAFHPMDMTYGE 310

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 97/391 (24%), Positives = 145/391 (37%), Gaps = 61/391 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    V  E+  PL  +EI V  PK +E+ I V Y+ VCHTD +   G  P     P 
Sbjct: 35  PKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 94

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C+    + C           
Sbjct: 95  VGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC----------- 143

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F QY     V    I P   L +   + C   T Y 
Sbjct: 144 -PDA----------DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPVLCAGITVY- 191

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  VAI G AG +G   VQ A   G  +++ +D    K++     G   F
Sbjct: 192 KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEELFKTLGGEVF 250

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHK---GWGQSIIIGV 299
           ++     +    IV  +V  T+GG         N  V   A+ A  K     G S+++G+
Sbjct: 251 ID----FQKESDIVGAVVNATNGGAHGVV----NVSVSEGAISASTKYVRACGTSVLVGM 302

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVSDYMDGKLKVDEF---ITHRR 355
            A              G V K   F   ++    +G  V +  D +  +D F   + H  
Sbjct: 303 PA--------------GAVCKSEVFDQVVRSTKIVGSYVGNRADTREALDFFARGLVHAP 348

Query: 356 ----GFTDINSAFEDLHHGDCL-RTVLDLSK 381
                 + +   FE +  G  + R V+D SK
Sbjct: 349 INVVPLSTLPEIFEKMEKGQIIGRYVVDTSK 379

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 147/387 (37%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE+   L  ++I V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                     GD   I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADSVQAAHIPKGTDLAECAPVLCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  G  VAI G AG +G   VQ A   G  +++ +D  + K++     G   F
Sbjct: 161 KALKSANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++        + IV  +++ TDGG     + + +   + ++   C    G ++++G+ A 
Sbjct: 220 ID----FTTEKDIVGAVIKATDGGAHGIINVSVSEAAIEASTRYCRAN-GTTVLVGMPAG 274

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------THRR 355
            K  S    Q+V             K  S +G  V +  D +  +D F            
Sbjct: 275 AKCCSDVFNQVV-------------KSISIVGSYVGNRADTREALDFFARGLVKSPIKVV 321

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
           G + +   +E +  G  + R V+D SK
Sbjct: 322 GLSTLPEIYEKMEKGQIVGRYVVDTSK 348

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 95/395 (24%), Positives = 154/395 (38%), Gaps = 61/395 (15%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           MS   P T    + YE   PL  ++I V  P  +E+ I V Y+ VCHTD +   G  P  
Sbjct: 1   MSTEIPKTQKGVIFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLP 60

Query: 61  A-FPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRAT 118
              P +                   K GD+  I      C  C+ C+    + C      
Sbjct: 61  VKLPLVGGHEGAGVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC------ 114

Query: 119 QGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGV 178
                 P+           DL  +    +F QY     V    I   A L     + C  
Sbjct: 115 ------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPAGADLKNIAPILCAG 158

Query: 179 TTGYGAAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDF 237
            T Y  A+K+A+++ GD +AI GA G +G   +Q     G  +I+ +D   +K++     
Sbjct: 159 VTVY-KAIKSANLKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKL 216

Query: 238 GATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQS 294
           G   F++ ++  KD   I+ ++ + T+GG         N  V  +A+EA     +  G  
Sbjct: 217 GGEYFIDFTQ-CKD---IIAEVKKATNGGAHGVI----NVSVSEAAIEASTNYVRSNGTV 268

Query: 295 IIIGVAAAGKEISTRPFQLVTGRVWKGSAFGG-IKGRSEMGGLVSDYMDGKLKVDEFI-- 351
           +++G+ A              G V K + F   +K    +G  V +  D +  +D F+  
Sbjct: 269 VLVGLPA--------------GAVCKSNVFNQVVKSTKIVGSYVGNRADTREAIDFFVRG 314

Query: 352 -----THRRGFTDINSAFEDLHHGDCL-RTVLDLS 380
                    G + + S F+D+  G  + R V+D S
Sbjct: 315 LVKSPIKVVGLSQLASVFDDMQAGKIVGRVVVDTS 349

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 147/380 (38%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  +++ V  PKA+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 31  PETQKGVIFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPL 90

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD+  I      C  C+ C+ G  + C           
Sbjct: 91  VGGHEGAGIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQA-------- 142

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 143 --------------DLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY- 187

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTAD++ G  VAI G AG +G   VQ A   G  +++ +D  D K++     G   F
Sbjct: 188 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVF 246

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++     +  + +V  + E T+GG     + + +   +  + E      G  +++G+ A 
Sbjct: 247 ID----FRKSKDMVADIQEATNGGPHGVINVSVSEAAISMSTEYVRPT-GVVVLVGLPAD 301

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++       +  G +K    I    G +++  
Sbjct: 302 AYVKSEVFSHVVKSISIKGSYVG---NRADTREATDFFTRGLVKSPIKII---GLSELPE 355

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
           A+E +  G  L R V+D  K
Sbjct: 356 AYELMEQGKILGRFVVDTYK 375

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 93/216 (43%), Gaps = 39/216 (18%)

Query: 85  KAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+    + C              K C  C+ G  NLC       G GV+  G   
Sbjct: 90  KVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  VV+   ++ +  + PLD   L+     T +  AVK + 
Sbjct: 146 -----------------FAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVKISG 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            +KG +  + GAG +GL  +      GASKI+V +I +++ + +   G   F NPSK   
Sbjct: 187 FKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSKHGH 245

Query: 251 DGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEA 286
               I+  L +  D G D+++DC+G      ++L+A
Sbjct: 246 KSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 149/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE G  L  +++ V  PK +E+ I V+Y+ VCHTD +   G  P +   P 
Sbjct: 43  PTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLDVKLPL 102

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   I      C  C+ C+ G    C           
Sbjct: 103 VGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNC----------- 151

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    +     L +   + C   T Y 
Sbjct: 152 -----------EHADLSGYTHDGSFQQYATADAVQAAQLPKGINLAEVAPILCAGVTVY- 199

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTAD+  G  VAI G AG +G   VQ A   G  +++ +D  D+KK+     G   F
Sbjct: 200 KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKLGGEIF 258

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +   KD   +V  + E T GG     + + +   +  + +   +  G  +++G+ A 
Sbjct: 259 IDYTT-TKD---MVGAIQEATQGGPQGVINVSVSEAAISLSTQYV-RPTGSVVLVGLPAN 313

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 314 AYVKSEVFSHVVKSISIKGSYVG---NRADTREAIDFFNRGLIKAPIKII---GLSELPQ 367

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
           A++ +  G  L R V+D SK
Sbjct: 368 AYKMMEAGKILGRYVVDTSK 387

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 150/387 (38%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE+   L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F +Y     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G   AI G AG +G   VQ A   G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + IV  +V+ T+GG     + + +   + ++   C    G  +++G+  A
Sbjct: 220 IDFTK----EKDIVSAVVKATNGGAHGIINVSVSEAAIEASTRYCRAN-GTVVLVGL-PA 273

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------THRR 355
           G + S+  F  V            +K  S +G  V +  D +  +D F            
Sbjct: 274 GAKCSSDVFNHV------------VKSISIVGSYVGNRADTREALDFFARGLVKSPIKVV 321

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
           G + +   +E +  G    R V+D SK
Sbjct: 322 GLSSLPEIYEKMEKGQIAGRYVVDTSK 348

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 103/202 (50%), Gaps = 19/202 (9%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
           A + A ++ G    +FGAG VGL   + A V GA+ ++ VD+++ K + +  FGAT  VN
Sbjct: 163 ANRLAKMRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN 222

Query: 245 PSKGLKDG---QTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA 301
            S  L  G   +T++ K +     G D  F+C+G    +R+ +E C  G G  + +G+  
Sbjct: 223 -SGDLPQGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAG-GTYVQVGM-- 276

Query: 302 AGKEISTRPFQLVTGR--VWKGSAFGGIKG-RSEMGGLVSDYMDGKLKVDEFITHRRGFT 358
            G+E    P   +  +   ++GS F   +G  S+   LVS    GKL +   IT R  F 
Sbjct: 277 -GQEEIQFPISKIPAKEITFQGS-FRYCQGDYSDSIELVS---SGKLSLKPLITRRYQFK 331

Query: 359 DINSAFEDL--HHGDCLRTVLD 378
           +   AF++   H  D ++T+++
Sbjct: 332 EAIEAFDENRDHPLDNVKTIIE 353

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 118/302 (39%), Gaps = 32/302 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V  + G PL   EI V  PK  E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 41  PKTQHAIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 100

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   I      C  C+ C+ G  + C           
Sbjct: 101 VGGHEGAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC----------- 149

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 150 -PEA----------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY- 197

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI GA G +G   +Q A   G  +++ +D  D+K+      G   F
Sbjct: 198 KALKSANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVF 256

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           V+     +  + +V  +V+ T GG     + + +   + S+ E      G  +++G+   
Sbjct: 257 VD----FRKSKDVVADVVKATGGGAHGVINVSVSEAAIESSTEYVRSN-GTVVLVGLPGG 311

Query: 303 GK 304
            K
Sbjct: 312 AK 313

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 120/302 (39%), Gaps = 32/302 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE+   L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKGVIFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I    + C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  VAI G AG +G   VQ A   G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + IV  +++ TDGG     + + +   + ++   C    G  +++G+ A 
Sbjct: 220 IDFTK----EKDIVGAVIKATDGGAHGIVNVSVSEAAIEASTRYCRAN-GTVVLVGLPAG 274

Query: 303 GK 304
            K
Sbjct: 275 AK 276

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 97/218 (44%), Gaps = 43/218 (19%)

Query: 85  KAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+    + C              K C+ CK G  NLC +     G GV+  G   
Sbjct: 90  KVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLC-THGGFIGLGVISGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++   V++  ++ +  + PLD   L+     T +  AVK + 
Sbjct: 146 -----------------FAEQVAVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKISG 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            +KG +  + GAG +GL  +      GA KI+V ++ +++ + + + G   F NPS   K
Sbjct: 187 FKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAKNLGVEVF-NPS---K 242

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEA 286
            GQ  ++ L  +T    G D+++DC+G      ++L+A
Sbjct: 243 HGQKSIEVLRGLTKSHDGFDYSYDCSGIQVTFETSLKA 280

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/264 (27%), Positives = 104/264 (39%), Gaps = 31/264 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+G  L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 33  PTTQKGVIFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 92

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   I      C  C+ C+ G  + C           
Sbjct: 93  VGGHEGAGVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC----------- 141

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                   H     DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 142 -------LH----ADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY- 189

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTAD++ G  VAI G AG +G   VQ A   G  +I+ +D    K++     G   F
Sbjct: 190 KALKTADLKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVF 248

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGG 266
           ++ +K  KD   IV  + E T GG
Sbjct: 249 IDFTK-TKD---IVSAIQEATKGG 268

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/383 (22%), Positives = 153/383 (39%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + Y+ G PL  +++ V  PK +E+ I ++Y+ VCHTD +   G  P +   P 
Sbjct: 7   PQTQKAVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDWPLDTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           I                   K GD+  +      C  C+ C+    + C           
Sbjct: 67  IGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F +Y     V    I     L +   L C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQEYCTADAVQAARIPQGTDLAQVAPLLCAGVTVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+AD+  G  VAI GA G +G   +Q A   G  +++ +D  ++KK+   + G   F
Sbjct: 164 KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMFHELGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++     +  + +   +++ T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 LD----FRLEKDMEAAIIKATNGGAHGVI----NVSVSEAAIESSTRYVRSNGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
            A     S    Q+V      GS  G    R++    +  +  G +K      H  G + 
Sbjct: 275 PANAYCKSEVFAQVVKSYKIVGSYVG---NRADTREALDFFSRGLVKSP---IHIVGLST 328

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           +   +E +  G  + R V+D +K
Sbjct: 329 LPEIYEKMEKGQIVGRYVVDTTK 351

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 92/380 (24%), Positives = 150/380 (39%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  PK +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 31  PQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPL 90

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+FC+SG  + C           
Sbjct: 91  VGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC----------- 139

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F Q+     +    I     L +   + C   T Y 
Sbjct: 140 -PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY- 187

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K A+++ GD VAI G AG +G   VQ A   G  +++ +D   +K++     G   F
Sbjct: 188 KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQLGGEVF 246

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K  KD   +V  + E T GG     + + +   +  + E      G  +++G+ A 
Sbjct: 247 IDFTK-TKD---MVSDIQEATKGGPQGVINVSVSEAAISLSTEYVRPT-GTVVLVGLPAN 301

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     ++     KGS  G    R++    +  +  G +K    I    G +++  
Sbjct: 302 AYVKSEVFSHVIKSINIKGSYVG---NRADTREALDFFSRGLIKSPIKIV---GLSELPM 355

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            ++ +  G  L R V+D SK
Sbjct: 356 VYDLMEKGKILGRYVVDTSK 375

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 86/188 (45%), Gaps = 20/188 (10%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
           AVK A V+ GD V +FGAG VGL V       GA++++ +D+ D+K   SL+ G+T  +N
Sbjct: 162 AVKLAGVKFGDKVVVFGAGPVGLLVGSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAIN 221

Query: 245 PSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGK 304
            SK + +    ++   ++     +   DCTG    +RS++ AC  G G  + +G+     
Sbjct: 222 -SKDMAEEALALEIQNDLNGQHPNKVIDCTGAEPCLRSSILACKPG-GTVVQVGMGTTNA 279

Query: 305 EISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDG-------KLKVDEFITHRRGF 357
            +       V+  V K   F G      M     DY D        K+ V   ITHR  F
Sbjct: 280 SLP------VSDIVIKELTFKG-----SMRYCHGDYQDAIQLLKYKKVDVKAIITHRFSF 328

Query: 358 TDINSAFE 365
            D   A +
Sbjct: 329 DDAIKALQ 336

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 149/365 (40%), Gaps = 57/365 (15%)

Query: 31  PKAHEVRIKVEYTAVCHTDA-YTLSGVDPEGAF----PSILXXXXXXXXXXXXXXXXXXK 85
           P  H V++ ++ T +C +D  Y  SG    G +    P +L                  K
Sbjct: 27  PNEHYVKVAIKATGICGSDIHYYKSG--SIGKYVVNQPMVLGHESSGEVVEVGSAVRSIK 84

Query: 86  AGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGT-SRFHNKKGEDLLHFMG 144
            GD V        +     K G+ NLC  +       +  DGT  +++    + L+    
Sbjct: 85  VGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTLVKYYVSPADFLVKLPD 142

Query: 145 CSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGT 204
             +F +   +  +SV                 GV      A K A V  G  V +FGAG 
Sbjct: 143 HVSFEEGACIEPLSV-----------------GVH-----ANKLAKVHFGSVVVVFGAGP 180

Query: 205 VGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQ-TIVDKLVEMT 263
           VGL     A   GAS++I VD+ D K + +  FGAT  +N SK L  G+   V   V   
Sbjct: 181 VGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTIN-SKSLPRGEGDAVSAAVSNY 239

Query: 264 DGG--LDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
            GG   D  F+C+G    + S + +   G G  + IG+   GK     P   V+G+  + 
Sbjct: 240 LGGALADVVFECSGAEPCINSGVLSTKNG-GTMVQIGM---GKNYINFPLAEVSGK--EM 293

Query: 322 SAFGGIKGRSEMGGLVSDYMD-------GKLKVDEFITHRRGFTDINSAFED--LHHGDC 372
           S  G    R   G    DY D       G+++V + IT+R  F D  +A++    + G+ 
Sbjct: 294 SVIGCF--RYSFG----DYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNIANGGEV 347

Query: 373 LRTVL 377
           ++T++
Sbjct: 348 VKTII 352

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 91/390 (23%), Positives = 149/390 (38%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A + YE G PL  ++I V  P A E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PKTQKAVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDWPLPTKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C+ C+    + C           
Sbjct: 67  VGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC----------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 -PEA----------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAEVAPVLCAGITVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A++  GD VAI GA G +G   +Q A   G  +++ +D   +K +     G   F
Sbjct: 164 KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELFKQLGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           ++        + +  ++++ T+GG         N  V  +A+E+     +  G  +++G+
Sbjct: 223 ID----FTTCKDVEGEIIKATNGGAHGVI----NVSVSEAAIESSTRYVRANGTVVLVGL 274

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEF-------IT 352
              G +  +  F  V            +K  S +G  V +  D +  +D F         
Sbjct: 275 -PGGAKCRSDVFSHV------------VKSISIVGSYVGNRADTREALDFFSRGLVKSPI 321

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
              G + +   FE +  G  + R V+D SK
Sbjct: 322 KVVGLSTLPEVFEKMEKGQIVGRYVVDTSK 351

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 93/383 (24%), Positives = 148/383 (38%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T  A V    G  L  ++I V  P A+E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESCELSNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G+ VAI G AG +G   VQ A   G  ++I +D  D+K+Q     G   F
Sbjct: 161 KALKSANLRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           V+     +  + +V +++E+T GG         N  V  +A+E+     +  G  +++G+
Sbjct: 220 VD----FRKSKDVVAEILEVTGGGAHGVV----NVSVSEAAIESSTHYVRANGTVVLVGL 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
               K  S     +V      GS  G    R++    +  +  G +K    I    G ++
Sbjct: 272 PGGAKCCSDVFNHVVKSISIVGSYVG---SRADTRQALDFFARGLVKSPIKIV---GLSE 325

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           +   FE +  G    R V+D +K
Sbjct: 326 LPDVFEKMEKGQIAGRYVVDTAK 348

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 121/302 (40%), Gaps = 38/302 (12%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE    L  ++I V  P  +E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 7   PETQKGVIFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDWPLPVKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C+ C+ G  + C           
Sbjct: 67  VGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQA-------- 118

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I P   L +   + C   T Y 
Sbjct: 119 --------------DLSGYTHDGSFQQYATTDAVQAAKISPGTDLAEVAPVLCAGLTVY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  VAI GA G +G   VQ A   G  +++ +D  D+K +   + G   F
Sbjct: 164 KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMFKELGGEYF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEAC---HKGWGQSIIIGV 299
           ++ +K  KD   I+ ++V+ T+GG         N  V  +A+ A     +  G  +++G+
Sbjct: 223 IDFTK-CKD---IIGEVVKATNGGAHGVI----NVSVSEAAISASTRYARANGTVVLVGL 274

Query: 300 AA 301
            A
Sbjct: 275 PA 276

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 93/216 (43%), Gaps = 39/216 (18%)

Query: 85  KAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+    + C              K C+ CK G  NLC       G GV+  G   
Sbjct: 90  KVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLCAH-SGFVGLGVISGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  VV++  ++ +  + PLD   L+     T +  AVK + 
Sbjct: 146 -----------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVKLSG 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            +KG +  + GAG +GL  +      GA KI+V ++ +++ + +       F NP++   
Sbjct: 187 FKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKMAKSLDVEVF-NPAQHGH 245

Query: 251 DGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEA 286
               ++  L E  D G D+++DC+G      ++L+A
Sbjct: 246 KSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 91/385 (23%), Positives = 152/385 (39%), Gaps = 41/385 (10%)

Query: 2   SEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSG---VDP 58
           S   P T  A V YE G  L   +I V  PK +E+ + ++Y+ VCHTD +   G   + P
Sbjct: 25  STAIPTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKP 84

Query: 59  EGAFPSILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRA 117
           +   P +                   + GD+  +      C EC+FC+ G    C +   
Sbjct: 85  K--LPLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCET--- 139

Query: 118 TQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCG 177
                  P  +   H+             TF QY     +    I P   L K   + C 
Sbjct: 140 -------PTLSGYTHD------------GTFQQYATADAIHAAHIPPGTDLAKVAPILCA 180

Query: 178 VTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDF 237
             T Y  A+KTA +  G  VAI GAG    S+     V    +++ +D  ++K+      
Sbjct: 181 GITVY-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSL 239

Query: 238 GATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIII 297
           G   FV+  K  KD   IV  + E T GG     + + +T+ +  ++E   +  G  +++
Sbjct: 240 GGETFVDFHKN-KD---IVSAVREATGGGPHGVVNVSVSTNAILQSVEYV-RPTGTVVLV 294

Query: 298 GVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGF 357
           G+       S     ++     KGS  G    R++    +  +  G ++    I    G 
Sbjct: 295 GLPPDATVKSDVLTHVLKSINIKGSYVG---NRADTKEAIEFFTRGLVQSPIKII---GL 348

Query: 358 TDINSAFEDLHHGDCL-RTVLDLSK 381
           + +  A++ +  G  + R V+D S+
Sbjct: 349 SQLEEAYKAMEEGTSIGRYVVDTSR 373

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 147/380 (38%), Gaps = 39/380 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE+G  L  +++ V  P+ +E+ + V+Y+ VCHTD +   G  P +   P 
Sbjct: 26  PSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPL 85

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   I      C+ C+ C+ G  + C           
Sbjct: 86  VGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHA-------- 137

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    TF QY     +    I     L     + C   T Y 
Sbjct: 138 --------------DLSGYTHDGTFQQYATADAIQAAHIPKGTDLAGVAPILCAGVTVY- 182

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A++++  + G+ VAI G AG +G    Q A   G  +++ +D  + K +     G   F
Sbjct: 183 KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKSLGGEIF 241

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           ++ +K     + I   ++E T GG     + + +   M  ++E   +  G  +++G+ A 
Sbjct: 242 IDFTK----EKDIPAAILEATQGGAHGVINVSVSEKAMSQSVEYV-RPQGTVVLVGLPAN 296

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
               S     +V     KGS  G    R++    V  +  G +K    I    G +++  
Sbjct: 297 AVIKSNVFNHVVKSFSIKGSYVG---NRADSREAVEFFSRGLVKSPIKIV---GLSELPK 350

Query: 363 AFEDLHHGDCL-RTVLDLSK 381
            +E +  G  L R V+D SK
Sbjct: 351 IYELMEAGKILGRYVVDTSK 370

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 92/218 (42%), Gaps = 43/218 (19%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+   T  C +              C  CK G  N C  +    G G    G   
Sbjct: 91  KVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACKRGIYNCCTHL-GFCGLGAHGGG--- 146

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            FS+  V+++  V+ I  + PLD   L+     + +  AVK ++
Sbjct: 147 -----------------FSEKVVISEQHVIKIPKEIPLDIAALVEPISVSWH--AVKISN 187

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
           ++ G +  + GAG +GL+ +      GA KI+V +    +++ +   G   F NP    +
Sbjct: 188 LKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF-NP---FE 243

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEA 286
            G+  V++L ++  G  G DF+FDC+G      + L A
Sbjct: 244 HGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 87/387 (22%), Positives = 150/387 (38%), Gaps = 53/387 (13%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P 
Sbjct: 29  PATQKGVIFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPL 88

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   +    + C  C++C+ G  + C           
Sbjct: 89  VGGHEGAGVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA-------- 140

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     +    I     L +   + C   T Y 
Sbjct: 141 --------------DLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY- 185

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KT+  + G  VAI G AG +G   VQ A   G  +++ +D  + K++     G   F
Sbjct: 186 KALKTSGAKPGQWVAISGAAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVF 244

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAA 302
           V+ +K  KD   +V  + E T+GG     + + +   ++ + E   +  G  +++G+ A 
Sbjct: 245 VDFTK-TKD---MVSAIQEATNGGPHAVVNVSVSEAAIQQSTEYV-RPTGTVVLVGLPAH 299

Query: 303 GKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRR------- 355
              + +  F  V            +K  S  G  V +  D +  +D F  +         
Sbjct: 300 AY-VKSEIFSHV------------VKSISIKGSYVGNRADTREAIDFFSRNLVKSPIKII 346

Query: 356 GFTDINSAFEDLHHGDCL-RTVLDLSK 381
           G +++   +E +  G  L R V+D S+
Sbjct: 347 GLSELPKVYELMEEGKILGRYVVDTSR 373

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 94/390 (24%), Positives = 149/390 (38%), Gaps = 59/390 (15%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T    + YE    L  +++ V  PK  E+ I V Y+ VCHTD +   G  P +   P 
Sbjct: 9   PKTQKGVIFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPL 68

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C+    + C           
Sbjct: 69  VGGHEGAGVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC----------- 117

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            P+           DL  +    +F QY     V    I   A + +   + C   T Y 
Sbjct: 118 -PEA----------DLSGYTHDGSFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY- 165

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ GD VAI G AG +G   VQ A   G  +++ +D  D+K+++    G   F
Sbjct: 166 KALKSAELKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVF 224

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGV 299
           V+        + IV  + E T+GG      C  N  V   A+EA     +  G  +++G+
Sbjct: 225 VD----FMTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEASTQYVRTNGTVVLVGL 276

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-------T 352
             AG    +  F  V            +K    +G  V +  D +  +D F+        
Sbjct: 277 -PAGAYCKSEVFDQV------------VKSYKIVGSYVGNRADTREALDFFVRGLVKPTI 323

Query: 353 HRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
              G + +   +E +  G  + R V+D SK
Sbjct: 324 KVVGLSTLPEIYEKMEKGQIVGRYVVDTSK 353

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 91/217 (41%), Gaps = 41/217 (18%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+   T  CK+              C  CK G  N+C  +    G GV   G   
Sbjct: 90  KVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNICSKL-GLCGAGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +    PLD   L+       +  A++  +
Sbjct: 146 -----------------FAERVVMNESHCHKVPDDLPLDIAALIQPIAVCWH--ALRICN 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            +KG +  + G+G +GL ++   H  G + I+V +    ++ ++ + GAT F +PS  L 
Sbjct: 187 FKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRDFAKELGATVF-DPSS-LP 244

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALE 285
             +  +  L  +  G  G D+TFDC+GN     +++E
Sbjct: 245 THEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 91/222 (40%), Gaps = 51/222 (22%)

Query: 85  KAGDHVIALYTAECK--------------ECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+   T  CK              EC  CK    N C                  
Sbjct: 90  KVGDHVVVETTGTCKDRYRWPDVKHASDEECAACKKDFYNCCSE---------------- 133

Query: 131 FHNKKGEDLLHF--MGCST--FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAV 186
                    L F  +GC +  F++  V+++  VV +    PLD   L+     + +  AV
Sbjct: 134 ---------LGFCGLGCHSGGFAEKVVISEKHVVKVPKDIPLDVAALVEPLAVSWH--AV 182

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPS 246
           + + ++ G +  I GAG +GL+ V      GA  I+V + +  +++ +   GA  F NP 
Sbjct: 183 RISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPSASRRKQAEALGALTF-NP- 240

Query: 247 KGLKDGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEA 286
                G   VD+L ++  G  G DF++DC+G      + L A
Sbjct: 241 --FDHGDKAVDELRKIPPGSDGFDFSYDCSGLKATFNTGLYA 280

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 95/383 (24%), Positives = 145/383 (37%), Gaps = 45/383 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A +  E   PL  ++I V  PK +E+ I V Y+ VCHTD +   G  P     P 
Sbjct: 4   PETQKAVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C+ C+    + C           
Sbjct: 64  VGGHEGAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC----------- 112

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
            PD           DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 113 -PDA----------DLSGYTHDGSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  VAI G AG +G   VQ A   G  +++ +D    K++     G   F
Sbjct: 161 KALKSANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECF 219

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHK---GWGQSIIIGV 299
           ++ +K       I + +++ T+GG         N  V   A+ A  K     G S+++G+
Sbjct: 220 IDFTK----EHDIAEAVIKATNGGAHGVI----NVSVSEGAISASTKYVRSCGTSVLVGM 271

Query: 300 AAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTD 359
            A     S    Q+V      GS  G    R++    +  +  G +K    I    G + 
Sbjct: 272 PAGAICKSEVFDQVVRSTKIVGSYVG---NRADTREALDFFARGLVKAPIKIV---GLST 325

Query: 360 INSAFEDLHHGDCL-RTVLDLSK 381
           +   FE +  G    R V+D SK
Sbjct: 326 LPEIFEKMEKGLIAGRYVVDTSK 348

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 61.6 bits (148), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 148 FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGL 207
           F++  VV +  +V +  + P D   L+   ++  +  AV+ +  +KG +  I GAG +GL
Sbjct: 149 FAERVVVGERHIVKLPEEVPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGL 206

Query: 208 SVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDG-- 265
           + +      GASKI+V ++ ++++  +   G   F +PS   K G   V +L  +  G  
Sbjct: 207 AAILALKAHGASKIVVSELAERRRILASKMGVEVF-DPS---KHGDNAVTELRNIPRGQH 262

Query: 266 GLDFTFDCTGNTDVMRSALEA 286
           G D+ FDC+G      +AL+A
Sbjct: 263 GFDYAFDCSGVKATFNTALKA 283

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 84/180 (46%), Gaps = 10/180 (5%)

Query: 148 FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGL 207
           F++  +V +  +V I  + PLD   L+     T + A  K     KG T  I G+G +GL
Sbjct: 146 FAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGL 203

Query: 208 SVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGL 267
           +++      GASKI+V ++   +++ +       F +PS   K+    +  L E  D G 
Sbjct: 204 AMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVF-DPSVHGKNTSNELRLLTENKD-GF 261

Query: 268 DFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGI 327
           DF FDC+G    M +A+   H    +  I+ VA  G   ST  F ++   + + +  G I
Sbjct: 262 DFAFDCSGLEVTMNTAI---HATKCRGTIVNVAVWG---STMEFNMMDITLQEKTLIGSI 315

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 94/218 (43%), Gaps = 43/218 (19%)

Query: 85  KAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+    + C              K C  CK G  NLC       G GV+  G   
Sbjct: 90  KVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCTHA-GFIGLGVISGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  VV++  ++ +  + PLD   L+     T +  AV+ + 
Sbjct: 146 -----------------FAEQVVVSEHHIIPVPKEIPLDVAALVEPLSVTWH--AVRLSG 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            +KG +  + GAG +GL  +      GA +I+V ++ +++ + +   G   F +P    K
Sbjct: 187 FKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMELARRLGVEIF-DPR---K 242

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEA 286
            G+  V+ L  +T    G D+++DC+G      ++L+A
Sbjct: 243 HGEKSVESLRALTKSHDGFDYSYDCSGIQATFDASLKA 280

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 141/369 (38%), Gaps = 39/369 (10%)

Query: 18  GKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPSILXXXXXXXXXX 76
           G  L  E++ V  P ++EV I V+Y+ VCHTD +T  G  P +   P +           
Sbjct: 39  GPLLYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVA 98

Query: 77  XXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKK 135
                   + GD   +    + C  C+ C+ G    C      +  G   DG        
Sbjct: 99  KGKDVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG-------- 147

Query: 136 GEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGD 195
                      TF QY  +  +    +     L     + C   + Y  A+K  ++Q   
Sbjct: 148 -----------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQ 195

Query: 196 TVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQT 254
            VAIFGA G +G   VQ A   G   + +    +++KQ     G   F++ ++       
Sbjct: 196 WVAIFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFLDYTQ----VDN 251

Query: 255 IVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLV 314
           I   + + T GG     + T +       ++ C +  G  + +GV      + T  F +V
Sbjct: 252 IPAAVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIV 310

Query: 315 T-GRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCL 373
             G   KGSA G    R++    V  +  G +K    I    G +++  AFE L  G   
Sbjct: 311 QHGFSIKGSASG---SRADTREAVDFFTRGLIKSPIKIL---GLSELPKAFELLESGQTT 364

Query: 374 -RTVLDLSK 381
            R VLD SK
Sbjct: 365 GRLVLDTSK 373

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 77/158 (48%), Gaps = 13/158 (8%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCG----VTTGYGAAVKTADVQK 193
           D + ++   TF+QYT +A+   ++  P+   DK   L       V T    A +   V+K
Sbjct: 100 DKVAYLSAGTFAQYTKIAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKK 159

Query: 194 GDTVAIF-GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD V ++  AG VGL+  Q     GA  I V    D+K Q + +FGA   VN SK     
Sbjct: 160 GDFVLLYAAAGGVGLAFNQILKRLGAHTIAVAS-TDEKLQLAKEFGAEYLVNSSK----- 213

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHK 289
           + ++ +++E+T G G+D  +D  G  D   + L A  +
Sbjct: 214 EDVLARVLEITQGQGVDVAYDSIGK-DTFETTLSALRR 250

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 96/243 (39%), Gaps = 39/243 (16%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV    T  C++              C  CK G  N+C  +    G GV   G   
Sbjct: 90  KVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRGMYNVCSHL-GLIGNGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +    P++   L+     + +  AV+ + 
Sbjct: 146 -----------------FAERVVINESHCYKLPNHIPMEVVALVQPIAVSWH--AVRVSK 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            + G +V I G G +GLS +   +  G ++I+V +    ++  +   GA  +       +
Sbjct: 187 FKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPAKIRRDLAEKMGAVVYDPMQHSYE 246

Query: 251 DGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRP 310
           +    +  L    D G D+ FDC+G    +RS++E C    G ++ + + A GK I   P
Sbjct: 247 ENIKYLRALAPDKD-GFDYCFDCSGTPATLRSSIE-CLTFRGTAVNVAMWATGKPIDFFP 304

Query: 311 FQL 313
             +
Sbjct: 305 MDI 307

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 71/143 (49%), Gaps = 8/143 (5%)

Query: 148 FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGD--TVAIFGAGTV 205
           F++  VV +  VV +  + P D   L+       +  AVK A  +KG      + GAG +
Sbjct: 146 FAEQVVVGERHVVKLPEEVPTDVGALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPI 203

Query: 206 GLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTD- 264
           GL+ +      GASKI+V ++   +++ +L  G   F +PSK   + Q I  KL E+ + 
Sbjct: 204 GLATILALKAHGASKIVVSELAAIRRELALKMGVEVF-DPSKHGDEKQGI-KKLREIPED 261

Query: 265 -GGLDFTFDCTGNTDVMRSALEA 286
             G DF FDC+G      +AL +
Sbjct: 262 HDGFDFAFDCSGVETTFNTALHS 284

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 90/219 (41%), Gaps = 42/219 (19%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+   TA C +              C+ C++G  N+C  +  T G GV   G   
Sbjct: 90  KIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNGMPNICKYLGLT-GAGVEGGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     I    PLD   L+       +  AVK + 
Sbjct: 146 -----------------FAEKMVINEHHCHKIPHHMPLDVASLIQPISVCWH--AVKVSH 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            ++G +V I G G +GL  +      G   I+V +    +++ +   GA  F +PS    
Sbjct: 187 YKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPALIRRELAEKMGARVF-DPSNMSL 245

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEAC 287
           D    +  L EM  G  G D+TFDC+G    ++ A+E C
Sbjct: 246 DNS--IKTLTEMAPGSQGFDYTFDCSGIPATLKVAIECC 282

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 105/264 (39%), Gaps = 31/264 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSG-VDPEGAFPS 64
           P T  A +  E G  L  ++I V  PK++E+ I V Y+ VCH+D +   G +      P 
Sbjct: 7   PKTQKAIIFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDLPLPLKLPL 66

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I      C  C+FC+      C     T   G 
Sbjct: 67  VGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHADFT---GT 123

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
           + DG                   +F QY     V    I     L     L C   T Y 
Sbjct: 124 VHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLLCAGLTAY- 163

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  VAI GA G +G   +Q A   G  +++ +D  ++K ++    G   F
Sbjct: 164 KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYFKTLGGEVF 222

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGG 266
           ++     K  + +V  +++ TDGG
Sbjct: 223 ID----YKKSKDVVADVIKATDGG 242

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 92/392 (23%), Positives = 153/392 (39%), Gaps = 52/392 (13%)

Query: 1   MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG 60
           M+   P T  A V    G  L  ++I V  P+ +E+ I V+Y+ VCHTD +   G  P  
Sbjct: 1   MTTQIPKTQKAVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWP-- 58

Query: 61  AFPSILXXX-----XXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGS 114
             P+ L                       + GD   I      C  C++C+    + C  
Sbjct: 59  -LPTKLPLVGGHEGAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQ 117

Query: 115 VRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLL 174
                                  DL  +    +F QY     V    +     L +   +
Sbjct: 118 A----------------------DLSGYTHDGSFQQYATADAVQAARVPKGTDLAEVAPI 155

Query: 175 GCGVTTGYGAAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQW 233
            C   T Y  A+K+A+++ G+ VAI GA G +G   VQ A   G  +++ +D  D+K + 
Sbjct: 156 LCAGITVY-KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKL 213

Query: 234 SLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEAC---HKG 290
               G   F++ +K     + ++ ++++ TDGG         N  V   A+ A     + 
Sbjct: 214 FKQLGGEYFIDFTK----SKDVIAEVIKATDGGAHGVI----NVSVSEGAISASTRYARA 265

Query: 291 WGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEF 350
            G  +++G+ A     S    Q+V      GS  G    R++    +  +  G +K    
Sbjct: 266 NGTVVLVGLPANAYCKSEVFNQVVKSVAIVGSYVG---NRADTREALDFFARGLVKSPIK 322

Query: 351 ITHRRGFTDINSAFEDLHHGDCL-RTVLDLSK 381
           I    G + +   +E +  G  + R V+D SK
Sbjct: 323 IV---GLSTLPEIYEKMEKGQIVGRYVVDTSK 351

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 87/230 (37%), Gaps = 27/230 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V    G  L  ++I V  P + E+ I V+Y+ VCHTD +   G  P     P 
Sbjct: 4   PKTQKAIVFASNGGELEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPL 63

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   I      C  C++C+ G  + C           
Sbjct: 64  VGGHEGAGVVVALGENVKGWKVGDLAGIKWLNGSCMACEYCELGNESNCPHA-------- 115

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 116 --------------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY- 160

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQ 232
            A+K+AD++ G  VAI GA G +G   VQ A   G  +++ +D  D K++
Sbjct: 161 KALKSADLKAGQWVAISGACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 99/249 (39%), Gaps = 31/249 (12%)

Query: 21  LTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPSILXXXXXXXXXXXXX 79
           L   +I V  PK++E+ I V+Y+ VCHTD +   G  P     P +              
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 80  XXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGED 138
                K GD   I      C  C+ C++G    C                      +  D
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANC----------------------EHAD 148

Query: 139 LLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVA 198
           L  +    +F QY     V    I   + L +   + C   T Y  A+KTA+++ G+ VA
Sbjct: 149 LSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 199 IFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVD 257
           I G AG +G   VQ A   G  +++ +D  ++K++     G   FV+ +K     + IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFVDFTK----SKDIVA 262

Query: 258 KLVEMTDGG 266
            +   T GG
Sbjct: 263 DIQNATKGG 271

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 99/276 (35%), Gaps = 52/276 (18%)

Query: 35  EVRIKVEYTAVCHTDAYTLS----------GVDPEGA--FPSILXXXXXXXXXXXXXXXX 82
           EV I+V +  +C TD +  S          G  P      P  +                
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 83  XXKAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GDHV+      C              K C  C+ G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 129 SRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++   V+    + I    PLD   L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 189 ADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKG 248
           A  QKG T  + GAG +GL+ +      GASKI+V ++   ++  +   G   F NP++ 
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAEH 243

Query: 249 LKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSAL 284
            KD    + K+ E    G D  FDC+G      +AL
Sbjct: 244 -KDAIAELRKIPEGAT-GFDAAFDCSGVKATFNTAL 277

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 104/261 (39%), Gaps = 31/261 (11%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P+T  A +  +    L ++ I V  PKA+E+ I V+++ VCH+D +   G  P +   P 
Sbjct: 10  PLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPL 69

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD+  I    + C  C+ C+      C           
Sbjct: 70  VGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA-------- 121

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                         D+  F    +F QY     V    I P   L +   + C   T + 
Sbjct: 122 --------------DISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF- 166

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+KTA++  G+ VAI GA G +G   +Q A   G S ++ +D   +K+    D G   F
Sbjct: 167 KALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVF 225

Query: 243 VNPSKGLKDGQTIVDKLVEMT 263
           ++ SK     + +V ++V  T
Sbjct: 226 LDFSK----SENLVPEVVSAT 242

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 85/360 (23%), Positives = 132/360 (36%), Gaps = 45/360 (12%)

Query: 12  AVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDA-YTLSGVDPEGAF----PSIL 66
           A+ YE  +P+ V E   DP   H V++K+E T +C +D  Y L G    G F    P +L
Sbjct: 16  AIVYE-HRPVPVIE---DP---HYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 67  XXXXXXXXXXXXXXXXXXKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPD 126
                             + GD V        +  +  KSG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 127 GTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAV 186
           GT   +    ED L  +  S   +   + +   VA+                      A 
Sbjct: 125 GTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAVH---------------------AN 163

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPS 246
           + A  Q    V +FGAG VGL     A   GA+ + +VDI+  K   +   G T  V+ S
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 247 KGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEI 306
                 + + +KL       +D  FDC+G    + +A+  C  G      + V ++   +
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTH---VQVGSSRDYV 279

Query: 307 STRPFQLVTGRVWKGSAFGGIK-GRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFE 365
           S   F L    V +    G  +    +    V      ++     +THR  F     A++
Sbjct: 280 S---FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 91/217 (41%), Gaps = 42/217 (19%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GD V+   T  CK+              C  CK G  N+C ++    G GV   G   
Sbjct: 129 KVGDRVVVEPTGTCKDRYRWPNSPNVDKEPCAACKKGLYNICSNL-GLVGAGVQSGG--- 184

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +     +D   L+     + +  AV+ + 
Sbjct: 185 -----------------FAERLVMNERQCYKVPDHMSMDVAALIQPIAVSWH--AVRVSK 225

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            +KG +V I GAG +GL  +   +  G S+++V +    ++ ++   GA  + +PS   K
Sbjct: 226 FKKGASVLIVGAGPIGLGTILALNGHGVSEVVVSEPAKIRRDFAEKMGAIVY-DPSA--K 282

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALE 285
           D    +  L  +  G  G D+ FDC+GN   +++A+E
Sbjct: 283 DHDESIKYLRSIAPGGDGFDYAFDCSGNPATLKAAIE 319

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 91/218 (41%), Gaps = 42/218 (19%)

Query: 85  KAGDHVIALYTAEC--------------KECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           + GDHV+   T+ C              + C  CK G  N+C  +    G GV   G   
Sbjct: 90  EVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRGLYNICSHL-GLCGVGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            FS+  V+    V+ I    PLD   L+     + +  A++ + 
Sbjct: 146 -----------------FSERVVMNQKHVIKIPKHIPLDVAALVQPLAVSWH--AIRISG 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
           +  G +  + G G +GL  +      GASKI+V +    +++ +   GA  F +P++   
Sbjct: 187 LTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPAKNRRELAKLMGAEVF-DPTEW-- 243

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEA 286
           +    V+ L ++  G  G D++FDC+G     R+++ A
Sbjct: 244 EEHEAVEYLRKVAPGGDGFDYSFDCSGLPVTFRASVHA 281

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 98/203 (48%), Gaps = 21/203 (10%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
           A + A+   G  V +FGAG VGL     A   GAS ++ VD+ + K + S DFGAT+ +N
Sbjct: 161 ANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTIN 220

Query: 245 PSKGLKDGQTIVDKLVEMTDGGL-----DFTFDCTGNTDVMRSALEACHKGWGQSIIIGV 299
            +K   +     D+L E+    L     +   DC+G    +R+A++   K  G  + +G+
Sbjct: 221 STKYKSE-----DELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVL-KAGGSYVQVGM 274

Query: 300 AAAGKEISTRPFQLVTGRVWK--GSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGF 357
              GK+    P  ++  +  +  GS             L+S   +GK+ V + ITH   F
Sbjct: 275 ---GKDNINFPIAMIGAKELRVLGSFRYYFNDYKIAVKLIS---EGKVNVKKMITHTFKF 328

Query: 358 TDINSAFE-DLHHG-DCLRTVLD 378
            +   A+  +L HG + ++T++D
Sbjct: 329 EEAIDAYNFNLEHGSEVVKTMID 351

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 105/220 (47%), Gaps = 23/220 (10%)

Query: 138 DLLHFMGCSTFSQYT-VVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD---VQK 193
           D + ++  STF+QYT   ++ +V+ +  +   ++  L   G+     A   T +   V+K
Sbjct: 89  DKVAYISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQALTALSFTNEAYHVRK 148

Query: 194 GDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD + +F A G VGL + Q   ++GA  I V    D+K + + ++GA   +N SK     
Sbjct: 149 GDYILLFAAAGGVGLILNQLLRMKGAHAIAVAS-TDEKLEIAKEYGAEYLINSSK----- 202

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
           + I+ K++E+T+G G+D +FD  G  D     L A  +   + + +    A   I   PF
Sbjct: 203 EDILKKVLEITNGEGVDASFDSVGK-DTFEITLAALKR---KGVFVSFGNASGLIP--PF 256

Query: 312 QLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI 351
                 + + S       R ++ G ++D  + K   DEF+
Sbjct: 257 S-----INRLSPKNITLVRPQLYGYIADLKEWKSYTDEFV 291

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 103/255 (40%), Gaps = 44/255 (17%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GDHV+      CK+              C  CK G  N+C ++    G GV   G + 
Sbjct: 90  KVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKGHYNVCSNL-GLIGNGVQSGGCA- 147

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                              +   + +     +    P+D   L+     + +  A+K A 
Sbjct: 148 -------------------ERMCINESHCFKVPKDMPMDIAALIQPIAVSWH--AIKVAR 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            ++G +V + G G +GL  +      G S I+V +    +++ +   GAT + +PS+   
Sbjct: 187 FKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPAKVRRELAERMGATTY-DPSQ--H 243

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEIST 308
           + +  +  L +M  G  G D+ FD +G  + + +A+E C    G ++ + +    K +  
Sbjct: 244 NTEKNIQNLRKMILGGDGFDYVFDNSGTPETLETAIE-CLTVRGTAVNVAMWPPHKRVEF 302

Query: 309 RPFQLV-TGRVWKGS 322
            P  +    +++ GS
Sbjct: 303 SPMAVTKEEKIYTGS 317

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 91/197 (46%), Gaps = 13/197 (6%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
           A K A  + G  V + GAG VGL     A   GA++++ VDI ++K + S  FGAT  V+
Sbjct: 160 ANKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVS 219

Query: 245 PSKGLKDGQTIVDKLVEMTDGGL-DFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303
            S    D +  V ++ ++  G L +   +C+G    +R  ++AC K  G  + +G+   G
Sbjct: 220 SS---SDEERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKAC-KAGGHYVQVGM---G 272

Query: 304 KEISTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
           K+    P   V +  +     F   KG  +    V+    G++     I+HR  F     
Sbjct: 273 KDDVNFPISAVGSKEITFHGCFRYKKG--DFADSVALLSSGRINGKPLISHRFAFDKAPE 330

Query: 363 A--FEDLHHGDCLRTVL 377
           A  F   H  + ++T++
Sbjct: 331 AYKFNAEHGNEVVKTII 347

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 99/264 (37%), Gaps = 28/264 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGA-FPS 64
           P T    + YE G  L  ++I V  PK +E+ + V+Y+ VCHTD +   G  P     P 
Sbjct: 27  PQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLSVKLPL 86

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   + GD   I      C  C+ C+SG  + C           
Sbjct: 87  VGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC----------- 135

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
                      +  DL  +    +F QY     V    I     L +   + C   T Y 
Sbjct: 136 -----------EHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLCAGITVY- 183

Query: 184 AAVKTADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K A +  G  V I G AG +G   VQ     G  ++I +D    K++     G   F
Sbjct: 184 KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSLGGEVF 242

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGG 266
           ++ +K   D   +V  + + T+GG
Sbjct: 243 IDFTKQKTDSD-MVAAIQKATNGG 265

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
           A K A  + GD V +FGAG VGL     A V GA +++ +D+ D+K + +  FGAT  +N
Sbjct: 162 ANKQAGTRFGDKVVVFGAGPVGLLNGAVAKVFGALQVVFIDVVDEKLERAKHFGATAVIN 221

Query: 245 PSKGLKDGQTIVDKLVEMTDGGL--DFTFDCTGNTDVMRSALEACHKG 290
            SK   + +  +   ++   GG+  D   +CTG    +R+ + A   G
Sbjct: 222 SSKLRINDEFELAVAIKEKLGGVDPDIVLECTGAEPCIRAGIRALKTG 269

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 112/297 (37%), Gaps = 32/297 (10%)

Query: 6   PITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDP-EGAFPS 64
           P T  A V  E G  L   +I V   KA+E+ I V+Y+ VCH+D Y      P     P 
Sbjct: 17  PKTQKAMVFSEYGGDLEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPL 76

Query: 65  ILXXXXXXXXXXXXXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123
           +                   K GD   +    + C  C+ C+ G    C     ++  G 
Sbjct: 77  VGGHEGAGVVVGMGSNVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGF 133

Query: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183
             +G                   +F QY  V  +    +     L +     C   T Y 
Sbjct: 134 TRNG-------------------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY- 173

Query: 184 AAVKTADVQKGDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDF 242
            A+K+A+++ G  +AI GA G +G   +Q     G  +++ +D  + K     + G   F
Sbjct: 174 KAIKSANIRAGQWMAITGACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVF 232

Query: 243 VNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGV 299
           ++ +K     + +V  +V  T+GG           D + ++++      G  +I+ V
Sbjct: 233 IDFTK----SKDLVADVVSATNGGAHGVLSIAATEDAINTSVKYVRSN-GTCVIVSV 284

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 100/220 (45%), Gaps = 23/220 (10%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCG----VTTGYGAAVKTADVQK 193
           D + ++  STF+QY+ ++    V   PK   D+   L       V T      +   V+K
Sbjct: 89  DQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKK 148

Query: 194 GDTVAIF-GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD V +F  AG VGL + Q   ++GA  I V    D+K + + ++GA   +N SK     
Sbjct: 149 GDYVLLFAAAGGVGLILNQLLKMKGAHTIAVAS-TDEKLKIAKEYGAEYLINASK----- 202

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
           + I+ ++++ T+G G+D +FD  G  D    +L A  +   + + +    A   I   PF
Sbjct: 203 EDILRQVLKFTNGKGVDASFDSVGK-DTFEISLAALKR---KGVFVSFGNASGLIP--PF 256

Query: 312 QLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI 351
            +      + S       R ++ G ++D  + K   DEF 
Sbjct: 257 SIT-----RLSPKNITLVRPQLYGYIADPEEWKYYSDEFF 291

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/217 (23%), Positives = 85/217 (39%), Gaps = 42/217 (19%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GD V+   T  C++              C  CK G  N+C S     G GV   G   
Sbjct: 90  KVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +    PLD   L+       +  A++  +
Sbjct: 146 -----------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AIRVCE 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            + G T  I GAG +GL  +   +  G   I+V +    +++ +   GA  +   +   K
Sbjct: 187 FKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEKMGARVYDPTAHAAK 246

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALE 285
           +    +D L  + DG  G D+TFDC+G    + +A++
Sbjct: 247 ES---IDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 78/207 (37%), Gaps = 42/207 (20%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GD V+   T  C++              C  CK G  N+C S     G GV   G   
Sbjct: 90  KVGDKVVVEPTGTCRDRYRWPTSPNVDKEWCAACKRGLYNIC-SYLGLCGAGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +    PLD   L+       +  A+   D
Sbjct: 146 -----------------FAERVVINESHCYKVPEFVPLDVAALIQPLAVCWH--AISVCD 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            + G T  I GAG +GL  +   +  G S I V +    +++ +   GA  F   +   K
Sbjct: 187 FKAGSTALIIGAGPIGLGTILALNAAGCSDIAVSEPAKVRRELAEKMGARVFDPTAHAAK 246

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTG 275
           D    +D L  +  G  G D+TFDC+G
Sbjct: 247 DS---IDYLRSVAPGGDGYDYTFDCSG 270

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 106/269 (39%), Gaps = 44/269 (16%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAF-------PSILXXXXXXXXXXXXXXXXXXKA 86
           H+V+I+++ T +C +D +  +    +G+        P +L                  K 
Sbjct: 29  HDVKIQIKATGICGSDVHYFT----QGSIGDFVVKSPLVLGHESAGVVVEVGDAVSSVKV 84

Query: 87  GDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCS 146
           GD V        +  K   SG  NLC  +          DGT   +    ED ++ +   
Sbjct: 85  GDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY--DGTLVKYYLSPEDFVYKLADH 142

Query: 147 -TFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTV 205
            +F +  VV  +SV                         A + A+   G  V + GAG V
Sbjct: 143 ISFEEGAVVEPLSVAV----------------------HANRLANTAFGQAVLVLGAGPV 180

Query: 206 GLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV--NPSKGLKDGQTIVDKLVEMT 263
           GL     A   GA+ ++ VDI + K + +  FGAT  V   P     D  ++V K +   
Sbjct: 181 GLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVLFKPDSDENDLVSLVTKSL--- 237

Query: 264 DGGL--DFTFDCTGNTDVMRSALEACHKG 290
            GGL  D  F+C+G    +R+A+++  +G
Sbjct: 238 -GGLHPDVVFECSGAEKCIRAAVKSVKRG 265

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 78/158 (49%), Gaps = 13/158 (8%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPKAPLD-KTCLLGCGVTTGYGAAVKTAD---VQK 193
           D + ++  STF+QYT  +    V   PK   D K  L   G+     A   T +   V+K
Sbjct: 89  DQVAYISHSTFAQYTKFSSKGNVMRLPKCTSDEKMKLYAAGLLQALTALSFTNEAYHVKK 148

Query: 194 GDTVAIF-GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD + ++  AG VGL + Q   ++GA  I V    D+K   +   GA   +N SK     
Sbjct: 149 GDYILVYAAAGGVGLILNQLLKMKGAHAIAVAS-TDEKLDIAKKNGAEYLINSSK----- 202

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHK 289
           + ++++++E+T+G G+D +FD  G  D   + L A  +
Sbjct: 203 EDVLERVLEITNGEGVDSSFDSIGK-DTFETTLAALKR 239

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/156 (29%), Positives = 78/156 (50%), Gaps = 14/156 (8%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPKAPL-DKTCLLGCGVTTGYGAAV---KTADVQK 193
           D + +M  STF+QYT  +   +++  P     D+  +    +  G  A     +   V++
Sbjct: 90  DKVAYMSSSTFAQYTKYSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYKVKE 149

Query: 194 GDTVAIF-GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD + ++  AG VGL + Q    RGA  I VV   ++K++ +  FGA   +N SK     
Sbjct: 150 GDYILLYAAAGGVGLLMDQLLKERGAHAIAVVS-TEEKEELAKKFGAEYVINSSK----- 203

Query: 253 QTIVDKLVEMT-DGGLDFTFDCTGNT--DVMRSALE 285
           + I+ + +E+T D G+D  FD  G    D+  +AL+
Sbjct: 204 EDILKRALEITNDKGVDAVFDSVGKDTFDISLNALK 239

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 111/257 (43%), Gaps = 24/257 (9%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCG----VTTGYGAAVKTADVQK 193
           D + ++  +TF+QYT +++   V+  P+   D+   L  G      T      +   V+K
Sbjct: 112 DKVAYLSSNTFAQYTKISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKK 171

Query: 194 GDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQ 253
           GD + ++ A             +  +  I V   D+K Q + ++GA   +N SK      
Sbjct: 172 GDYILLYAAAGGAGLAFNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSK-----D 226

Query: 254 TIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQ 312
            ++ +++E+T+G G++  FD  G  D   ++L+A  +   +  ++    A   +      
Sbjct: 227 DVLARVLEITNGQGVEAAFDSVGK-DTFETSLKALKR---KGTLVSFGNASGPVPPVAIN 282

Query: 313 LVTG---RVWKGSAFGGIKGRSEMGGLVSDYMD----GKLKVDEFITHRRGFTDINSAFE 365
           ++T    ++ + S FG I    E     S+  D    G LK+   I+      + N A E
Sbjct: 283 ILTPKNIKLLRPSLFGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAE 340

Query: 366 DLHHGDCL-RTVLDLSK 381
            L     + + +L++S+
Sbjct: 341 QLESRKTVGKLMLEISQ 357

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 86/217 (39%), Gaps = 42/217 (19%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GD V+   T  C++              C  CK G  N+C S     G GV   G   
Sbjct: 90  KVGDKVVVEPTGTCRDRYRWPESPNVDKEWCAACKKGYYNIC-SYLGLCGAGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +    PLD   L+       +  A+   +
Sbjct: 146 -----------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AISVCE 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            + G T  I GAG +GL  +   +  G   I+V +    +++ +   GA  + +P++   
Sbjct: 187 FKAGSTALIIGAGPIGLGTILALNAAGCRDIVVSEPAKLRRELAEKMGARVY-DPTE--H 243

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALE 285
             +  +D L  + +G  G D+TFDC+G    + +A++
Sbjct: 244 AARESIDYLRSVAEGGDGFDYTFDCSGLEVTLNAAIQ 280

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 82/217 (37%), Gaps = 42/217 (19%)

Query: 85  KAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           K GD V+   T  C++              C  CK G  N+C S     G GV   G   
Sbjct: 90  KVGDKVVVEPTGTCRDRYRWPNSPNVSKEWCAACKKGYYNIC-SYLGLCGAGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     +    PLD   L+       +  A+   +
Sbjct: 146 -----------------FAERVVMNESHCYKVPDFVPLDVAALIQPLAVCWH--AISVCE 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            + G T  I GAG +GL  +      G   I+V +    +++ +   GA  +       K
Sbjct: 187 FKAGSTALIIGAGPIGLGTILALDAAGCKDIVVSEPAKLRRELAEKMGARVYDPTEHAAK 246

Query: 251 DGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALE 285
           +    +D L  + +G  G D+TFDC+G    + +A++
Sbjct: 247 ES---IDYLRSIAEGGDGFDYTFDCSGLEITLNAAIQ 280

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 10/152 (6%)

Query: 142 FMGCST----FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTV 197
           FMG       F++  V  +  VV +    P+D   L+   ++  + AA + +    G + 
Sbjct: 136 FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PLSVAWHAA-RVSKFPPGKSA 193

Query: 198 AIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVD 257
            + GAG +GL+++     +GASKIIV +    +++ +       F   + G K    +  
Sbjct: 194 LVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMHVETFDPSTHGDKSVAMLRS 253

Query: 258 KLVEMTDG-GLDFTFDCTGNTDVMRSALEACH 288
           K     DG G DF FDC+G      + L+A H
Sbjct: 254 KTF---DGKGFDFAFDCSGVPATFNTGLQAAH 282

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 102/232 (43%), Gaps = 27/232 (11%)

Query: 138 DLLHFMGCSTFSQYTVVADVS-VVAIDPKAPLDKTCLLGCGVTTGYGAAV---KTADVQK 193
           D + ++  +TF+Q+T V + + V  +      ++  L   G+  G  A     +  DV+K
Sbjct: 89  DKVSYIAGATFAQFTKVPNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKK 148

Query: 194 GDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD V ++ A G VGL   Q   +RGA  I V   N +K   + + GA   +N  +     
Sbjct: 149 GDYVLLYAAAGGVGLIFNQLLRMRGAHTIAVASTN-EKLSLAKENGAEFLINSKE----- 202

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
             I++K+ ++T G G+D  FD  G  D   + L +C K  G  +  G A+        PF
Sbjct: 203 DNILEKVQQITKGNGVDVAFDSVGK-DTFETTL-SCLKRKGTFVSYGNASG----PVPPF 256

Query: 312 QLV-----TGRVWKGSAFGGI----KGRSEMGGLVSDYMDGKLKVDEFITHR 354
            L        R+ +   FG +    + R     L+S    GKL +  F  ++
Sbjct: 257 PLSRLSPKNIRLLRPQLFGYVAQADEFRHYTEELISLIDSGKLNIKLFKIYQ 308

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 74/158 (46%), Gaps = 13/158 (8%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPK-APLDKTCLLGCGVTTGYGAAV---KTADVQK 193
           D + ++  STF+Q+T       +   PK    +K  ++   +  G        +  +VQK
Sbjct: 108 DKVAYLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFIDEAYNVQK 167

Query: 194 GDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD + ++ A G VGL   Q    RGA + I V   D+K Q + ++GA   +N +K     
Sbjct: 168 GDFILVYAAAGGVGLIFDQLLKARGA-RTIAVASTDEKLQLAKEYGAEFLINSTK----- 221

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHK 289
             IV+K+ E T+G G+   FD  G  D   + L+   +
Sbjct: 222 DDIVEKVKEFTNGEGVAAAFDSIGK-DTFETTLQVVKR 258

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 76/340 (22%), Positives = 130/340 (38%), Gaps = 33/340 (9%)

Query: 35  EVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX-XXXXKAGDHV-IA 92
           ++ +K+E   VC +D +  SG   + A P I+                   K GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 93  LYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYT 152
                C +CK C +G  + C +   T             ++   ED   ++    ++ Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQT-------------YSTPYED--GYVSKGGYADYV 139

Query: 153 VVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQG 212
            V +   V I    P      L CG  T +   ++      G  VAI G G +G   V  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 213 AHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFD 272
           A   GA ++  +     KK+ ++  GA  F+   +     +   D+        LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 273 CTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRS 331
           C G+ TD+  + L       G+ + I +    + +  +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSMEELK 308

Query: 332 EMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           ++  LVS+  D K+ V+      +G   ++  FE +  GD
Sbjct: 309 QLLKLVSE-KDIKIWVETVPISEKG---VHEVFERMDKGD 344

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 130/340 (38%), Gaps = 32/340 (9%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXXXXXXKAGDHV-IA 92
           ++V +K+E   VC +D +T SG   E   P ++                  K GD V I 
Sbjct: 38  YDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVTQIGSQCNELKVGDRVGIG 97

Query: 93  LYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYT 152
                C EC  CKS     C     T  K    D T  +++K G           ++ Y 
Sbjct: 98  AQVFSCLECDRCKSDNEPYCPKTVNTYRK----DYTDGYNSKGG-----------YADYI 142

Query: 153 VVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQG 212
            + +   V I    P      L CG  T +   ++      G  V I G G +G   +  
Sbjct: 143 RLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPGKKVGIMGIGGIGHMGLIF 201

Query: 213 AHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFD 272
           A   GA +   +  +  KK+ ++  GA  F+      K+      K  +      D    
Sbjct: 202 AKAMGA-ETFAISRSSAKKEDAIKMGADHFI----ATKEEPDWATKYFDT----FDLIVV 252

Query: 273 CTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRS 331
           C+ + TD+  + +    K  G+ + I V    + ++ +PF L+ G     SA GGI    
Sbjct: 253 CSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGLI-GVSISNSALGGINEIK 311

Query: 332 EMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           +M  LVS   + K+ V+      +G  ++   FE +  GD
Sbjct: 312 QMLDLVSK-KNLKIWVETIPISEKGVKEV---FERMEKGD 347

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 98/223 (43%), Gaps = 22/223 (9%)

Query: 138 DLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTC-LLGCGVTTGYGAAV---KTADVQK 193
           D + ++  S F+QYT V     V   PK   D+T  L   G+     A     +  +V+K
Sbjct: 105 DKVAYLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKK 164

Query: 194 GDTVAIF-GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD +  +  AG VGL + Q    RGA  I VV   ++K + +   GA   +  SK     
Sbjct: 165 GDFILNYAAAGGVGLILDQLLKERGAHTIAVVS-TEEKLELAKKHGAEYGIISSK----- 218

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
           + IV ++ E+T+  G+D  FD  G  D   + + A  +   +   +    A   +S  P 
Sbjct: 219 EDIVTRVKEITNNQGVDAAFDSIGK-DTFETTISALKR---KGTFVSYGNASGPVSPFPL 274

Query: 312 QLVTG--RVWKGSAFGGIKGRSEMGGLVSDYM----DGKLKVD 348
             +TG  ++ + S F  I    E      +++     GKLK++
Sbjct: 275 TKLTGNIKILRPSLFSYIATSEEWKHYSREFVSLVSSGKLKIN 317

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 94/361 (26%), Positives = 135/361 (37%), Gaps = 49/361 (13%)

Query: 24  EEIVVDPPKA--HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX- 80
           +++  DP K   H++ IKVE   VC +D +  SG   +   P ++               
Sbjct: 24  KKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKPLVVGHEIIGTVVRLGENC 83

Query: 81  XXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDL 139
               K GD V +      C +C+ CK+     C     T G+   PDG S   +K G   
Sbjct: 84  NSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQD-YPDGYS---SKGG--- 136

Query: 140 LHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ADVQKGDTV 197
                   ++ Y  V +   V I    P      L CG  T Y   V+      +K   V
Sbjct: 137 --------YADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTVYSPLVRNGCGPNKKVGIV 188

Query: 198 AIFGAGTVGLSVVQ--GAHVRGASKIIVVDINDQKKQWSLDFGATDFV----NPSKGLKD 251
            I G G  GL   +  GA V   S+         KK+ ++  GA  F+     P  G K 
Sbjct: 189 GIGGIGHQGLLFAKAMGAEVYAISR------TSAKKEDAMKLGADHFIATKEEPDWGTKY 242

Query: 252 GQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
             T  D +V       D  F+   NT           K  G  + I V    + +S +PF
Sbjct: 243 FDTF-DLIVVCASSLTDVDFNTVPNT----------MKIGGSIVSISVPEQNETLSLKPF 291

Query: 312 QLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            L  G     SA G I    ++  LVS+  + KL V+      +G   +  AFE +  GD
Sbjct: 292 GL-KGVSISNSALGSISEMRDLLKLVSE-NNIKLWVETIPIGEKG---VKEAFERMDKGD 346

Query: 372 C 372
           C
Sbjct: 347 C 347

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 70/153 (45%), Gaps = 13/153 (8%)

Query: 143 MGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD----VQKGDTVA 198
           +   TF+QYT V++ S V   P    D       G       A+   D     Q G+ V 
Sbjct: 94  LSSGTFAQYTAVSEKSNVLKLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKPQVGEIVL 153

Query: 199 IF-GAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVD 257
           ++  AG VG  ++Q  H R   ++I V   D+K Q +   GA   +N S+     + IV 
Sbjct: 154 VYAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSR-----EDIVA 207

Query: 258 KLVEMTDG-GLDFTFDCTGNTDVMRSALEACHK 289
           K++E TDG G+  ++D  G  D   + L++  +
Sbjct: 208 KVLEFTDGEGVGASYDSVGK-DTFETTLQSVKR 239

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 82/179 (45%), Gaps = 12/179 (6%)

Query: 114 SVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCL 173
           ++   +  GV+ D  +   N +  D + ++G  + +Q+T + +  ++ +   +  +   L
Sbjct: 81  AILGREASGVVVDKGTNIKNFEIGDKVAYIGNCSMAQFTKIDNSMIMKLSSDSTNEDLKL 140

Query: 174 LGCGVTTGYGA---AVKTADVQKGDTVAIF-GAGTVGLSVVQGAHVRGASKIIVVDINDQ 229
              G+  G  A     +  +V+KGD + ++  AG  GL   Q    RGA  +I V  +D+
Sbjct: 141 YAAGILQGLTALSFVTEAYEVKKGDYILVYAAAGGAGLIFDQLIKARGAH-VIAVCSSDE 199

Query: 230 KKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEAC 287
           K Q + + GA   +N          I+ K++E+TD  G+   FD  G  D   + L A 
Sbjct: 200 KLQLAKENGAEYLINSKT-----DDILTKVMEITDNKGVQAAFDSVGK-DTFHTTLAAL 252

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 109/302 (36%), Gaps = 48/302 (15%)

Query: 31  PKA---HEVRIKVEYTAVCHTDAYTLS---GVDPEGAFPS-------ILXXXXXXXXXXX 77
           PKA   H+V I+VE   +C ++ + L    G  P     S       ++           
Sbjct: 28  PKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYGPKTQVVGHEVVGKVVAV 87

Query: 78  XXXXXXXKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKG 136
                    GD V +    + C +C  C SG    C +  +T  K   PDG         
Sbjct: 88  GPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTYCK-PYPDG--------- 137

Query: 137 EDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDT 196
                ++    ++ +    +     I P+ P +    L CG  T +    +    +    
Sbjct: 138 -----YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNLQGKHDPK 192

Query: 197 VAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIV 256
           VA+ G G +G   +  A   GA ++        K+  +L  GA  FV  + G  D     
Sbjct: 193 VAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGAHHFV--ATGDAD----- 244

Query: 257 DKLVEMTDGGLDFTFD----CTGNTDVM-RSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
                  + GLD TFD    C  +T  +  +A+  C K     + +G+    +E+S +PF
Sbjct: 245 ------WNAGLDDTFDLILNCASSTSSLDLNAMLPCLKVNCNFVSVGLPHIDEELSVKPF 298

Query: 312 QL 313
             
Sbjct: 299 SF 300

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 71/154 (46%), Gaps = 11/154 (7%)

Query: 143 MGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADV----QKGDTVA 198
           +  STF +YTV     V  +  +  LD    +G  + T   A     +V    ++  ++ 
Sbjct: 142 LRTSTFQEYTVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIV 201

Query: 199 IFGAGT-VGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVD 257
           I+G  T VG+ VVQ A   G +KII +  + + +Q+ L  GAT  ++  +  +D   IV+
Sbjct: 202 IWGGSTGVGIFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREEKTED---IVN 257

Query: 258 KLVEMTDGGLDFTFDCTGN--TDVMRSALEACHK 289
           ++ ++   G+    D       + + S L A  K
Sbjct: 258 EIKKICPNGVSHGVDLISKKTAETLSSILSAESK 291

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 85/235 (36%), Gaps = 35/235 (14%)

Query: 85  KAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFM 143
           K GD V +    + C +C  C+S     C     T      PDG              ++
Sbjct: 95  KVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP-YPDG--------------YV 139

Query: 144 GCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAG 203
               ++ +    +     I P+ P +    L CG  T +    +    +K   VAI G G
Sbjct: 140 SQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGIG 199

Query: 204 TVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMT 263
            +G   +  +   GA ++  V     K+  +L  GA  F+  S+                
Sbjct: 200 GLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFIATSE-------------PNW 245

Query: 264 DGGLDFTFD----CTGNTDVM-RSALEACHKGWGQSIIIGVAAAGKEISTRPFQL 313
           + GLD TFD    C  +T  +  +AL  C K     + +G+    ++   +PF  
Sbjct: 246 NAGLDDTFDLILNCASSTSSLDLNALLPCLKVNCNFVSVGLPHIDEDFKVKPFSF 300

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 108/281 (38%), Gaps = 54/281 (19%)

Query: 35  EVRIKVEYTAVCHTD--AYTLSGV--DPEG--------AFPSILXXXXXXXXXXXXXXXX 82
           E+ I V Y  +C TD   YT   +   P+G          P  +                
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 83  XXKAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             K GDHV+   T  CK+              C  C  G TN+C  + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 129 SRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
                              F++  V+ +  V  I    PLD   L+       +  AVK 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALIQPISVCWH--AVKV 184

Query: 189 ADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKG 248
           A  +KG +  I G G +GL  +      G   I++ +    +++++   GA  + +P+ G
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAKVY-DPT-G 242

Query: 249 LKDGQTIVDKLVEM--TDGGLDFTFDCTGNTDVMRSALEAC 287
           +   ++ V  L EM     G D+TFDC+G    + +A+E C
Sbjct: 243 VPFDES-VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 37.7 bits (86), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 219 SKIIVVDINDQKKQWSLDFGATDFVNPSK-GLKDGQTIVDKLVEMTDG-GLDFTFDCTG 275
           S +I VD+ D K Q + DFGAT   N SK  + + Q + D+L ++  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 115/296 (38%), Gaps = 45/296 (15%)

Query: 85  KAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSR-----FHNKKGED 138
           K GD V +   +  C EC+ C +G    C          + PDG+        H +  E 
Sbjct: 86  KVGDRVGVGAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGSKAQGGFGSHVRTHEY 145

Query: 139 LLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVA 198
            +H           +  ++  V   P         L CG  T +   ++   V  G TV 
Sbjct: 146 FVH----------PIPKELDTVNAAP---------LLCGGITAFSPLLR-GQVGPGKTVG 185

Query: 199 IFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDK 258
           I G G +G   +  A   GA K+I +  +  KK+  L  GA +++  ++G        D 
Sbjct: 186 IVGIGGIGHIAILFAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEG--------DD 236

Query: 259 LVEMTDGGLDFTFDCTGNTDVMRSALEACH---KGWGQSIIIGVAAAGKEISTRPFQLVT 315
             +   G +DF   C  N+   +S  ++     K  G+   IG+      +S  P  L+ 
Sbjct: 237 WKQKFAGSIDFMLLC--NSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLL- 293

Query: 316 GRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           G  +  SA G      +M  LV    + KL V+      +G   ++ AFE + +GD
Sbjct: 294 GIKFGFSALGSRNEFQKMFELVKK-NNIKLWVETLPIGEKG---LHEAFERVENGD 345

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 84/344 (24%), Positives = 126/344 (36%), Gaps = 39/344 (11%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSIL-XXXXXXXXXXXXXXXXXXKAGDHV-I 91
           H++ IK+E   VC +D +T SG   +   P ++                   K GD V +
Sbjct: 35  HDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIGTVVRLGDKCTSGLKLGDRVGV 94

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQY 151
                 C EC  CKS     C     T       DG    +N KG           ++ Y
Sbjct: 95  GAQAFSCLECGRCKSDNEPYCTKSVWTYSTN-YEDG----YNSKG----------GYADY 139

Query: 152 TVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQ 211
             + +   + I    P      L CG  T +   ++     +G  V I G G +G   + 
Sbjct: 140 IRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLRNG-CGRGKKVGIMGIGGIGHMALI 198

Query: 212 GAHVRGASKIIVVDINDQKKQWSLDFGATDFV----NPSKGLKDGQTIVDKLVEMTDGGL 267
            A   GA ++  +     KK  S+  GA  F+     P    K   T  D +V  ++   
Sbjct: 199 FAKAMGA-EVYAISRTSAKKDDSIKMGADHFIATKEEPDWATKYFDTF-DLIVVCSNSLT 256

Query: 268 DFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGI 327
           D  FD    T           K  G+ + I      + I+ +PF L+ G     SA GGI
Sbjct: 257 DINFDVVPRT----------MKVGGKIVSICAPEQNEVINLKPFGLL-GVSISNSALGGI 305

Query: 328 KGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
               +M  LVS   D K+ V+      +G  ++   FE +  GD
Sbjct: 306 NEIKQMLDLVSK-KDLKIWVETVPISEKGVKEV---FERMDMGD 345

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 125/350 (35%), Gaps = 51/350 (14%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX---XXXXKAGDHV 90
           H+++IKVE   VC +D +  SG    G  P+ L                     K GD V
Sbjct: 34  HDIQIKVECCGVCGSDIHAASG--HWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRV 91

Query: 91  -IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFS 149
            +      C EC  CK+   + C    AT G G  PDG              ++    ++
Sbjct: 92  GVGAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYA 136

Query: 150 QYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTA----DVQKGDTVAIFGAGTV 205
            +  V +  VV I    P +    L CG  T +   ++             +   G   V
Sbjct: 137 DFVRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRNGCGPGKKVGIVGIGGIGHQGV 196

Query: 206 GLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV----NPSKGLKDGQTIVDKLVE 261
             +   GA V   S+        +KK  +   GA  F+     P  G K   T  D +V 
Sbjct: 197 IFANAMGAEVYAISR------TSKKKDDAFKLGAHHFIATKEEPDWGTKYYDTF-DLIVV 249

Query: 262 MTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
             +   D  FD   +T           K  G+ + I +    + +  +PF L  G     
Sbjct: 250 CANSLTDIDFDVVPHT----------MKIGGRIVSISIPEMSQVLKLKPFGL-KGVSISN 298

Query: 322 SAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           S  G IK    +  LVS+  + ++ ++      +G   ++ AF+ +  GD
Sbjct: 299 SHLGSIKELKTLLKLVSE-KNLRIWIETIPIGEKG---VHEAFDRMDKGD 344

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 84/366 (22%), Positives = 136/366 (37%), Gaps = 43/366 (11%)

Query: 25  EIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX-XXX 83
           E    P   H++ IK++   VC +D +  +G   +   P ++                  
Sbjct: 25  EFPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTG 84

Query: 84  XKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHF 142
            K GD V +      C EC  CK+     C     T             +++  ED   +
Sbjct: 85  LKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTT-------------YSQPYED--GY 129

Query: 143 MGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ADVQKGDTVAIF 200
           +    ++ Y  V +   V I    P      L CG  T Y   ++      +K   V I 
Sbjct: 130 VSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRNGCGPGKKVGIVGIG 189

Query: 201 GAGTVGLSVVQ--GAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDK 258
           G G +GL   +  GA V   S+      ++ KK+ SL  GA  ++   +    G+   D 
Sbjct: 190 GIGHMGLLFAKAMGAEVYAISR------SNAKKEDSLKLGADHYIATKEEPNWGEKYFDT 243

Query: 259 LVEMTDGGLDFTFDCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGR 317
                    D    C  + TDV    +    K  G+ + I +    + ++ +PF L+ G 
Sbjct: 244 --------FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPDEDQTLTMKPFGLL-GV 294

Query: 318 VWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLR--T 375
               SA G IK   ++  LVS+  D K+ V+       G   +  AFE +  GD     T
Sbjct: 295 SIANSALGSIKEIEQLLKLVSE-KDIKIWVETLPVGEAG---VKEAFERMDKGDVKYRFT 350

Query: 376 VLDLSK 381
           ++D  K
Sbjct: 351 LVDFDK 356

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 86/365 (23%), Positives = 138/365 (37%), Gaps = 41/365 (11%)

Query: 25  EIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX-XXX 83
           E    P   ++V IK+E   VC +D +  +G   +   P ++                  
Sbjct: 24  EFPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLVVGHEIIGKVVKVGPKCKTG 83

Query: 84  XKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHF 142
            K GD V +      C EC+ CK+     C     T             +++  ED   +
Sbjct: 84  LKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTT-------------YSQPYED--GY 128

Query: 143 MGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGA 202
           +    ++ Y  V +   V I    P +    L CG  T Y   ++      G  V I G 
Sbjct: 129 VSQGGYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYSPLLRNG-CGPGKKVGILGI 187

Query: 203 GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV----NPSKGLKDGQTIVDK 258
           G +G   +  A   GA ++  +  ++ KK+ SL  GA  ++     P  G K   T  D 
Sbjct: 188 GGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYIATKEEPDWGTKYFDTF-DL 245

Query: 259 LVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRV 318
           +V       D  F      DVM  A+    K  G+ + I V    + ++ +PF L+ G  
Sbjct: 246 IVVCASSLTDVDF------DVMPKAM----KVGGRIVSISVPEQDEVLTMKPFGLI-GVS 294

Query: 319 WKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLR--TV 376
              S  G I    ++  LVS+  + K+ V+       G   +  AFE +  GD     T+
Sbjct: 295 IANSILGSIAEMKQLLKLVSE-NNIKIWVETLPVGEAG---VKEAFERMDKGDVRYRFTL 350

Query: 377 LDLSK 381
           +D  K
Sbjct: 351 VDYEK 355

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 26/152 (17%)

Query: 143 MGCSTFSQYTVVADVSVVAIDPKAPLDKTCL-----------LGCGVTTGYGAAVKT--- 188
           +  STF +YTV  D  +V   P+  L    L           +G G+ T  G+A+ +   
Sbjct: 141 LETSTFQEYTVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVD 198

Query: 189 ------ADVQKGDTVAIFG-AGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATD 241
                 AD QK   + I+G + +VGL V+Q A      + IVV    + K++ L+ GA+ 
Sbjct: 199 LSLRDQADHQKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASC 258

Query: 242 FVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDC 273
            ++  +     + I+D ++     G+DF  D 
Sbjct: 259 IIDRHQS---EEEILDDILSHCPEGIDFGIDV 287

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 78/350 (22%), Positives = 127/350 (36%), Gaps = 33/350 (9%)

Query: 25  EIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX-XXX 83
           E    P   +++ IK+E   VC +D +  +G   +   P ++                  
Sbjct: 28  EFEPKPFYPNDIDIKIECCGVCGSDIHAAAGHWGDLEKPLVVGHEVIGTVVRLGENCNSG 87

Query: 84  XKAGDHV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHF 142
            K GD V +      C +C+ CKS     C S   T G+    DG S   +K G      
Sbjct: 88  LKLGDRVGVGAQVFSCLDCERCKSNNEPYCPSFVTTYGQSYK-DGYS---SKGG------ 137

Query: 143 MGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGA 202
                ++ Y  V +   V I    P      L CG  T +   ++           +   
Sbjct: 138 -----YADYIRVHEHFAVPIPENIPSHLAAPLMCGGITVFSPLLRNGCGPGKKVGIVGIG 192

Query: 203 GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEM 262
           G   + ++  A   GA ++  +     KK+ ++  GA  F+   +    G    D     
Sbjct: 193 GIGHMGLIF-AKAMGA-EVYAISRTSAKKEDAMKLGADHFIATKEEPDWGTKYFDT---- 246

Query: 263 TDGGLDFTFDCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKG 321
                D    C  + TDV  + +    K  G  + I V    + ++ +PF L+ G     
Sbjct: 247 ----FDLIVVCANSLTDVDFNVVPKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISN 301

Query: 322 SAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           SA GG+K   E+  LVS   + K+ V+       G   +  AFE +  GD
Sbjct: 302 SALGGVKEIKELLDLVSK-NNLKIWVETLPIGEEG---VKQAFERMDKGD 347

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 98/246 (39%), Gaps = 46/246 (18%)

Query: 85  KAGDHVIALYTAECK--------------ECKFCKSGKTNLCGSVRATQGKGVMPDGTSR 130
           + GD V+   T  CK              EC  CK G  N+C ++    G GV   G   
Sbjct: 90  QVGDRVVVEPTGTCKDRYRWPDAPNANQEECAACKKGLYNICSNL-GLVGCGVQSGG--- 145

Query: 131 FHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD 190
                            F++  V+ +     I     +D   L+     + +  AV+ + 
Sbjct: 146 -----------------FAERMVMNEAKCYKIPEHLTMDVAALIQPIAVSWH--AVRVSK 186

Query: 191 VQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLK 250
            + G +V I G G +GL  +   +  G ++++V +    ++  +   GA  +       +
Sbjct: 187 FKPGSSVLIIGGGPIGLGTILALNGHGVTEVVVSEPAKIRRDLAEKMGAVVY---DPMTR 243

Query: 251 DGQTIVDKLVEMTDGG--LDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKE-IS 307
           D    +  L  +  GG   D+TFDC+GN   +++A+E C    G +  + VA  GK  +S
Sbjct: 244 DHDESIKYLRSIAPGGDGFDYTFDCSGNPATLKAAIE-CLTFRGTA--VNVAIWGKNPVS 300

Query: 308 TRPFQL 313
             P  L
Sbjct: 301 FLPMDL 306

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 91/227 (40%), Gaps = 38/227 (16%)

Query: 85  KAGDHVIALYTAECKE----------CKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNK 134
           + GDHV+   T  C++          CK CK G  N+C  +    G GV   G       
Sbjct: 90  QPGDHVVVEPTGTCQDRERYNTKGETCKACKRGMHNVCVHL-GLCGCGVQSGG------- 141

Query: 135 KGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKG 194
                        F++  V+ +     +    PLD   L+       +  AVK   V++G
Sbjct: 142 -------------FAEKVVIGEKHCFKVPSWIPLDVAALIQPLAVCWH--AVKLGAVKEG 186

Query: 195 DTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQT 254
            +  I G G +GL ++      G + I+V +    ++  +   GA   V+     K  + 
Sbjct: 187 QSALILGGGPIGLGIIMALQHFGCTDIVVSEPAKIRRDLAEKMGA--IVSNPMDFKTNEE 244

Query: 255 IVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGV 299
            +  L  ++    G DFTFDC+G +    S+++ C    G +I + V
Sbjct: 245 NIKNLCSLSPNGEGYDFTFDCSGISVTFESSIK-CLTFRGTAINVAV 290

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 63/312 (20%), Positives = 106/312 (33%), Gaps = 53/312 (16%)

Query: 32  KAHEVRIKVEYTAVCHTDAYTLSGV---DPEGAFPS-------ILXXXXXXXXXXXXXXX 81
           +AH+V I+VE   +C ++ ++L      +P     S       ++               
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 82  XXXKAGDHV-IALYTAECKECKFCKSGKTNLC----GSVRATQGKGVMPDGTSRFHNKKG 136
                GD V +      C +C  C SG    C    G+  +    G +  G    H +  
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTYCSRYADGYISQGGYASHVRAH 153

Query: 137 EDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDT 196
           E             + +  D+    + P         L CG  T Y    +  +  K   
Sbjct: 154 EQFC----------FPIPDDIPSELVAP---------LQCGGLTVYSPIKRNIEGVKDPK 194

Query: 197 VAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIV 256
           VAI G G +G   +  +   GA ++        KK+ +L  GA  F+   +         
Sbjct: 195 VAIIGIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIATGE--------- 244

Query: 257 DKLVEMTDGGLDFTFDCTGN-----TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPF 311
               E  + GL+ TFD   N     T +  + L  C K     I +G+    ++   +PF
Sbjct: 245 ----EGWESGLNDTFDLILNCASSTTSLDLNKLLPCLKINRNFISVGLPHVDEDFKVKPF 300

Query: 312 QLVTGRVWKGSA 323
              +     GS+
Sbjct: 301 SFFSNGCCIGSS 312

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 72/347 (20%), Positives = 131/347 (37%), Gaps = 37/347 (10%)

Query: 30  PPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSIL-XXXXXXXXXXXXXXXXXXKAGD 88
           P   H++ IK+E   VC +D +  +G       P ++                   K G 
Sbjct: 30  PFYDHDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQ 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCST 147
            V +      C EC  CK+     C     T             +++  ED   ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKNDNEPYCTKFVTT-------------YSQPYED--GYVSQGG 134

Query: 148 FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ADVQKGDTVAIFGAGTV 205
           ++ Y  V +  VV I    P      L CG  T Y   V+      +K   V + G G++
Sbjct: 135 YANYVRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 206 GLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDG 265
           G  + +       ++  V+  + +K++ ++  GA  ++   +    G+   D        
Sbjct: 195 GTLISKAM----GAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKYFDT------- 243

Query: 266 GLDFTFDCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
             D    C  + TD+  + +    K  G+ + I +    + +S +P+ L    +   SA 
Sbjct: 244 -FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLSLKPYGLKAVSI-SYSAL 301

Query: 325 GGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           G IK  +++  LVS+  D K+ V+       G   ++ AFE +  GD
Sbjct: 302 GSIKELNQLLKLVSE-KDIKIWVETLPVGEAG---VHEAFERMEKGD 344

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 119/317 (37%), Gaps = 56/317 (17%)

Query: 35  EVRIKVEYTAVCHTDAYTLSG------VDPE------GAFPSILXXXXXXXXXXXXXXXX 82
           E+ + + Y  +C TD + L+       +D E         P  +                
Sbjct: 28  ELLVDIVYCGICGTDLHELTDGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSGVK 87

Query: 83  XXKAGDHVIALYTAECKE--------------CKFCKSGKTNLCGSVRATQGKGVMPDGT 128
             + GDHV    T  C++              C  C+ G  N C  +    G GV   G 
Sbjct: 88  KFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSGG- 145

Query: 129 SRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT 188
             F  +   +  H   C     + V A +  +A+         C            A+  
Sbjct: 146 --FAERIVVNESHCYKCPDNLPWEVAALIQPIAV---------CW----------HAINI 184

Query: 189 ADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKG 248
           A  + G +V I G G +GL  +   +  G ++IIV +    ++ ++   GA  + +P + 
Sbjct: 185 AQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPLQC 243

Query: 249 LKDGQTIVDKLVEMTDG--GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEI 306
             +    +  L +M  G  G D+ FDC+G    +++++E C    G ++ + + A  K +
Sbjct: 244 SHEQS--IPNLRKMAPGADGFDYCFDCSGTPATLKASIE-CLTFRGTAVNVAMWATNKAV 300

Query: 307 STRPFQLVTG-RVWKGS 322
           +  P  +    +++ GS
Sbjct: 301 NFYPMDITKQEKIYTGS 317

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 73/347 (21%), Positives = 129/347 (37%), Gaps = 45/347 (12%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSIL-XXXXXXXXXXXXXXXXXXKAGDHV-I 91
           H+V IK+E   VC +D +  +G   +   P ++                   + G  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQY 151
                 C EC  CKS     C     T G+    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYGQP-YEDG--------------YVSQGGYADY 138

Query: 152 TVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ADVQKGDTVAIFGAGTVGLSV 209
             V +  VV I    P      L CG  T Y   V+      +K   V   G G++G  +
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRNGCGPGKKVGIVGFGGIGSMGTLI 198

Query: 210 VQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKL-----VEMTD 264
            +       ++  V+  + +K++ ++  GA  ++   +    G+   D          + 
Sbjct: 199 AKAM----GAETYVISRSSKKREDAMKMGADHYIATLEEENWGEKYFDTFDLIVVCASSL 254

Query: 265 GGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
            G+DF        DVM  A+    K  G+ + I +    + ++ +P+ L    +   SA 
Sbjct: 255 TGIDF--------DVMPKAM----KVGGRIVSISIPEQHEVLTLKPYGLKAVSI-SYSAL 301

Query: 325 GGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
           G IK   ++  LVS+  + K+ V+       G   ++ A E +  GD
Sbjct: 302 GSIKELKQLLKLVSE-KNVKIWVETLPVGEAG---VHEALERMEKGD 344

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 74/359 (20%), Positives = 134/359 (37%), Gaps = 39/359 (10%)

Query: 30  PPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSIL-XXXXXXXXXXXXXXXXXXKAGD 88
           P   H+V IK+E   VC +D +  +G       P ++                   K G 
Sbjct: 30  PFYDHDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQ 89

Query: 89  HV-IALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCST 147
            V +      C EC  CKS     C     T             +++  ED   ++    
Sbjct: 90  RVGVGAQVFSCLECDRCKSDNEPYCTKFVTT-------------YSQPYED--GYISQGG 134

Query: 148 FSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ADVQKGDTVAIFGAGTV 205
           ++ Y  V +  +V I    P      L CG  T Y   V+      +K   V + G G++
Sbjct: 135 YANYVRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRNGCGPGKKVGIVGLGGIGSM 194

Query: 206 GLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDG 265
           G  + +       ++  V+  + +KK+ ++  GA  ++   +    G+   D        
Sbjct: 195 GTLISKAM----GAETYVISRSSKKKEDAIKMGADHYIATLEEGDWGEKYFDT------- 243

Query: 266 GLDFTFDCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAF 324
             D    C  + TD+  + +    K  G+ + I +    + ++ +P+ L    +   SA 
Sbjct: 244 -FDLIVVCASSLTDIDFNIMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSAL 301

Query: 325 GGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLR--TVLDLSK 381
           G IK   ++  LVS+  + K+ V+       G   ++ A E +  GD     T++D  K
Sbjct: 302 GSIKELKQLLALVSE-KNIKVWVETLPVGEAG---VHEALERMERGDVRYRFTLIDYDK 356

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 31.2 bits (69), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 185 AVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243
           AV+   V+ GD V +     +GL V       G  K++++   D KKQ S  FG T F+
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 84/367 (22%), Positives = 134/367 (36%), Gaps = 55/367 (14%)

Query: 16  EAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXX 75
           E  K   +E   V   K H+  +K++   +CH+D   L     +G FP+           
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTIL-----KGGFPASQRYAMGHEIC 147

Query: 76  XXXXXXXXXKAGDHVIALYT----AECKECKFCKSGKTNLCGSVRAT-----QGKGVMPD 126
                    +    V  LYT    A C  C  CK G  + C +         Q  G+  D
Sbjct: 148 GELVQTYADEPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTANGEKACGLGQCYGIGRD 207

Query: 127 GTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAV 186
           G   +      DL H +      +     ++  VA D              V T Y A  
Sbjct: 208 GG--YAEYIAIDLRHLVKVP--KELVNKPEICAVATD-------------AVLTPYHAIK 250

Query: 187 KTADVQKGD--TVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVN 244
                 K       + G G +GL+ +Q A+  G S++I VD  D + Q + + GA     
Sbjct: 251 NIPGFAKTPDYCTLVIGLGGLGLNGMQVANALG-SRVICVDFKDSQLQKATEMGA----- 304

Query: 245 PSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAGK 304
                   + +  +L      G+D   D  G+T  + SA+    K  G   ++G++AAG 
Sbjct: 305 --------EQVFKQLPTDASLGVDAVVDFVGHTSTIASAMFHL-KPHGFLALVGISAAGY 355

Query: 305 EISTRPFQLVTGRVWKG--SAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINS 362
           EI       + G+      S +G    + E+  L++       KV   +T    FTD+ S
Sbjct: 356 EIRFPALSYMLGKEISMIYSFWGTTSDQKEVLDLIA-----AGKVMPQVTSYSLFTDLPS 410

Query: 363 AFEDLHH 369
             E++  
Sbjct: 411 KIEEMRE 417

>Smik_2.3 Chr2
           complement(6099..6290,6294..6323,6327..6398,6402..6608,
           6612..6758) [648 bp, 216 aa] {OFF} YJR159W (PSEUDO)
          Length = 216

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%)

Query: 187 KTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKII 222
           K ADV+ G TV + G G V L  V  AH  GA  I+
Sbjct: 64  KLADVRLGTTVVVLGTGPVSLLTVAVAHTFGAKDIV 99

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 78/341 (22%), Positives = 123/341 (36%), Gaps = 33/341 (9%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSILXXXXXXXXXXXXXX-XXXXKAGDHV-I 91
           +++ IK+E   VC +D +  SG   +   P ++                   K GD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQY 151
                 C  C  C +     C +V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 152 TVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQ 211
             V +   V I    P      L CG  T Y   ++      G  V I G G +G   + 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG-CGPGKKVGILGIGGIGHMGII 197

Query: 212 GAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTF 271
            A   GA ++  +  +D KK+ +   GA  F+        G+   D         LD   
Sbjct: 198 FAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPDWGKKYFDT--------LDLIV 248

Query: 272 DCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGR 330
            C G+  DV    L       G+ + I +  A +++    F L  G     S+ G +   
Sbjct: 249 ICAGSLKDVDFDNLPKAMTVGGKVVSISIPEASEKLEFSAFGL-AGISIGNSSLGSMVEL 307

Query: 331 SEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGD 371
            ++  LVS+  D ++ V+       G   +   FE +  GD
Sbjct: 308 KQLLKLVSE-QDLRVWVETVPISEDG---VRQVFERMEKGD 344

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 73/355 (20%), Positives = 132/355 (37%), Gaps = 39/355 (10%)

Query: 34  HEVRIKVEYTAVCHTDAYTLSGVDPEGAFPSIL-XXXXXXXXXXXXXXXXXXKAGDHV-I 91
           H+V IK+E   VC +D +  +G       P ++                   K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 92  ALYTAECKECKFCKSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQY 151
                 C EC  CKS     C     T             +++  ED   ++    ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTT-------------YSQPYED--GYVSQGGYANY 138

Query: 152 TVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT--ADVQKGDTVAIFGAGTVGLSV 209
             V +  VV +    P      L CG  T Y   ++      +K   V   G G++G  +
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRNGCGPGKKVGIVGFGGIGSMGSLI 198

Query: 210 VQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDF 269
            +       ++  V+  + +KK+ ++  GA  ++   +    G+   D          D 
Sbjct: 199 AKAM----GAETYVISRSSKKKEDAMKMGADHYIATLEEEDWGEKYFDT--------FDL 246

Query: 270 TFDCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIK 328
              C  + T +  + +    K  G+ + I +    + ++ +P+ L    +   SA G IK
Sbjct: 247 IVVCASSLTGIDFNVMPKAMKVGGRIVSISIPEQHEMLTLKPYGLKAVSI-SYSALGSIK 305

Query: 329 GRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLR--TVLDLSK 381
              ++  LVS+  D K+ V+   T   G   ++ A E +  GD     T++D  K
Sbjct: 306 ELKQLLKLVSE-NDIKIWVE---TLPIGEAGVHEALERMEKGDVRYRFTLIDYDK 356

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 94/207 (45%), Gaps = 25/207 (12%)

Query: 138 DLLHFMGCSTFSQYTVVA-DVSVVAIDPKAPLDKTCLLGCGVT---TGYGAAVKTADVQK 193
           D + ++G STF+QYT  + +  ++ +    P +   L G  +    T      +   V +
Sbjct: 88  DKVAYLGGSTFAQYTKKSTENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVME 147

Query: 194 GDTVAIFGA-GTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDG 252
           GD + ++ A G VG  + Q    R A  +I V  + +K   + + GA   +N ++     
Sbjct: 148 GDYILVYAASGGVGSILCQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAE----- 201

Query: 253 QTIVDKLVEMTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAA------AGKE 305
             I++K+++ T+G G+   FD  G  D   + L A  +  G  +  G A+      A  +
Sbjct: 202 DDILEKVMQYTNGKGVHAAFDSIGK-DTFETDLAALRRK-GTLVSFGNASGMVPPFAINK 259

Query: 306 ISTRPFQLVTGRVWKGSAFGGIKGRSE 332
           +S +  +L+  +V+     G +  RSE
Sbjct: 260 LSPKNLKLLRPQVY-----GYLGTRSE 281

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 68/156 (43%), Gaps = 32/156 (20%)

Query: 149 SQYTVVADVSVVAIDPK-APLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGA-GTVG 206
           ++Y VV++   VA+ PK     +   LG  +TT    A++ A V+  D V++ GA G+VG
Sbjct: 51  AEYCVVSE-DAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVG 108

Query: 207 LSVVQ-----GAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVE 261
             VVQ     G  V  A++    D+   + +   +F A                   L  
Sbjct: 109 SYVVQLAQSMGCRVLRAARQSPTDVCIAEDE---EFSA-------------------LTS 146

Query: 262 MTDG-GLDFTFDCTGNTDVMRSALEACHKGWGQSII 296
           +T G G+D   D  G   +M++A E    G   ++I
Sbjct: 147 LTQGRGVDVVIDTVGMPALMKAAAEKLAHGGRMAVI 182

>NDAI0K00920 Chr11 (205240..210396) [5157 bp, 1718 aa] {ON} Anc_8.757
            YMR229C
          Length = 1718

 Score = 31.6 bits (70), Expect = 4.7,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 14/86 (16%)

Query: 180  TGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGA 239
            TG     + AD Q  D  ++FG G                K  V+ +N  KKQ SL   A
Sbjct: 1292 TGLAHITEIADTQPKDLSSLFGTGD-------------RVKAFVLKVNPTKKQLSLSLKA 1338

Query: 240  TDFVNPSKGLKD-GQTIVDKLVEMTD 264
            + F   S   KD  +  +D+ V++ D
Sbjct: 1339 SRFSKDSATKKDTAKEDMDEPVDVID 1364

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 80/364 (21%), Positives = 125/364 (34%), Gaps = 55/364 (15%)

Query: 24  EEIVVDPPKA--HEVRIKVEYTAVCHTDAYTL-SGVDPEGAFPSILXXXXXXXXXXXXXX 80
           ++I  DP K   ++V IK+E   VC +D +   S   P  A   +               
Sbjct: 22  KKISYDPKKFDDYDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKC 81

Query: 81  XXXXKAGDHV-IALYTAECKECKFCKSGKTNLC------GSVRATQGKGVMPDGTSRFHN 133
               K GD V +      C  CK CKS     C      G+   T   G +  G    H 
Sbjct: 82  KLGLKVGDRVGVGAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDGYVSQGGYASHV 141

Query: 134 KKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKT----A 189
           +  E   HF                V  I    P +    L CG  T +   ++      
Sbjct: 142 RTHE---HF----------------VFKIPDNIPTELAAPLLCGGVTVFSPLLRNGCGPG 182

Query: 190 DVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFVNPSKGL 249
                  +   G   +  +   GA V   S+      +  KK+ SL  GA  ++   +  
Sbjct: 183 KKVGVVGIGGIGHMGILFAKAMGAEVYAISR------SSSKKEDSLKLGADYYIATQEEK 236

Query: 250 KDGQTIVDKLVEMTDGGLDFTFDCTGN-TDVMRSALEACHKGWGQSIIIGVAAAGKEIST 308
               T  D         LD    C  + +D+    L A     G+ + I +  A ++++ 
Sbjct: 237 DWATTYADT--------LDLIVLCASSLSDINIDDLVATMTIGGKIVSIAIPDASQQLTL 288

Query: 309 RPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFI-THRRGFTDINSAFEDL 367
           +PF L+ G     SA G  K   ++  LVS+      K+  ++ T       +N  FE +
Sbjct: 289 KPFGLL-GVYISNSALGSRKEIIQLLDLVSEK-----KIKPWVQTVPISEAGVNEVFERM 342

Query: 368 HHGD 371
             GD
Sbjct: 343 EKGD 346

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 154 VADVSVVAIDPKAPLDKTCLLGCGVTTGYGAAVKTAD---VQKGDTVAIFGAGTVGLSVV 210
           +A +S  ++ PK  LD       GV  GYG A + +      K D + I G    G S +
Sbjct: 406 IARISFPSLKPKQRLDAGTNATMGVGLGYGIAARLSQDYMKSKPDILVIQGDSAFGFSAI 465

Query: 211 Q-GAHVRGASKIIVVDIND 228
           +    VR    +I++ IN+
Sbjct: 466 EIETAVRFKLGLIIIVINN 484

>KLTH0F01056g Chr6 complement(80904..83219) [2316 bp, 771 aa] {ON}
           similar to uniprot|P25574 Saccharomyces cerevisiae
           YCL045C
          Length = 771

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 5/55 (9%)

Query: 220 KIIVVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCT 274
           KI V+D+ D ++ W+ + G  D +N      D + ++      T  G   TFD T
Sbjct: 339 KIAVLDVRDGRQLWNYESGLKDILNIEALRSDTEVVI-----FTKSGPSLTFDIT 388

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,661,888
Number of extensions: 1498918
Number of successful extensions: 3442
Number of sequences better than 10.0: 180
Number of HSP's gapped: 3349
Number of HSP's successfully gapped: 182
Length of query: 381
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 270
Effective length of database: 40,753,473
Effective search space: 11003437710
Effective search space used: 11003437710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)