Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0H01188g7.353ON26726714280.0
Kwal_56.246507.353ON2522528791e-119
SAKL0F11440g7.353ON2722775703e-72
TDEL0C019507.353ON2732824173e-49
TBLA0E020707.353ON2522774093e-48
ZYRO0F11770g7.353ON2722814033e-47
KNAG0B026007.353ON2792873974e-46
NCAS0E028507.353ON2812913932e-45
CAGL0A03993g7.353ON2722813903e-45
YLR199C (PBA1)7.353ON2762853842e-44
Kpol_530.287.353ON2742843834e-44
KAFR0L015007.353ON2792883826e-44
Skud_12.2637.353ON2742833817e-44
Smik_12.2587.353ON2742833773e-43
Suva_10.2947.353ON2752873764e-43
TPHA0F030007.353ON2822913696e-42
NDAI0E044507.353ON2211972984e-32
Ecym_47207.353ON2612772804e-29
KLLA0D12276g7.353ON2582801842e-15
ACL145W7.353ON2342281401e-09
NCAS0E035307.283ON718165740.82
CAGL0F01881g8.51ON18017672.9
KLLA0E10561g8.161ON52350683.5
KAFR0C028508.161ON52672675.3
Suva_2.1078.161ON52650666.7
YBL015W (ACH1)8.161ON52650666.8
Skud_2.918.161ON52650666.8
Smik_2.1028.161ON52650666.8
TBLA0E035608.161ON52450666.9
CAGL0J04268g8.161ON52650658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0H01188g
         (267 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   554   0.0  
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   343   e-119
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   224   3e-72
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   165   3e-49
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   162   3e-48
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   159   3e-47
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   157   4e-46
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   155   2e-45
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   154   3e-45
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   152   2e-44
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   152   4e-44
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   151   6e-44
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   151   7e-44
Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   149   3e-43
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   149   4e-43
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   146   6e-42
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   119   4e-32
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...   112   4e-29
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...    75   2e-15
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    59   1e-09
NCAS0E03530 Chr5 (699391..701547) [2157 bp, 718 aa] {ON} Anc_7.2...    33   0.82 
CAGL0F01881g Chr6 (186169..186711) [543 bp, 180 aa] {ON} no simi...    30   2.9  
KLLA0E10561g Chr5 (932415..933986) [1572 bp, 523 aa] {ON} highly...    31   3.5  
KAFR0C02850 Chr3 (561545..563125) [1581 bp, 526 aa] {ON} Anc_8.1...    30   5.3  
Suva_2.107 Chr2 (188609..190189) [1581 bp, 526 aa] {ON} YBL015W ...    30   6.7  
YBL015W Chr2 (194122..195702) [1581 bp, 526 aa] {ON}  ACH1Protei...    30   6.8  
Skud_2.91 Chr2 (177817..179397) [1581 bp, 526 aa] {ON} YBL015W (...    30   6.8  
Smik_2.102 Chr2 (187680..189260) [1581 bp, 526 aa] {ON} YBL015W ...    30   6.8  
TBLA0E03560 Chr5 (890420..891994) [1575 bp, 524 aa] {ON} Anc_8.1...    30   6.9  
CAGL0J04268g Chr10 complement(399703..401283) [1581 bp, 526 aa] ...    30   8.8  

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/267 (100%), Positives = 267/267 (100%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS
Sbjct: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60

Query: 61  LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVHKLDDGTL 120
           LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVHKLDDGTL
Sbjct: 61  LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVHKLDDGTL 120

Query: 121 FICVREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDRVERVKYVGFPGNVGKGLPLL 180
           FICVREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDRVERVKYVGFPGNVGKGLPLL
Sbjct: 121 FICVREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDRVERVKYVGFPGNVGKGLPLL 180

Query: 181 TPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWSEVRFGN 240
           TPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWSEVRFGN
Sbjct: 181 TPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWSEVRFGN 240

Query: 241 REDYVKSCHRNWRLNGTVMGAQTGLYL 267
           REDYVKSCHRNWRLNGTVMGAQTGLYL
Sbjct: 241 REDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  343 bits (879), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 195/252 (77%)

Query: 16  LDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLFEDRLARAEQISSF 75
           +DAPL E  D +SLQ APLPEV L +P+ +  FKR FI+T IFRSLF  +LA AEQIS+F
Sbjct: 1   MDAPLGEIFDSNSLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQISTF 60

Query: 76  VVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVHKLDDGTLFICVREDFLHVPPIS 135
            V WQTKGREQHLYRED+Q QED    +E+  L  PV K+D+ T  +CV EDFLHVPPI 
Sbjct: 61  EVKWQTKGREQHLYREDFQVQEDCTKENESCGLSIPVLKIDEDTFLLCVAEDFLHVPPIV 120

Query: 136 INLLSREIAKLCGGLEVLLFGSSDRVERVKYVGFPGNVGKGLPLLTPPELITNFTASIMT 195
            NLLS+E+AKLC  L VL+ G+SDR+E VKYVG   N   G+P LTPPELIT+FTASI T
Sbjct: 121 GNLLSQEMAKLCRDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSFTASITT 180

Query: 196 QLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLN 255
           QLL  KV FDGYVAPSEGPSGYEKLSMETMD LIDLCWSE+  GNR++YVK  HRNWRL+
Sbjct: 181 QLLLCKVPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRDEYVKETHRNWRLH 240

Query: 256 GTVMGAQTGLYL 267
           GT  G QTGLYL
Sbjct: 241 GTSTGTQTGLYL 252

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  224 bits (570), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 120/277 (43%), Positives = 162/277 (58%), Gaps = 15/277 (5%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFK WNE +EPRH LD P   N + +SLQ  PLP V+L +PID + F +  + T + R 
Sbjct: 1   MLFKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRP 60

Query: 61  LFEDRLARAEQISSFVVVWQ------TKGREQHLYREDYQTQEDSRSTDETKRLEFPVHK 114
           LF   +     IS F V          K        EDY+ +       E   + F V K
Sbjct: 61  LFPSTICPMTTISEFQVTIPPQPTAIKKAHGSSYGDEDYEQESLPDKKPEEIIVSFQVEK 120

Query: 115 LDDGTLFICVREDFLHVPPISINLLSREIAKLCGG---LEVLLFGSSDRVERVKYVGFPG 171
            +D  LFIC+ E+FLHV PI+ NLLS++I +LC     L+ ++ G+SDR+  +K VG   
Sbjct: 121 FND-ILFICIEENFLHVSPIAWNLLSQQIIRLCKSKNTLQTIVLGTSDRITTLKSVG--- 176

Query: 172 NVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDL 231
               GLP L PPE +TN TAS++T L+ + + F   +APSEGPSG+EKLS+ +MD L + 
Sbjct: 177 -STLGLPDLEPPEFVTNCTASLITTLILHDLPFKSLIAPSEGPSGFEKLSLVSMDQLAES 235

Query: 232 CWSEVR-FGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           C+  V+   N   Y++ CHR WRL GT MGAQTGLY+
Sbjct: 236 CFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  165 bits (417), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 154/282 (54%), Gaps = 24/282 (8%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWNE +EPRH LD+P+    +  +LQ + LP+V L  PID   F R  + + I   
Sbjct: 1   MLFKQWNEIAEPRHQLDSPVIIANE-GTLQTSVLPQVTL-PPIDLQNFSRVILTSAIMNP 58

Query: 61  LFEDRLARAEQISSFVVVWQTKGREQHL--------YREDYQTQEDSRSTDE--TKRLEF 110
           LF ++L ++  +    V+      +  L        + E++  + D     E  +K  E 
Sbjct: 59  LFPEKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSKTFEL 118

Query: 111 PVHKLDDG-TLFICVREDFLHVPPISINLLSREI-AKLCGGL---EVLLFGSSDRVERVK 165
               +  G TL I V+E+FL   PI +N +++ +  KL  G    EV++ G+SD++  +K
Sbjct: 119 CAPIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELK 178

Query: 166 YVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETM 225
            V            L PPE +T+F  +++TQL+   + F G +APSEGP G+EKL++ TM
Sbjct: 179 PVSDKETT------LNPPEFVTSFVGAVITQLIEKSLPFQGLIAPSEGPVGFEKLNLVTM 232

Query: 226 DLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           + LI LC   V   N+E Y   C+R WRL+G  +GAQ+GLY+
Sbjct: 233 EELITLCHQWVD-SNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  162 bits (409), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 149/277 (53%), Gaps = 35/277 (12%)

Query: 1   MLFKQWNEYSEPRHHLD--APLEEN-TDLDSLQPAPLPEVMLEKPI-DTAGFKRAFIVTN 56
           MLFKQW+E++EPRHH+D  A +  N  + DSLQ APLP V +   + D   +++  + T 
Sbjct: 1   MLFKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATR 60

Query: 57  IFRSLFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVHKLD 116
           +   LF   +     + +  V         HL +                    P++K +
Sbjct: 61  VLMPLFPKEILNFTSLGNIEVKLNVSEATAHLVKT-------------------PIYKCN 101

Query: 117 DGTLFICVREDFLHVPPISINLLSREIAKLCGG-LEVLLFGSSDRVERVKYVGFPGNVGK 175
           + TL I V E+ + V PI +N++S+ I  + G  L+ L+FG+SDR+ ++K +        
Sbjct: 102 ERTLIIIVDENVMQVCPIFLNVISKTICTMFGNQLKFLIFGTSDRISKIKTINHLNCT-- 159

Query: 176 GLPLLTPPELITNFTASIMTQL-LSNKVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWS 234
               L PPE IT F  SI++ L L+   +F+G++ PSEGP G+EKL++ETM+ LI     
Sbjct: 160 ----LIPPEFITGFIGSIISDLSLTANSKFNGFLVPSEGPLGFEKLTLETMEFLIKEGGR 215

Query: 235 EVRFG----NREDYVKSCHRNWRLNGTVMGAQTGLYL 267
            V+      N E Y K C+RNWRL GT +G Q+GLY+
Sbjct: 216 IVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  159 bits (403), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 148/281 (52%), Gaps = 23/281 (8%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWNE +EPRHHLD+PL    D +SLQ   LP V L   I+   F + F+ T I   
Sbjct: 1   MLFKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELPN-INWNKFHKIFLTTGIMDP 59

Query: 61  LFEDRLARAEQISSFVVVWQTKGREQHL-------YREDYQTQED---SRSTDETKRLEF 110
           LF   L    ++            +QH        + E++  + +    +  D+ + L F
Sbjct: 60  LFPKELLGVMKLGDIRTTLTIDRNQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSLTF 119

Query: 111 --PVHKLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGL--EVLLFGSSDRVERVKY 166
              V    D  L + V+E+FL V PI  N +++ +  +  G   E+ + G+SDR+  +K 
Sbjct: 120 VTTVEAFGD-CLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITELK- 177

Query: 167 VGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMD 226
                ++      L PPE +T F  SI+TQL    + F+G++APSEG  G+EK+SM TM 
Sbjct: 178 -----SISHLRSDLQPPEFVTGFIGSILTQLTVKNIPFEGFIAPSEGAIGFEKMSMNTMP 232

Query: 227 LLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
            LID+C   +  GN E Y   C+R+WRL+   +G+ +GLY+
Sbjct: 233 ELIDICGQWIN-GNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  157 bits (397), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 153/287 (53%), Gaps = 28/287 (9%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRA----FIVTN 56
           MLFK WNE+ EPRHHLDAP+    + +SLQ  PLP V +    D    +       I+  
Sbjct: 1   MLFKHWNEFVEPRHHLDAPVMV-PNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNP 59

Query: 57  IFRSLFEDRLARAEQISSF-----VVVWQTKGREQHL-YREDYQTQ----EDSRSTDETK 106
           +F +     + R E ++S      VV        QH  YRE++  +     D+R   ++ 
Sbjct: 60  LFNTSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPASDTREDTKSI 119

Query: 107 RLEFPVHKLDD-GTLFICVREDFLHVPPISINLLSREIAKLCGG-LEVLLFGSSDRVERV 164
            L  P+ +L+   TL I V E+FL V PI  N+++R++  L     ++LL GSSD++   
Sbjct: 120 VLRLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRTLLNTQTKILLVGSSDKIYST 179

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKV-RFDGYVAPSEGPSGYEKLSME 223
           K V            L PPE IT F   ++ +L+ N+   F G++  SEGP+G+EKLS+E
Sbjct: 180 KMVSLNECT------LQPPEFITGFLGGMIDELVKNRFSNFKGFIVQSEGPTGFEKLSLE 233

Query: 224 TMDLLIDLC---WSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           +MD LID     WS     N + + ++CH+ W+L+G  M AQ+GLY+
Sbjct: 234 SMDELIDFIIDEWSSYNI-NADAFRENCHKLWKLDGAAMSAQSGLYI 279

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  155 bits (393), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 154/291 (52%), Gaps = 34/291 (11%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWNE+ EPRH LD P+    D +SLQ +P+P+V+    I    +++  I T +   
Sbjct: 1   MLFKQWNEFIEPRHQLDFPILSKND-ESLQASPIPKVLFPS-IAFQNYEKIIITTQLMNP 58

Query: 61  LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQT--------------QEDSRSTDETK 106
           LF ++L  ++ +   +    T   +Q+   ED  +               ED  +  +  
Sbjct: 59  LFPEKLIESKNLGK-IETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAF 117

Query: 107 RLEFPVHKLDDGTLFICVREDFLHVPPISINLLSRE-IAKLCGGLEVLLFGSSDRVERVK 165
             EFPV  +    + I ++++FL + PI  N++S++ I +L   ++ L+ GSSDR+  VK
Sbjct: 118 NFEFPVFAVG-KVVIISIQDNFLKISPIFSNIISKKLIEQLPRTIKPLILGSSDRIASVK 176

Query: 166 YVGFPGNVGKGLPLLTPPELITNFTASIMTQLL---------SNKVRFDGYVAPSEGPSG 216
                  +      L PPE IT F AS++T+L           NK +FD  + PSEGP G
Sbjct: 177 ------EINDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENKFQFDAILVPSEGPLG 230

Query: 217 YEKLSMETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           +EKL++  +  LIDL   E    + + Y +  +RNW+L G+V+GAQ+GLY+
Sbjct: 231 FEKLNLTVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  154 bits (390), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/281 (36%), Positives = 154/281 (54%), Gaps = 23/281 (8%)

Query: 1   MLFKQWNEYSEPRHHLDAP-LEENTDLDSLQPAPLPEVMLEKPIDTAG-FKRAFIVTNIF 58
           MLFKQWNE SEPR+HLDAP L  NT  +SLQ  PLP+V +   +   G  KR  + T   
Sbjct: 1   MLFKQWNELSEPRNHLDAPNLVNNT--ESLQLLPLPDVHIPDELFEGGNVKRVILTTKTM 58

Query: 59  RSLF-EDRLARAEQISSFVVVWQT-KGREQHLYREDYQTQEDSRS-----TDETKR---L 108
            + F  D+  + ++++      +  K  + H     +   E+  +      DE +R   L
Sbjct: 59  DTFFLLDKTMKVKKLADITCSLEIPKNLQTHEATHTWDFGENFPNEVEPLQDEEQRTFSL 118

Query: 109 EFPVHKLDDGTLFICVREDFLHVPPISINLLSREIA-KLCGGLEVLLFGSSDRVERVKYV 167
            FP++ L+D TL++ + E+FL V PI    +S  I+ KL  G E+++ G SDR+E  K +
Sbjct: 119 RFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRGHEIVILGCSDRIEDTK-I 177

Query: 168 GFPGNVGKGLPLLTPPELITNFTASIMTQLL-SNKVRFDGYVAPSEGPSGYEKLSMETMD 226
               N       L PPE +T F  S+M+ L  +N   F   + PSEGP G+EKLS  T+D
Sbjct: 178 CTNNNCS-----LVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSEGPQGFEKLSSTTVD 232

Query: 227 LLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
            +ID C S++   ++  Y + C++ W+ N +  GAQ+GLYL
Sbjct: 233 SIIDFC-SQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  152 bits (384), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 145/285 (50%), Gaps = 27/285 (9%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWN+  EP+H LD P E + +L SL+  P+P+V   + +D   +  A I T I   
Sbjct: 1   MLFKQWNDLPEPKHLLDLP-EISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNP 59

Query: 61  LFEDRLARAEQISSFVVVW--------QTKGREQHLYREDYQTQEDSRSTDETKR----- 107
           LF   L +   I               Q+ G+    Y E++  + D    ++T       
Sbjct: 60  LFPKNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYG 119

Query: 108 LEFPVHKLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGL--EVLLFGSSDRVERVK 165
             FP++     TL   + E+F+ + PI  N++SR I         ++++ G+SD++  +K
Sbjct: 120 FSFPIYSFGK-TLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMK 178

Query: 166 YVGFPGNVGKGLPLLTPPELITNFTASIMTQLL---SNKVRFDGYVAPSEGPSGYEKLSM 222
            +       +    L PPE IT F  S++TQL+   S  ++F   VAPSEGP+G+EKLS+
Sbjct: 179 VMT------ENECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSL 232

Query: 223 ETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
             M  L+DLC   + F     Y + C+R WR +   +GAQ+GLY+
Sbjct: 233 SDMGSLVDLCGQWLGF-EPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  152 bits (383), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 149/284 (52%), Gaps = 27/284 (9%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWNE+  PRH LD+P+    D DSLQ   LPEV + +  D + +K   + T I   
Sbjct: 1   MLFKQWNEFVAPRHELDSPIIARND-DSLQLLSLPEVHMPET-DLSKYKNVVLTTKIMDP 58

Query: 61  LFEDRLARAEQISSFVVVWQTKGR------EQHL--YREDYQTQEDSRSTDETKRL---E 109
           LF  +L  AE+I+      +          E H   Y E++  +   +     +RL    
Sbjct: 59  LFPSKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRDSNNRRLLSFS 118

Query: 110 FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGG---LEVLLFGSSDRVERV 164
            P+    D T+ I + E+F+ +  I  N+++ ++    L  G   L  +  G+SDR+  +
Sbjct: 119 SPIFAFKD-TIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRILNI 177

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVR-FDGYVAPSEGPSGYEKLSME 223
           K       + +    L PPE +T F  SI+TQL+S +V  F G +APSEGP G+EK++++
Sbjct: 178 K------KLTQDHCSLEPPEFVTGFIGSILTQLISKEVNVFTGILAPSEGPIGFEKMTLD 231

Query: 224 TMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
            +  LID+C   +   + E Y   C R WRL+G  +GAQ+GLY+
Sbjct: 232 VIKELIDICQELLDIKSTE-YSVDCQRMWRLDGAAIGAQSGLYI 274

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  151 bits (382), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 157/288 (54%), Gaps = 30/288 (10%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWNE  EPRH LD+P+    + +SLQ +PLP+V +   ++ + +K+  + T +   
Sbjct: 1   MLFKQWNELVEPRHQLDSPVILKNE-ESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNP 59

Query: 61  LFEDRLARAE---QISSFVVVWQTK--GREQHLYREDYQTQ--------EDSRSTDETKR 107
           LF   L + E    I + +++ ++K    EQ+ Y  D+            +S + +    
Sbjct: 60  LFPKNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGNNNFS 119

Query: 108 LEFPVHKLDD-GTLFICVREDFLHVPPISINLLSREIAKLCGG--LEVLLFGSSDRV-ER 163
            +FP++++    TL I + E+FL V PI +NL+S+++          +LL G+SD++   
Sbjct: 120 FKFPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNN 179

Query: 164 VKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLS-NKVRFDGYVAPSEGPSGYEKLSM 222
           +K V       K    + PPE IT F  S++ +LL      F+  + PSEGP G+EKLS+
Sbjct: 180 IKTV-----TNKNCS-INPPEFITGFIGSLLYELLEIGTDNFECIIVPSEGPIGFEKLSL 233

Query: 223 ETMDLLIDLCWSEVRFGNRED---YVKSCHRNWRLNGTVMGAQTGLYL 267
            TM+ LI+  + E+  G++ D   Y   CHRNW+L G+    Q+GLY+
Sbjct: 234 STMEELINQFFHEL--GSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  151 bits (381), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 148/283 (52%), Gaps = 27/283 (9%)

Query: 3   FKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLF 62
           FKQWN+  EPRH LD P E + +L SL+  P+P V L + ++ + +    I T I   LF
Sbjct: 1   FKQWNDLPEPRHQLDFP-EISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLF 59

Query: 63  EDRLARAEQI----SSFVVVWQTKGREQHLYR----EDYQTQEDSRSTDETKR-----LE 109
              L +   I    SS  V   +  +    Y     E++  + D  S  ET +       
Sbjct: 60  PKNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFS 119

Query: 110 FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGGLEVLLFGSSDRVERVKYV 167
           FP++   + TL   + E+F+++ PI  N++SR I    +    ++++ GSSDR+  +K  
Sbjct: 120 FPIYSFGE-TLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMK-- 176

Query: 168 GFPGNVGKGLPLLTPPELITNFTASIMTQLL--SNK-VRFDGYVAPSEGPSGYEKLSMET 224
                + K    L PPE IT F  S++TQL+   NK + F   + PSEGP+G+EK+S+  
Sbjct: 177 ----KMTKSECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSD 232

Query: 225 MDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           M  LID+C   + F +   Y + C+R WR +   +GAQ+GLY+
Sbjct: 233 MGSLIDVCSQWLGF-DHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  149 bits (377), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 150/283 (53%), Gaps = 27/283 (9%)

Query: 3   FKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLF 62
           FKQWNE  EPRH LD P E + +L SL+  P+P+V L + +D + +    I T I   LF
Sbjct: 1   FKQWNEIPEPRHLLDFP-EISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLF 59

Query: 63  EDRLARAEQI----SSFVVV----WQTKGREQHLYREDYQTQED----SRSTDETKR-LE 109
              L +   +    ++  VV     Q+ G     + E++  + D       +DETK    
Sbjct: 60  PKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFS 119

Query: 110 FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGGLEVLLFGSSDRVERVKYV 167
           FP++     TL   + E+FL + PI  N++SR I    +    E+++ G+SD++  +K +
Sbjct: 120 FPIYSFGK-TLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVM 178

Query: 168 GFPGNVGKGLPLLTPPELITNFTASIMTQLLS--NK-VRFDGYVAPSEGPSGYEKLSMET 224
                  K    L PPE IT F  S++TQL+   NK ++F   V PSEGP+GYEKLS+  
Sbjct: 179 T------KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSD 232

Query: 225 MDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           M  L+ LC   + F +   Y + C+R WR +   +GAQ+GLY+
Sbjct: 233 MGSLVSLCGQWLGF-DHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  149 bits (376), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 149/287 (51%), Gaps = 34/287 (11%)

Query: 3   FKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLF 62
           FKQWN+  EPRH LD P E + +L SL+  P+P+V L + +D + + R  I T I   LF
Sbjct: 1   FKQWNDLPEPRHQLDFP-EISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLF 59

Query: 63  EDRLARAEQISSFVVVWQTK------GREQHL--YREDYQTQEDSRSTDETKRLE----- 109
              L +   I         K        + H   Y E++  + +  S   T   E     
Sbjct: 60  PKNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNF 119

Query: 110 -FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGGLEVLLFGSSDRVERVKY 166
            FP++     TL   + E+F+++ PI  N++SR IA   +    +V++ G+SDR+  +K 
Sbjct: 120 SFPIYSFGK-TLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKI 178

Query: 167 VGFPGNVGKGLPLLTPPELITNFTASIMTQLLS--NK-VRFDGYVAPSEGPSGYEKLSME 223
           +       +    L PPE +T F  S++TQL++  NK ++F   V PSEGP+G+EK S+ 
Sbjct: 179 MT------EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLS 232

Query: 224 TMDLLIDLC--WSEVRFG-NREDYVKSCHRNWRLNGTVMGAQTGLYL 267
            M  LID+C  W    FG +   Y + CHR WR +   +GAQ+GLY+
Sbjct: 233 DMGSLIDVCSQW----FGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  146 bits (369), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 96/291 (32%), Positives = 157/291 (53%), Gaps = 33/291 (11%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           MLFKQWN+ +EPRH L +P   +T+++SLQ   +PEV +   +    F+   + T    +
Sbjct: 1   MLFKQWNDLAEPRHQLMSP-SLSTNIESLQLQNIPEVSMTN-LKYEDFENVIVTTKTMNA 58

Query: 61  LFEDR---LARAEQISSFVVVWQTKG--REQHL---YREDYQTQEDSRS---------TD 103
           LF ++   L +  ++SS +V+ + +     +H    Y+E++  + D  S         ++
Sbjct: 59  LFPNKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSN 118

Query: 104 ETKRLEFPVHKLD-DGTLFICVREDFLHVPPISINLLSREIAKLC-----GGLEVLLFGS 157
           E+K+  F +  +  D TL I + E+F+ + PI  NL + +I K+        + +L  G+
Sbjct: 119 ESKKYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGT 178

Query: 158 SDRVERVKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKV-RFDGYVAPSEGPSG 216
           SDRV  ++ +  P N       L  PE IT F  S ++QL+  +V  +   + PSEGP G
Sbjct: 179 SDRVAAIRKLT-PEN-----STLVAPEFITGFVGSFISQLVILEVPNYKAVIVPSEGPIG 232

Query: 217 YEKLSMETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           +EKLS+ET+  LID+C   +   N   Y    HR W++ G+ MGAQTGLY+
Sbjct: 233 FEKLSIETISELIDICKENLNI-NDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  119 bits (298), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 116/197 (58%), Gaps = 17/197 (8%)

Query: 81  TKGREQHLYREDYQTQ-----EDSRSTDETKRLEFPVHKLDDGTLFICVREDFLHVPPIS 135
            +G+    Y E++  +     +D +S++++    FP+  +D  TL I ++E+FL + PI 
Sbjct: 32  NEGKHSWNYNENFPNEFDPSDKDMKSSEKSYDFNFPIFAIDR-TLVISIQENFLKISPIF 90

Query: 136 INLLSREIAK-LCGGLEVLLFGSSDRVERVKYVGFPGNVGKGLPLLTPPELITNFTASIM 194
            N++S+ + + L    E+L+ G+SDRV  ++       +   +  L PPE +T F  S++
Sbjct: 91  SNVISQTLVQALPLNKEILILGTSDRVAVMR------KISNEIDTLEPPEFVTGFIGSLI 144

Query: 195 TQL-LSN-KVRFDGYVAPSEGPSGYEKLSMETMDLLIDLCWSEVRFGNRED--YVKSCHR 250
           T+L L N K  FD  + PSEGP+G+EKL++  M  LID+  +E  + N +   Y + C+R
Sbjct: 145 TELNLHNAKYNFDAIIVPSEGPTGFEKLNLTIMQDLIDIFKNEWNYLNIDSKVYTEQCYR 204

Query: 251 NWRLNGTVMGAQTGLYL 267
           +W+L G  +GAQ+GLY+
Sbjct: 205 HWKLAGAAIGAQSGLYI 221

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score =  112 bits (280), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 137/277 (49%), Gaps = 26/277 (9%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRS 60
           M+FKQW     PRH + +    + D  SL  +P P + L+  I+  G+++A  + +    
Sbjct: 1   MIFKQWEFDRIPRHQVQSI--NSADPTSLLLSPEPVITLDNDINK-GYEKAIALPSSLTW 57

Query: 61  LFEDRLARAEQISSFVVVWQTKGREQHLYREDYQT----QEDSRSTDETKRLEFPVHKLD 116
           L    L   +QIS    V +       +  ED  T    + D + + +  R  +P+++LD
Sbjct: 58  LLPADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFYEVDVKPSTKEVRASYPIYELD 117

Query: 117 DGTLFICVREDFLHVPPISINLLSREIAKL--CGGLEVLLFGSSDRVERVKYVGFPGNVG 174
           D TL + ++ED L  PPI  N L+  +AK+      +V L  +SD++     +GF     
Sbjct: 118 DHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKI-----IGF----- 167

Query: 175 KGLPLLTPPELITNFTASIMTQL----LSNKVRFDGYVAPSEGPSGYEKLSMETMDLLID 230
           K L  L PPE I    A+I+T L     S + + +  V  SEGP GYE  ++  +DLL++
Sbjct: 168 KSLSELQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITVVDLLVE 227

Query: 231 LCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
              S    G  E+YV S +R W+ N +    Q+GLYL
Sbjct: 228 YMKS--TLGYSEEYVTSAYRRWKSN-SASQFQSGLYL 261

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 125/280 (44%), Gaps = 36/280 (12%)

Query: 1   MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLE-KPIDTAGFKRAFIVTNIFR 59
           + FKQW     PRH +D  ++  +D  SL     P V +E + +D + +    ++    +
Sbjct: 2   LTFKQWQNDQVPRHQIDPVVQ--SDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLK 59

Query: 60  SLFEDRLARAEQIS------SFVVVWQTKGREQHLYREDYQTQEDSRSTDETKRLEFPVH 113
            L    +     I       S +  W++      +Y     T+E   ++ E   + + + 
Sbjct: 60  WLLPKSIINLVHIGIISGTLSNMNEWESMKPVPGMY----DTEEHMINSTEQFVIHYNLW 115

Query: 114 KLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGL-EVLLFGSSDRVERVKYVGFPGN 172
           +L+D TL   + E+ +  P I  N ++R +A+L   + ++ +  +SD++  +K + +   
Sbjct: 116 RLED-TLIAIIDENEVKYPAIVTNFMTRNLAQLLRDIKDITILVNSDKITELKQLSY--- 171

Query: 173 VGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMETMDLLID-- 230
                  L PPE IT    + +  L   +++    V PSEGP G+EK +  T+D L+D  
Sbjct: 172 -------LVPPEFITGSITNFILALPRKELKV--IVVPSEGPIGFEKYNFPTVDALVDEM 222

Query: 231 ---LCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
              LC         E YV  C + W+L+      Q GLY+
Sbjct: 223 SKLLCSYP---SQTEYYVSECLKLWKLDECT-TTQGGLYI 258

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 100/228 (43%), Gaps = 25/228 (10%)

Query: 48  FKRAFIVTNIFRSLFEDRLARAEQISSFV-VVWQTKGRE--QHLYREDYQTQEDSRSTDE 104
           +  A +V +    L    + +   ++  V  + Q  G E    L   D   + D    + 
Sbjct: 24  YSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGGECATRLVAADQFYEADVPQAER 83

Query: 105 TKRLEFPVHKLDDGTLFICVREDFLHVPPISINLLSREIAKL--CGGLEVLLFGSSDRVE 162
             R+ + +++   G L + V E+ L  PPI  N L++++A+     G E  +  +SD+  
Sbjct: 84  HVRVAYQLYERGPGQLVVVVEENDLKYPPIVHNRLAQQLAEKLRAVGAETTVLVNSDKST 143

Query: 163 RVKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLL-SNKVRFDGYVAPSEGPSGYEKLS 221
            VK           L  L PPE IT   A+++  L  S   R    V  SEGP G+EK +
Sbjct: 144 GVK----------DLEELVPPEFITGALAALVCALAPSGAGRV--LVVQSEGPHGFEKHN 191

Query: 222 METMDLLIDLCWSEVR--FGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267
           +  +D L++     VR       +YV +C R+W+L       Q GLYL
Sbjct: 192 LTVVDALVE----RVRQILDQPPEYVAACTRHWKLQAGSQ-FQGGLYL 234

>NCAS0E03530 Chr5 (699391..701547) [2157 bp, 718 aa] {ON} Anc_7.283
           YDL176W
          Length = 718

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 70/165 (42%), Gaps = 33/165 (20%)

Query: 17  DAPLE------ENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLFEDRLARAE 70
           DAP+       E+T L ++ P  L    L   IDT  FKRA +   +F+ LF        
Sbjct: 522 DAPVSRFNYSGEDTKLSTIHPPDL----LTTNIDTLSFKRAIMNLKVFQKLF-------- 569

Query: 71  QISSFVVVWQTKGREQHLYREDYQTQEDSRSTDETKR-LEFPVHK---LDDGTLFIC--- 123
            IS  + +  T G    L R D+  ++     D   R ++  ++K   ++DG + +    
Sbjct: 570 IISDTLCMVITSGGVLLLDRHDFNDKKHLVGKDNNYRSVKIALYKIGFINDGLVLVSYFQ 629

Query: 124 ---VREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDRVERVK 165
              +  D++ +  + I  ++ +I  L G      FG   R+  +K
Sbjct: 630 QNLLANDYILIFTLVITTITNDIIVLKGS-----FGLGKRIGTIK 669

>CAGL0F01881g Chr6 (186169..186711) [543 bp, 180 aa] {ON} no
           similarity
          Length = 180

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 10/17 (58%), Positives = 15/17 (88%)

Query: 172 NVGKGLPLLTPPELITN 188
           N+G GL L+TPP+++TN
Sbjct: 39  NIGDGLQLMTPPDVVTN 55

>KLLA0E10561g Chr5 (932415..933986) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|P32316 Saccharomyces cerevisiae
           YBL015W ACH1 Acetyl-coA hydrolase primarily localized to
           mitochondria required for acetate utilization and for
           diploid pseudohyphal growth
          Length = 523

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P   P  LI +    +    L  K+RF+ +V  S GP
Sbjct: 34  QYIGWSGFTGVGAPKAVPEALIKH----VEENNLQGKLRFNLFVGASAGP 79

>KAFR0C02850 Chr3 (561545..563125) [1581 bp, 526 aa] {ON} Anc_8.161
           YBL015W
          Length = 526

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSMET 224
           +Y+G+ G  G G P   P  +I++    +    L  K+RF+ +V  S GP   E+ +   
Sbjct: 34  QYLGWSGFTGVGTPKAVPQAIISH----VEKNNLQGKLRFNLFVGASAGP---EEEAWAN 86

Query: 225 MDLLIDLCWSEV 236
            D++I     +V
Sbjct: 87  HDMIIKRAPHQV 98

>Suva_2.107 Chr2 (188609..190189) [1581 bp, 526 aa] {ON} YBL015W
           (REAL)
          Length = 526

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P   P  LI +    +    L  K+RF+ +V  S GP
Sbjct: 34  QYLGWSGFTGVGTPKAVPEALIDH----VEKNNLQGKLRFNLFVGASAGP 79

>YBL015W Chr2 (194122..195702) [1581 bp, 526 aa] {ON}  ACH1Protein
           with CoA transferase activity, particularly for CoASH
           transfer from succinyl-CoA to acetate; has minor
           acetyl-CoA-hydrolase activity; phosphorylated; required
           for acetate utilization and for diploid pseudohyphal
           growth
          Length = 526

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P   P  LI +    +    L  K+RF+ +V  S GP
Sbjct: 34  QYLGWSGFTGVGTPKAVPEALIDH----VEKNNLQGKLRFNLFVGASAGP 79

>Skud_2.91 Chr2 (177817..179397) [1581 bp, 526 aa] {ON} YBL015W
           (REAL)
          Length = 526

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P   P  LI +    +    L  K+RF+ +V  S GP
Sbjct: 34  QYLGWSGFTGVGTPKAVPEALIDH----VEKNNLQGKLRFNLFVGASAGP 79

>Smik_2.102 Chr2 (187680..189260) [1581 bp, 526 aa] {ON} YBL015W
           (REAL)
          Length = 526

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P   P  LI +    +    L  K+RF+ +V  S GP
Sbjct: 34  QYLGWSGFTGVGTPKAVPEALIDH----VEKNNLQGKLRFNLFVGASAGP 79

>TBLA0E03560 Chr5 (890420..891994) [1575 bp, 524 aa] {ON} Anc_8.161
           YBL015W
          Length = 524

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P + P  L  +    +    L  K+RF+ +V  S GP
Sbjct: 32  QYIGWSGFTGVGAPKVIPETLANH----VQENNLQGKLRFNLFVGASAGP 77

>CAGL0J04268g Chr10 complement(399703..401283) [1581 bp, 526 aa]
           {ON} highly similar to uniprot|P32316 Saccharomyces
           cerevisiae YBL015w ACH1 acetyl-CoA hydrolase
          Length = 526

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 165 KYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGP 214
           +Y+G+ G  G G P   P  LI +    +    L  K+RF+ +V  S GP
Sbjct: 34  QYLGWSGFTGVGTPKAVPDALIKH----VEDNNLQGKLRFNLFVGASAGP 79

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,332,454
Number of extensions: 1252531
Number of successful extensions: 3094
Number of sequences better than 10.0: 33
Number of HSP's gapped: 3099
Number of HSP's successfully gapped: 33
Length of query: 267
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 159
Effective length of database: 41,097,471
Effective search space: 6534497889
Effective search space used: 6534497889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)