Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01210g7.352ON1131135732e-77
Kwal_56.246487.352ON1131104715e-62
SAKL0F11418g7.352ON1151083771e-47
TPHA0F029907.352ON1071043719e-47
Kpol_530.297.352ON1071003552e-44
TBLA0E004407.352ON1151073544e-44
TDEL0C019607.352ON1071043432e-42
NCAS0E028607.352ON1051003395e-42
KLLA0D12298g7.352ON1151033406e-42
KNAG0B026107.352ON1191083381e-41
KAFR0L014907.352ON1071003353e-41
YLR200W (YKE2)7.352ON1141003311e-40
ZYRO0F11748g7.352ON1091003258e-40
Smik_12.2597.352ON1141043259e-40
Suva_10.2957.352ON1141043232e-39
NDAI0E044607.352ON1061053213e-39
Skud_12.2647.352ON1141043198e-39
CAGL0A03971g7.352ON1061053171e-38
ACL146C7.352ON1071033152e-38
Ecym_47217.352ON1071033041e-36
KLLA0E04753g7.531ON33041641.9
NCAS0H002307.518ON2633104633.4
YBR148W (YSW1)3.106ON60981614.9
KNAG0D035204.113ON103062615.6
TBLA0H033008.415ON108125599.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01210g
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   225   2e-77
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   186   5e-62
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   149   1e-47
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   147   9e-47
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   141   2e-44
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   140   4e-44
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   136   2e-42
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   135   5e-42
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   135   6e-42
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   134   1e-41
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   133   3e-41
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   132   1e-40
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   129   8e-40
Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   129   9e-40
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   129   2e-39
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   128   3e-39
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   127   8e-39
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   126   1e-38
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   125   2e-38
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   121   1e-36
KLLA0E04753g Chr5 complement(423256..424248) [993 bp, 330 aa] {O...    29   1.9  
NCAS0H00230 Chr8 complement(30741..38642) [7902 bp, 2633 aa] {ON...    29   3.4  
YBR148W Chr2 (537876..539705) [1830 bp, 609 aa] {ON}  YSW1Protei...    28   4.9  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    28   5.6  
TBLA0H03300 Chr8 (805828..809073) [3246 bp, 1081 aa] {ON} Anc_8....    27   9.0  

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  225 bits (573), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL 60
           MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL
Sbjct: 1   MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL 60

Query: 61  LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQARQQ 113
           LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQARQQ
Sbjct: 61  LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQARQQ 113

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  186 bits (471), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 93/110 (84%), Positives = 99/110 (90%)

Query: 1   MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL 60
           MSSSAQ+LTMNY T+Q ELEELV ARQ+LETQLQENKIVQDEFD L+EETQVYKLTG VL
Sbjct: 1   MSSSAQELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVL 60

Query: 61  LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           LPVEQFEAKSNVSKRLEFI  EI RCE+NIK KQ LLEKLRAELLQ Q+A
Sbjct: 61  LPVEQFEAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEA 110

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  149 bits (377), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 89/108 (82%)

Query: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63
           +AQ L+M Y T Q ELE+LVIARQKLETQLQENKIVQDEFD LR+E+QVYKLTG VLLPV
Sbjct: 5   NAQKLSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPV 64

Query: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQAR 111
           EQ EAK NV KRL+FI  EI RCEENIK KQ  LE+LR EL++ + A+
Sbjct: 65  EQEEAKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTAK 112

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  147 bits (371), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 85/104 (81%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           D+   Y + Q ELEEL+IARQKLETQLQENKIV DEF+ L E+T +YKLTGNV+LP+EQF
Sbjct: 3   DVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIEQF 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           EAKSNV KRLEFI  EI RCEENIKTKQ  L+KLR EL++ + A
Sbjct: 63  EAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  141 bits (355), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           DL   Y   Q ELEE+++AR++LETQLQENKIV +EF+GL+E+TQVYKLTGNVLLPVEQF
Sbjct: 3   DLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVEQF 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           EA+SNV KRLEFI AEI +CE+NIK+KQ  L KLR EL++
Sbjct: 63  EARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMK 102

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  140 bits (354), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 68/107 (63%), Positives = 86/107 (80%)

Query: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63
           S+ +L   Y T Q+ELE  ++ RQKLETQLQENKIV DEF+ L+EET+V+KLTGNVLLP+
Sbjct: 2   SSNELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPI 61

Query: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           EQ EA+SN+ KRLEFI  EI+RCE+NIK KQ  +EK+R+EL+ T  A
Sbjct: 62  EQDEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELMATAPA 108

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  136 bits (343), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 81/104 (77%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           DL   Y   Q ELE LVIARQKLETQLQENKIV +EF  L+E+TQVYKLTGNVLLPVEQ 
Sbjct: 3   DLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           EA SNV+KRLEFI  EI RCE N+K KQ   EKLRAEL++ + A
Sbjct: 63  EANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  135 bits (339), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 82/100 (82%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           DL   Y + Q ELE  +IARQKLETQLQENKIV DEF+ L +ET+VYKLTGNVLLPVEQ 
Sbjct: 3   DLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVEQD 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           EA+SNV KRLEFI +EI +CE+NIK KQ  LEK+RAE+++
Sbjct: 63  EARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIK 102

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  135 bits (340), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 69/103 (66%), Positives = 80/103 (77%)

Query: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63
           SA++ T  Y   Q ELEEL++ARQKLETQLQENKIV DEF  L+++  VYKLTG VLLPV
Sbjct: 2   SAEETTQKYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPV 61

Query: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           EQFEAK NV KRLEFI  EI RCE NIK+KQ  LE  R+EL++
Sbjct: 62  EQFEAKGNVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMK 104

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 69/108 (63%), Positives = 86/108 (79%), Gaps = 4/108 (3%)

Query: 1   MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVL 60
           MS+ A      Y  +Q  LEEL++ARQKLETQLQENKIV +EFD L+E+++VYKLTG+VL
Sbjct: 1   MSNPA----AKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVL 56

Query: 61  LPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQ 108
           LPV+Q EA++NV KRLEFI  EI+RCEENIK KQ  LE LR+EL++ Q
Sbjct: 57  LPVDQDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKLQ 104

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           +L   Y   Q ELEEL++ARQKLETQLQENKIV DEF  L+EETQVYKLTGNVLLP+EQ 
Sbjct: 3   ELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIEQD 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           EA+ NV KRLEFI  EI RCE NIK+KQ  +E +R EL++
Sbjct: 63  EARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVK 102

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  132 bits (331), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           +L   Y   Q+ELEE ++ARQKLETQLQENKIV +EFD L E+T VYKLTGNVLLPVEQ 
Sbjct: 3   ELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           EA++NV KRLEFI  EI RCE+NI+ KQ  LEK+R+EL++
Sbjct: 63  EARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIK 102

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  129 bits (325), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           +L   Y   Q ELE  ++ARQKLETQLQENKIV DEF+GL+ +++VYKLTGNVLLPVEQ 
Sbjct: 3   ELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVEQD 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           +A++NVSKRLEFI  EI+RCE NIK KQ   E+++AEL++
Sbjct: 63  DARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIK 102

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  129 bits (325), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (75%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           +L   Y   Q ELEE ++ARQKLETQLQENKIV +EFD L E T VYKLTGNVLLPV+Q 
Sbjct: 3   ELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQS 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           EA+ NV KRLEFI AEI RCE+NIK KQ  LEK+R +L++   A
Sbjct: 63  EARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  129 bits (323), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (76%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           +L   Y   Q ELEE ++ARQKLETQLQENKIV +EFD L+E+T VYKLTGNVLLPVEQ 
Sbjct: 3   ELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           EA+ NV KRLEFI  EI RCE+NI+ KQ  LE++R EL++   A
Sbjct: 63  EARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNA 106

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  128 bits (321), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 82/105 (78%)

Query: 5   AQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVE 64
           A +L   Y   Q ELE+L++ARQKLETQLQENKIV +EF+ L  E+QVYKLTGNVLLPV+
Sbjct: 2   ASNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVD 61

Query: 65  QFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQ 109
           Q EA SNV KRLEFI  EI+RCE NIK KQ  L+ +R+E+L+ +Q
Sbjct: 62  QEEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKMRQ 106

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  127 bits (319), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 78/104 (75%)

Query: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66
           +L   Y   Q ELEE ++ARQKLETQLQENKIV +EFD + ++T VYKLTGNVLLPVEQ 
Sbjct: 3   ELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVEQS 62

Query: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110
           EA+ NV KRLEFI  EI RCE NI+ KQ  LEK+R EL++   A
Sbjct: 63  EARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNA 106

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  126 bits (317), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 82/105 (78%)

Query: 5   AQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVE 64
           + +L   Y + Q+ELEELV ARQKLETQLQENKIV +EF  L+E+T VYKLTGNVLLPVE
Sbjct: 2   SAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVE 61

Query: 65  QFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQ 109
             +AK+NV KRLEFI  EI RCE+NI++KQ  LE +R +L+  Q+
Sbjct: 62  HDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLISQQK 106

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  125 bits (315), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 77/103 (74%)

Query: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63
           SA+ +   Y   Q ELEELV+ RQKLETQLQENKIV +E   L+ ETQVYKLTG VLLPV
Sbjct: 2   SAEQVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPV 61

Query: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           EQ EA+ NVSKRLEFI  EI RCE+NIK KQ  +E  RA L++
Sbjct: 62  EQEEAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVK 104

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  121 bits (304), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 76/103 (73%)

Query: 4   SAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPV 63
           S + +   Y   Q ELE+L++ RQKLETQLQENKIV +E   L+E+ QVYKLTG VLLPV
Sbjct: 2   SVEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPV 61

Query: 64  EQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQ 106
           E  EA SNVSKRLEFI  EI+RCE NIK KQ  LE+ R EL++
Sbjct: 62  EHEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIK 104

>KLLA0E04753g Chr5 complement(423256..424248) [993 bp, 330 aa] {ON}
           similar to uniprot|P52919 Saccharomyces cerevisiae
           YLR457C NBP1 Component of the mitotic apparatus
           containing a coiled-coil domain essential for the G2/M
           transition
          Length = 330

 Score = 29.3 bits (64), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 27/41 (65%)

Query: 19  LEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNV 59
           +EELVI ++KLE   Q+N ++++ FD  + ET+  K   N+
Sbjct: 185 VEELVITKKKLEFVQQKNNLLEELFDDGKMETEYVKSRRNI 225

>NCAS0H00230 Chr8 complement(30741..38642) [7902 bp, 2633 aa] {ON}
            Anc_7.518
          Length = 2633

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 21/104 (20%)

Query: 12   YNTSQH-ELEELVIARQKLETQ----LQENKIVQDEFDGLREETQVYKLTGNVLLPVEQ- 65
            Y  S H ++  L IA    +      L++N     EF GL+ +       G  ++ + Q 
Sbjct: 1673 YTISYHADVSPLYIAHIYHDIDAAYILKKNDFETVEFAGLKAKV------GQFVMDLHQR 1726

Query: 66   ------FEAKSNVSKR---LEFITAEINRCEENIKTKQGLLEKL 100
                  ++ K NV+KR   L+F++A+I     +I+T  G+  KL
Sbjct: 1727 KEVVTEYKKKLNVTKRVKKLKFLSADILTHRIDIRTVHGIFHKL 1770

>YBR148W Chr2 (537876..539705) [1830 bp, 609 aa] {ON}  YSW1Protein
           required for normal prospore membrane formation;
           interacts with Gip1p, which is the meiosis-specific
           regulatory subunit of the Glc7p protein phosphatase;
           expressed specifically in spores and localizes to the
           prospore membrane
          Length = 609

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 16  QHELEELVIARQKLETQLQENKIVQDEFDGLREETQ-VYKLTGNVLLPVEQFEAKSNVSK 74
           Q ELE+L +    L T  QEN   + E + L++  + + K   +++L + + + KS  +K
Sbjct: 319 QDELEKLKLENLNLSTLKQENLQHKQEINSLKDNLESISKKNNDLILEMNKLKKKSTNNK 378

Query: 75  RLEFITAEINRCEENIKTKQG 95
             E+I+ + N  EE  K+  G
Sbjct: 379 TNEYISTDENENEEITKSNMG 399

>KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1030

 Score = 28.1 bits (61), Expect = 5.6,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 30  ETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQFEAKSNVSKRLEFITAEINRCEEN 89
           + Q++E +++    D L  ++QVYK    +L PV+Q     +V K L+ +     +CEEN
Sbjct: 855 QLQVKEPQLIACTRDILDTKSQVYKY---LLTPVQQSGFHISVRKLLKDLGVVGQQCEEN 911

Query: 90  IK 91
            K
Sbjct: 912 EK 913

>TBLA0H03300 Chr8 (805828..809073) [3246 bp, 1081 aa] {ON} Anc_8.415
           YDR206W
          Length = 1081

 Score = 27.3 bits (59), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 19/25 (76%)

Query: 33  LQENKIVQDEFDGLREETQVYKLTG 57
             +N I++++FD + + TQVY+++G
Sbjct: 311 FDKNSIIREKFDEILKSTQVYEISG 335

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.125    0.318 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,304,551
Number of extensions: 392458
Number of successful extensions: 2081
Number of sequences better than 10.0: 177
Number of HSP's gapped: 2070
Number of HSP's successfully gapped: 190
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)