Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01232g7.351ON25725713450.0
Kwal_56.246447.351ON25825810831e-150
KLLA0D12320g7.351ON2502538501e-115
TDEL0C019707.351ON2602597971e-107
ZYRO0F11726g7.351ON2512477911e-106
SAKL0F11396g7.351ON2542557761e-104
YLR201C (COQ9)7.351ON2602477309e-97
Kpol_530.307.351ON2602477239e-96
Suva_10.2967.351ON2602477073e-93
Skud_12.2657.351ON2602477003e-92
ACL147W7.351ON2462506836e-90
TPHA0F029807.351ON2642656821e-89
NDAI0E044707.351ON2642636786e-89
KNAG0B026207.351ON2652506761e-88
NCAS0E028707.351ON2612526743e-88
Ecym_47227.351ON2532486654e-87
TBLA0E004507.351ON2792476614e-86
CAGL0A03949g7.351ON2682486596e-86
Smik_12.2607.351ON2602476492e-84
KAFR0L014807.351ON2642476082e-78
TDEL0B058601.420ON18337740.35
Ecym_5679na 1ON130666667.0
SAKL0D02156g8.813ON114933667.0
KAFR0L002404.14ON313385667.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01232g
         (257 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   522   0.0  
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   421   e-150
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   332   e-115
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   311   e-107
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   309   e-106
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   303   e-104
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   285   9e-97
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   283   9e-96
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   276   3e-93
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   274   3e-92
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   267   6e-90
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   267   1e-89
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   265   6e-89
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   265   1e-88
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   264   3e-88
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   260   4e-87
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   259   4e-86
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   258   6e-86
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   254   2e-84
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   238   2e-78
TDEL0B05860 Chr2 complement(1040386..1040937) [552 bp, 183 aa] {...    33   0.35 
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...    30   7.0  
SAKL0D02156g Chr4 (171759..175208) [3450 bp, 1149 aa] {ON} simil...    30   7.0  
KAFR0L00240 Chr12 complement(32708..42109) [9402 bp, 3133 aa] {O...    30   7.5  

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/257 (100%), Positives = 257/257 (100%)

Query: 1   MLALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALV 60
           MLALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALV
Sbjct: 1   MLALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALV 60

Query: 61  ASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAE 120
           ASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAE
Sbjct: 61  ASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAE 120

Query: 121 PPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDA 180
           PPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDA
Sbjct: 121 PPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDA 180

Query: 181 NDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMW 240
           NDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMW
Sbjct: 181 NDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMW 240

Query: 241 YTLLMSVNLAKSQLTRS 257
           YTLLMSVNLAKSQLTRS
Sbjct: 241 YTLLMSVNLAKSQLTRS 257

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  421 bits (1083), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/258 (79%), Positives = 226/258 (87%), Gaps = 1/258 (0%)

Query: 1   MLALS-RILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERAL 59
           MLA S R L RR Y P+ LE+QL    APL YG  S QFKVL+HAL  HVPSYGFNERAL
Sbjct: 1   MLARSFRTLGRRFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERAL 60

Query: 60  VASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPA 119
           VASLNDL LG  +LS IGA NSP  LN+SPAVLEL+KFHLVTKRYALTK+LD AR +SPA
Sbjct: 61  VASLNDLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPA 120

Query: 120 EPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPD 179
           EPPALETLFH+RLELN PIA H+TQLL+ L++PGEFL+Q+ALPELHRLSDDM+YFSKEPD
Sbjct: 121 EPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPD 180

Query: 180 ANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYM 239
           ANDFAWYSKR A+SCAFVSSELFMAQD+S NYADTFEFAA+KLHNV+KLGQYY NTEEYM
Sbjct: 181 ANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYM 240

Query: 240 WYTLLMSVNLAKSQLTRS 257
           WYTLLMSVNLAKSQ+TRS
Sbjct: 241 WYTLLMSVNLAKSQITRS 258

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  332 bits (850), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 200/253 (79%), Gaps = 4/253 (1%)

Query: 4   LSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASL 63
           +SR+  R LYHP+ LEH L     PLTYG  S QFKVL +ALNKHVP YGFNERA+V SL
Sbjct: 1   MSRVFTR-LYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSL 59

Query: 64  NDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPA 123
           N+L +G S LSV+G+SNSPSF N SP+VLEL+KFHLV+KR  L  +L P  +  P   P 
Sbjct: 60  NELGMGSSYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDL-PLDSDKPL--PD 116

Query: 124 LETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDF 183
           L+TLF +RL+LN+ +APHL+QLLS +S+PGEFL  TAL ELH+L+DDM+++S E D NDF
Sbjct: 117 LKTLFLQRLKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDF 176

Query: 184 AWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTL 243
           AWYSKRIALS A+VSSELFMAQD+S N+ +T EFA  KL+ VS+LG  YNNTEEY+W+TL
Sbjct: 177 AWYSKRIALSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTL 236

Query: 244 LMSVNLAKSQLTR 256
           L S+NLAKSQ+TR
Sbjct: 237 LSSINLAKSQITR 249

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  311 bits (797), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 195/259 (75%), Gaps = 6/259 (2%)

Query: 1   MLALSRILARRLYHPSALEH-QLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERAL 59
           ++A SRI AR  Y P+  E+    +S  PL YG  S Q+KVL H L K VP YGFNERA+
Sbjct: 6   LIAGSRIFARG-YRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERAI 64

Query: 60  VASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPA 119
           V SLN+L    ++LSVIG+SN PSF ++SPA++EL+KFHLV KR  LT+ +      +P 
Sbjct: 65  VNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENIS---LETPV 121

Query: 120 EP-PALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEP 178
           +  P+LE L  +RLE+N P+A HL+QLLS LSIPG FLV  ++PELHRLSDDM+YFS E 
Sbjct: 122 DQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEK 181

Query: 179 DANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEY 238
           D NDFAWYSKR+A+SCA+VSSELFMAQDRS +Y +TFEFA EKLH VS LG+YYNNTEE+
Sbjct: 182 DHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEF 241

Query: 239 MWYTLLMSVNLAKSQLTRS 257
            WYTLL ++NL KSQL R 
Sbjct: 242 AWYTLLSTINLVKSQLARG 260

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  309 bits (791), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/247 (61%), Positives = 187/247 (75%), Gaps = 6/247 (2%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           R YHPS  EH  +    PL YG  S Q+ VL HAL   VP  GFNERA+V SLN L+   
Sbjct: 11  RRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNYPS 70

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           ++LSVIGASNSPS L++SPAV+EL+KFHLV KR  L+++L      S  E P+LE LF +
Sbjct: 71  TMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDL------SSEEKPSLEDLFIK 124

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RLELN PIA HL+QLLS +S+PG F V TALPELHRLSDD++Y+S E D +DFAWYSKR+
Sbjct: 125 RLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRL 184

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
            +SCA+VSSELFMAQD+S NY +TF+FA +KL    +LG+YYNNTEE++WYTLL S+NLA
Sbjct: 185 GISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLA 244

Query: 251 KSQLTRS 257
           KSQ+ R 
Sbjct: 245 KSQMARG 251

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  303 bits (776), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 197/255 (77%), Gaps = 5/255 (1%)

Query: 3   ALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVAS 62
           A S+I ARR YHP+ LEH  +    PL Y   S Q+K+L +AL++ VP YGFNERAL +S
Sbjct: 5   AFSKI-ARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSS 63

Query: 63  LNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPP 122
            +DL    S LSV+GASNSPSF N+SPAVLEL+KFHLV+KRY+LT  +         E P
Sbjct: 64  CSDLGYSSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV----ADGTLESP 119

Query: 123 ALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDAND 182
           +LE LF +RLE+NKPIA HL+QLLS L++PG FL + A+PELHRLSDDMVYFS EPD ND
Sbjct: 120 SLENLFLKRLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHND 179

Query: 183 FAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYT 242
           FAWYSKR+A+S A+VSSELFMAQD+S +Y DT +FA EKL N+ +LG+ YNN EEY WYT
Sbjct: 180 FAWYSKRLAISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYT 239

Query: 243 LLMSVNLAKSQLTRS 257
           LL S++LAKSQ+TRS
Sbjct: 240 LLSSISLAKSQMTRS 254

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  285 bits (730), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 140/247 (56%), Positives = 183/247 (74%), Gaps = 1/247 (0%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           RLYH + +EH       PLTYG  S Q+KVL  AL K VP +GF+ER++V SLN+L    
Sbjct: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           S++S IGA NSPSF ++S AV+ELIKF LV KRY LT+ ++P  T    + P+LE L  +
Sbjct: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQ-YKLPSLEHLLLK 133

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RLE++KPI  HL++L+S L+IP  FL +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 134 RLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
           A+S  ++ S+LFMAQD+S NY +TF FA +KLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 194 AVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLI 253

Query: 251 KSQLTRS 257
           KSQL R 
Sbjct: 254 KSQLVRG 260

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  283 bits (723), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 183/247 (74%), Gaps = 2/247 (0%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           R YHP+  E+    +  PL YG  S Q+K+L H+L+  VP +GFNERA+V S+N L    
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           S+LSVIG+SN+PSFL++S A++EL+KF+LV KRY L++++ P  T    E P+LE L  +
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDI-PLDTPV-EELPSLEDLLIK 133

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RL+++ PI PHL+QL++ LSIPG FL  T+LPELHRL+DDM+YFS E D  DFAWY+KR+
Sbjct: 134 RLKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRM 193

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
            +S A++SS+LFMAQDRS  Y DTFEFA +KL  + KLG YYNN EEY WY L+ S+N+A
Sbjct: 194 GVSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMA 253

Query: 251 KSQLTRS 257
           KS+  R 
Sbjct: 254 KSKAARG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  276 bits (707), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 181/247 (73%), Gaps = 1/247 (0%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           RLYH + +EH       PL YG  S Q+KVL  AL ++VP +GF ER++V SLN L    
Sbjct: 15  RLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLGYPS 74

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           S++S IGASNSPSF+++S AV+EL+KF LV KRY LT+ ++P  T    + P+LE L  +
Sbjct: 75  SMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPH-YKLPSLEHLLLK 133

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RLE++KP+   LT L+S L+IP  FL +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 134 RLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
           A+S  ++ S+LFMAQD+S ++ +TF FA +KLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 194 AVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLV 253

Query: 251 KSQLTRS 257
           KSQL R 
Sbjct: 254 KSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  274 bits (700), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 180/247 (72%), Gaps = 1/247 (0%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           RLYH + +EH       PLTYG  S Q+KVL  AL ++VP +GF+ER++V SLN L    
Sbjct: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           S++S IGASNSPSF ++S AV+EL+KF LV KRY LT+ ++P  TS   + P+LE L  +
Sbjct: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSR-YKLPSLEHLLLK 133

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RLE++K I   L  L+S L++P   L +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 134 RLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRL 193

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
           A+S  ++ S+LFMAQD+S ++ +TF FA EKLH V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 194 AVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLV 253

Query: 251 KSQLTRS 257
           KSQL R 
Sbjct: 254 KSQLARG 260

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  267 bits (683), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 134/250 (53%), Positives = 168/250 (67%), Gaps = 7/250 (2%)

Query: 8   LARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLD 67
           + RRLYHP+ LEH + +   PL Y   S Q+KVL+ AL  HVP  GFNERA+V +  DL 
Sbjct: 4   VCRRLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLG 63

Query: 68  LGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETL 127
            G ++LS + A NSP+ LN   AVLEL+KFHLVTKR AL         S       +E L
Sbjct: 64  YGSAVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVS-------MEQL 116

Query: 128 FHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYS 187
           F +R+E ++P+A  LTQLLS LS+PGEFLV TA+PEL RLSDD++Y+S E D  D AWYS
Sbjct: 117 FLQRVEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYS 176

Query: 188 KRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSV 247
           KR A++ A+VS+ LFMA+DRS    +T  FA  +L  V  LG  YNN EE+ WY LLM++
Sbjct: 177 KRAAVAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAM 236

Query: 248 NLAKSQLTRS 257
           NL KSQLTR 
Sbjct: 237 NLVKSQLTRG 246

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  267 bits (682), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 133/265 (50%), Positives = 190/265 (71%), Gaps = 9/265 (3%)

Query: 1   MLALSRILAR------RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGF 54
           M+   R++ R      R +HP+  E+ L +  +P TY   S QFK+L HA++  V  +GF
Sbjct: 1   MINRGRLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGF 60

Query: 55  NERALVASLNDLDL--GPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDP 112
           +ERA++ ++ +L +    ++LS IG+SNSPSFL++SP+V+EL+KF+LV KRY + + LDP
Sbjct: 61  SERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDP 120

Query: 113 ARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMV 172
             T    E P+LE+L  +RLE++ PI  H++  +S L IPG FL+ +ALPELHRL+DDM+
Sbjct: 121 L-TMQQEELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMI 179

Query: 173 YFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYY 232
           YFS E D +DFAWYSKR+ +S A++SS+LFMAQD S NY +T +FA +KL  V +LG YY
Sbjct: 180 YFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYY 239

Query: 233 NNTEEYMWYTLLMSVNLAKSQLTRS 257
           NNTEEY WY LL SVN+ KS+++R+
Sbjct: 240 NNTEEYAWYVLLNSVNMVKSRMSRA 264

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  265 bits (678), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 128/263 (48%), Positives = 184/263 (69%), Gaps = 8/263 (3%)

Query: 2   LALSRILAR-------RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGF 54
           + L+RIL++       R +H + LE+  A + +PLTY   S Q+K+L +ALNK VP  GF
Sbjct: 1   MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF 60

Query: 55  NERALVASLNDLDLGPSLLSVIGASNSPS-FLNASPAVLELIKFHLVTKRYALTKELDPA 113
            + A+ +SLN+LDL  SL SV+G+SNSPS F + SPAV+EL+KF LV+KRY LT+ + P 
Sbjct: 61  TDEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPY 120

Query: 114 RTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVY 173
             ++  + P+LETL   RL++++P+   L+ L + L IP   L   ALPEL  LSDD++Y
Sbjct: 121 IETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIY 180

Query: 174 FSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYN 233
           FS E D +D AWY+KR+ +SCA+VSS+L+M ++   N+  T +FA +KLH +  LG+YYN
Sbjct: 181 FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN 240

Query: 234 NTEEYMWYTLLMSVNLAKSQLTR 256
           NTEEY WYTL++S+NL K++L R
Sbjct: 241 NTEEYAWYTLMVSMNLVKARLAR 263

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  265 bits (676), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 126/250 (50%), Positives = 176/250 (70%)

Query: 7   ILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDL 66
           +L+ RLYHP+ +E+  +   APLTY   S Q ++L H L   VP +GF ERAL+ S+  +
Sbjct: 15  LLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTERALLKSIQAV 74

Query: 67  DLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALET 126
               S++SV+GASNSPS  ++SPAV+EL+KF+LV KR+ALT+ L  A   SPA  P+LE 
Sbjct: 75  GYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLGSPAALPSLEH 134

Query: 127 LFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWY 186
           L  +RL+++ P++  L  L + L++P +F+V  A+PEL RLSDDM+YFS E D  D AWY
Sbjct: 135 LLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSNEKDHFDTAWY 194

Query: 187 SKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMS 246
           SKR+ +S A+ +S+LFMAQD S N  DT EFA +KLH +  LG+YYNN EEY WY+++ +
Sbjct: 195 SKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVEEYAWYSIMTT 254

Query: 247 VNLAKSQLTR 256
           VN AK+  +R
Sbjct: 255 VNRAKAGFSR 264

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  264 bits (674), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 135/252 (53%), Positives = 179/252 (71%), Gaps = 2/252 (0%)

Query: 7   ILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDL 66
           + + R YHPS  E+    + +PLTY   S Q+K+L +AL K VP +GF E+A+  SLN+L
Sbjct: 11  LFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKEKAITDSLNEL 70

Query: 67  DLGPSLLSVIGASNSPS-FLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALE 125
               SLLSVIGASNSP+ F + SPAV+ELIKF LV+KRY LT+ L P  T+   E P+LE
Sbjct: 71  GFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPD-TTPKNELPSLE 129

Query: 126 TLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAW 185
           +L  +RLE++K I   +  L + L+ P  FL   ALPELHRLSDDM+YFS E D +D AW
Sbjct: 130 SLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSNEKDHHDMAW 189

Query: 186 YSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLM 245
           Y+KR+ +SCA+VSS+L+MAQD S ++ DT  FA +KLH + KLG+YYNNTEEY WY  ++
Sbjct: 190 YTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTEEYAWYMFMV 249

Query: 246 SVNLAKSQLTRS 257
           S NL +++L RS
Sbjct: 250 STNLVRARLARS 261

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  260 bits (665), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 123/248 (49%), Positives = 173/248 (69%), Gaps = 8/248 (3%)

Query: 10  RRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLG 69
           RR YH ++ E+ + ++  PL YG  S Q+KVL  AL K+VP  GF + A+V + N+L   
Sbjct: 14  RRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAANELGYN 73

Query: 70  PSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFH 129
            ++L+ IGA+NSP+  N S +V EL+KFHLVTKRY L ++ +  +T        LE LF 
Sbjct: 74  SAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQEDQEGTKT--------LEELFL 125

Query: 130 RRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKR 189
           +RLE NK + PHL ++LS L+IPG+FLV T LPEL +L+DDM+Y+S E D ND AWYSKR
Sbjct: 126 KRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWYSKR 185

Query: 190 IALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNL 249
           +A+S A++S+ELFMA+D S N+  T EFA  +++ + ++G  YNN EE+ W+ LL +VNL
Sbjct: 186 LAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTTVNL 245

Query: 250 AKSQLTRS 257
           A+SQL R 
Sbjct: 246 ARSQLVRG 253

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  259 bits (661), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 178/247 (72%), Gaps = 4/247 (1%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           R Y+  + + + +    PL YG  S Q+++LE A+   VP++GF ERA++ S+N L    
Sbjct: 37  RTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLGYNS 96

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           S++SV+G+SN+ + L++SPAVLEL+KF+LV+KR  L++ +DP       + P+LE L  +
Sbjct: 97  SMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDP----ETKDLPSLEYLLLK 152

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RL+++K I   L ++++ LSIPG FL +T++PEL RLSDDM+YFS E D +D AWYSKR+
Sbjct: 153 RLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKRL 212

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
           A+S  +++S++FMAQD S +   T EFA +KL+ V  LG+YYNNTEE++W+TL+ SVN+ 
Sbjct: 213 AVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNIV 272

Query: 251 KSQLTRS 257
           KSQL RS
Sbjct: 273 KSQLARS 279

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  258 bits (659), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 120/248 (48%), Positives = 175/248 (70%), Gaps = 2/248 (0%)

Query: 9   ARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDL 68
           A R YHP++ E+     + PLTY P S +FK+L H +   VP +GF E+A+V SLN + +
Sbjct: 22  AVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKM 81

Query: 69  GPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLF 128
              +L+ IGASNS +FL++SPAV+ELIKF LV KR+ + + +     +  ++ P+LE+L 
Sbjct: 82  PSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGI--TEIAEASKLPSLESLL 139

Query: 129 HRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSK 188
            +RL+++ PIA HLTQ+ + L +P  F+   +LPEL RL+DDM+Y+S E D +DFAWY+K
Sbjct: 140 LKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTK 199

Query: 189 RIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVN 248
           R AL+  +++S+ FMAQD+S N+ +T EFA +KLH V  LG YYNN EE+ W+TL+ +VN
Sbjct: 200 RAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVN 259

Query: 249 LAKSQLTR 256
           L KSQ+ R
Sbjct: 260 LTKSQMAR 267

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  254 bits (649), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 186/247 (75%), Gaps = 1/247 (0%)

Query: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70
           RLYHP+ +EH  +H   PLTYG  S Q+KVL  AL ++VP +GF+ER++V SLN+L    
Sbjct: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYPS 74

Query: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130
           S++S I ASNSPSF ++S AV+ELIKF LV KRY LT+ ++P  T    + P+LE L  R
Sbjct: 75  SMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQ-YKLPSLEHLLLR 133

Query: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190
           RLE++KPI   L++L+S L+IP  FL +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 134 RLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193

Query: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250
           A+S  ++ S+LFMAQD+S NY DTF+FA  KL+ V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 194 AVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLV 253

Query: 251 KSQLTRS 257
           KSQL R 
Sbjct: 254 KSQLVRG 260

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  238 bits (608), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 120/247 (48%), Positives = 175/247 (70%), Gaps = 6/247 (2%)

Query: 10  RRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLG 69
           RRLYHP++ E+    + +PLTY   S Q K+L H+L ++VP+ GFNE++++ S+NDL   
Sbjct: 23  RRLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYS 82

Query: 70  PSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFH 129
            S++SVIGASNSPSF ++SPAVLELIK++LV+KR  LTK+ +   T++  E         
Sbjct: 83  SSMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKDTNDNTTTTLKELLLKRL--- 139

Query: 130 RRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKR 189
              E++ PI+  L  L + L+ PG+F+   +LPEL +L+DDM++FS E D +D AWYSKR
Sbjct: 140 ---EMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKR 196

Query: 190 IALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNL 249
           +A+S A+V+S++FM QD S N+  T +FA++K+  V  LG+YYNN EEY W+TL+ S+NL
Sbjct: 197 LAVSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINL 256

Query: 250 AKSQLTR 256
            KSQ +R
Sbjct: 257 VKSQFSR 263

>TDEL0B05860 Chr2 complement(1040386..1040937) [552 bp, 183 aa] {ON}
           Anc_1.420 YCR003W
          Length = 183

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 2/37 (5%)

Query: 31  YGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLD 67
           YGPGS Q K++ H LNK  PS G  +RA    ++ +D
Sbjct: 85  YGPGSKQLKMIHH-LNK-CPSCGHQKRANTLCMHCVD 119

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar
           to Ashbya gossypii AGL364C
          Length = 1306

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 75  VIGASNSPSFLNASPAVLEL-IKFHLVTKRYALTKELDPARTSSPAEPPALETLFHRRLE 133
           ++   N  S LNA    L    K+ LV         L+P+RT S +E PA E +      
Sbjct: 106 ILSNKNVSSCLNADLGKLSCRKKWDLVCNAQNRRNVLNPSRTPSNSEDPAQEVIRFLNEN 165

Query: 134 LNKPIA 139
           LN PI 
Sbjct: 166 LNDPIT 171

>SAKL0D02156g Chr4 (171759..175208) [3450 bp, 1149 aa] {ON} similar
           to uniprot|P38426 Saccharomyces cerevisiae YMR261C TPS3
           115 kD regulatory subunit of trehalose-6- phosphate
           synthase/phosphatase complex
          Length = 1149

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 16/33 (48%)

Query: 204 AQDRSANYADTFEFAAEKLHNVSKLGQYYNNTE 236
           + D S  Y D  E A    HNV K G Y NN +
Sbjct: 335 SDDLSVEYEDDLECAQRYRHNVPKFGGYSNNAK 367

>KAFR0L00240 Chr12 complement(32708..42109) [9402 bp, 3133 aa] {ON}
           Anc_4.14 YLL040C
          Length = 3133

 Score = 30.0 bits (66), Expect = 7.5,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 35/85 (41%), Gaps = 1/85 (1%)

Query: 167 LSDDMVYFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVS 226
           LS  +   S+EP  N   W+S     S      EL + +++   + D  EF   +  N S
Sbjct: 416 LSPALSQISQEPQKNA-TWFSSWWNTSKQGKQDELIITEEQKQEFYDVIEFDESEEFNAS 474

Query: 227 KLGQYYNNTEEYMWYTLLMSVNLAK 251
           K     N      W TL ++ +L K
Sbjct: 475 KQENLANIKIPNHWTTLKITGSLRK 499

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,433,368
Number of extensions: 1096642
Number of successful extensions: 2963
Number of sequences better than 10.0: 28
Number of HSP's gapped: 3028
Number of HSP's successfully gapped: 28
Length of query: 257
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 150
Effective length of database: 41,212,137
Effective search space: 6181820550
Effective search space used: 6181820550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)