Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G15444g6.65ON26326311781e-165
Kwal_56.232426.65ON2562648351e-113
SAKL0A08426g6.65ON2991736141e-78
CAGL0L04620g6.65ON2641665651e-71
AGR270W6.65ON2941725653e-71
Smik_15.3526.65ON2881665531e-69
Suva_8.2276.65ON2871655531e-69
ZYRO0D14190g6.65ON2951635522e-69
Kpol_1042.116.65ON2921655462e-68
TBLA0G005506.65ON3181825431e-67
NCAS0F003306.65ON2811945391e-67
YOR174W (MED4)6.65ON2841655349e-67
Skud_15.3366.65ON2861665322e-66
KNAG0M010206.65ON2791915043e-62
NDAI0J013206.65ON3341705066e-62
KLLA0F20185g6.65ON2851694982e-61
TPHA0F025906.65ON3061634985e-61
Ecym_31246.65ON2741654921e-60
KAFR0G025006.65ON2892494922e-60
TDEL0G040606.65ON2201584393e-53
NCAS0B029708.409ON15492820.031
KAFR0I004804.313ON55376711.5
ABR002C2.509ON234140682.7
SAKL0C02222g1.66ON1153126684.5
NDAI0K020502.509ON237112665.6
SAKL0A08822g2.509ON229112656.7
Kpol_1024.188.384ON83454667.8
NCAS0A049902.509ON233112648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G15444g
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   458   e-165
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   326   e-113
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   241   1e-78
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   222   1e-71
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   222   3e-71
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   217   1e-69
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   217   1e-69
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   217   2e-69
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   214   2e-68
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   213   1e-67
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   212   1e-67
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   210   9e-67
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   209   2e-66
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   198   3e-62
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   199   6e-62
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   196   2e-61
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   196   5e-61
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   194   1e-60
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   194   2e-60
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   173   3e-53
NCAS0B02970 Chr2 complement(513418..513882) [465 bp, 154 aa] {ON...    36   0.031
KAFR0I00480 Chr9 (100612..102273) [1662 bp, 553 aa] {ON} Anc_4.3...    32   1.5  
ABR002C Chr2 complement(400235..400879,400946..401005) [705 bp, ...    31   2.7  
SAKL0C02222g Chr3 (197312..200773) [3462 bp, 1153 aa] {ON} weakl...    31   4.5  
NDAI0K02050 Chr11 complement(460673..461386) [714 bp, 237 aa] {O...    30   5.6  
SAKL0A08822g Chr1 (774870..774929,775006..775227,775290..775697)...    30   6.7  
Kpol_1024.18 s1024 (60564..63068) [2505 bp, 834 aa] {ON} (60564....    30   7.8  
NCAS0A04990 Chr1 complement(993133..993834) [702 bp, 233 aa] {ON...    29   8.5  

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  458 bits (1178), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/263 (85%), Positives = 225/263 (85%)

Query: 1   MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE 60
           MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE
Sbjct: 1   MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE 60

Query: 61  ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE 120
           ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE
Sbjct: 61  ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE 120

Query: 121 FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI 180
           FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI
Sbjct: 121 FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI 180

Query: 181 ASLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTDIRSPDTKEEPVARRPSFGFDGSGAK 240
           ASLR                            QTDIRSPDTKEEPVARRPSFGFDGSGAK
Sbjct: 181 ASLRASEGANAQEQQASSEQKTSEKSSENEEAQTDIRSPDTKEEPVARRPSFGFDGSGAK 240

Query: 241 DHESEKAXXXXXXXXXXFNSEEF 263
           DHESEKA          FNSEEF
Sbjct: 241 DHESEKADDDIDLDLDLFNSEEF 263

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  326 bits (835), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/264 (62%), Positives = 193/264 (73%), Gaps = 9/264 (3%)

Query: 1   MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE 60
           MSTS+ H+NP  +R  + E+ LSK Q+Y+DICEFE+TLGKLVASVD+FNPDL++A +LIE
Sbjct: 1   MSTSSVHKNPEVERPTNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIE 60

Query: 61  ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE 120
            DK+L K+LE LP+YDEID RAK LD++H +TDE+ +RILETLTEC +DLNALPMLEQVE
Sbjct: 61  VDKRLSKTLESLPRYDEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVE 120

Query: 121 FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI 180
           FER+TMLKQREKVFT+VLLDYAMKLAKFTHVPPTFDKG VGPNNFVWPAEDAMRRGMLAI
Sbjct: 121 FERQTMLKQREKVFTNVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAI 180

Query: 181 ASLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTDIRSPDTK-EEPVARRPSFGFDGSGA 239
           ASL+                                 SP  K EEP+ RR SF F+G+G 
Sbjct: 181 ASLQASEDAKKPETGAAQTAEETTKQPQS--------SPQLKVEEPMQRRDSFEFNGTGT 232

Query: 240 KDHESEKAXXXXXXXXXXFNSEEF 263
           K  ESEKA          FNS+E 
Sbjct: 233 KSPESEKADDDIDLDLDLFNSDEL 256

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  241 bits (614), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 144/173 (83%)

Query: 12  PDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLEC 71
           P + D  ++ LS+++VY DICE+E+TLGKLV+SVD+F PDL++A+ LIE DK+L+K+LE 
Sbjct: 34  PHQHDQDQDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEE 93

Query: 72  LPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQRE 131
            PKYD+ID R   L+++ ++ D+KT +ILE L  C + LN+LP LEQV  ER+TMLKQRE
Sbjct: 94  FPKYDKIDGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQRE 153

Query: 132 KVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           K+++ VLLDYAMKLAKFT VPPTFDKG VGPNNF+WPAEDAMRRGMLA+ASL+
Sbjct: 154 KIYSGVLLDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLK 206

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  222 bits (565), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 101/166 (60%), Positives = 133/166 (80%)

Query: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78
           E  L K+Q+Y+D+C +E+ L KLV SVD F P LE+ + LIEADK+LY +L+ LP+YD +
Sbjct: 14  EQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSV 73

Query: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138
            TR +TLD+E    D++T  IL  L EC  DLNALP+LE+VEFE++ +LKQREK+ ++VL
Sbjct: 74  FTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVL 133

Query: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           L+YA KLAKFT +PPTFDKGT+GPNNF+WPAEDA+R+GMLA+ASL 
Sbjct: 134 LEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLH 179

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  222 bits (565), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 135/172 (78%)

Query: 13  DRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECL 72
           D S   +N L  + +Y D+C++E++L +LV SVD+F PDLE A+ LIE D +LY +L  L
Sbjct: 38  DASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQL 97

Query: 73  PKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREK 132
           PKYD ID++ K L+EE +D DE+T +IL  L EC +DLN+LPM+EQVEFE  TM KQ++K
Sbjct: 98  PKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDK 157

Query: 133 VFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           V + VLL+YAMKL+KFT VPPTF+K  +GPNNF+WPAEDA+RRGMLA+ASL+
Sbjct: 158 VNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLK 209

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  217 bits (553), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 131/166 (78%)

Query: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78
           E+ LSK+Q+Y D+C +EDTL KLV SVDRF PD+++AR LI+ D+ L+ +++ L +YD I
Sbjct: 34  EDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNI 93

Query: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138
           D   + +D++  + D KT RILE + EC  +L ALPMLEQVEFE+ T+L+QR K+ +  L
Sbjct: 94  DRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTAL 153

Query: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           LDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA+RRGMLA+ASL 
Sbjct: 154 LDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLH 199

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  217 bits (553), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 132/165 (80%)

Query: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78
           E+  SK+Q+Y D+C +ED LGKLV SVDRF P+LE+A+ LI+ D+ L+ +++ L  YD+I
Sbjct: 34  EHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKI 93

Query: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138
           D   + +D++  + D KT +ILE L EC  +L+ALPMLEQVEFE++T+L+QR K+ +  L
Sbjct: 94  DLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTAL 153

Query: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASL 183
           LDYA KL+KFT +PPTFDKGTVGPNNF+WPAEDA+RRGMLA+ASL
Sbjct: 154 LDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASL 198

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  217 bits (552), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%)

Query: 22  LSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTR 81
           LSK+Q+Y D+ ++E+ L  LV SVD F PD+++   LIE DK LYKSL+   +YD ID+ 
Sbjct: 43  LSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSE 102

Query: 82  AKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDY 141
              LD+E  + D KT  +LETL+EC   LN LPMLEQVEFE++++LKQR KV + VLL+Y
Sbjct: 103 LNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNY 162

Query: 142 AMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           A KL+KFT +PPTFDKGT+GPNNFVWPAEDA+RRGMLAIASL 
Sbjct: 163 ATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLH 205

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  214 bits (546), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 132/165 (80%)

Query: 20  NPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEID 79
           N LSK+Q+YNDI E+E+TL KLV SVD+F PD++LA  LI+ D++L+KSL+   +YD+I 
Sbjct: 40  NDLSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKIS 99

Query: 80  TRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLL 139
           T+ +  D+E  + D KT  IL TL EC   LN+LPMLEQVEFE++ +LKQR K+ + +LL
Sbjct: 100 TKLEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLL 159

Query: 140 DYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           DYA KL+KFT +PPTF+KG++GPNNF+WPAEDA+RRGMLA+ASL 
Sbjct: 160 DYATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMASLH 204

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  213 bits (543), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 137/182 (75%), Gaps = 1/182 (0%)

Query: 1   MSTSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIE 60
           +STS    +   D +D   + LSK+Q YND+ ++E+TL KL +SVD++ PDL+ A  LI+
Sbjct: 17  LSTSISEGDVLQDNNDK-NDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLID 75

Query: 61  ADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVE 120
            D++LY +L+   KYDEI T+ K L+ + +  DEKT  +L++L +C   LN LPMLEQVE
Sbjct: 76  IDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVE 135

Query: 121 FERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAI 180
           FE+ TMLKQREK+ + VLLDYA KLAKFT +PPTF+K T+GPNNF+WPAEDA+RRGMLA+
Sbjct: 136 FEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAV 195

Query: 181 AS 182
           AS
Sbjct: 196 AS 197

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  212 bits (539), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 102/194 (52%), Positives = 136/194 (70%), Gaps = 13/194 (6%)

Query: 2   STSTGH-----------RNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNP 50
           +TS GH            NP    +D  E+ +SK+Q+Y+D+C +E  L  LV SVD+F P
Sbjct: 12  TTSMGHIRSSSVSLLAEVNPNSISND--EDDISKVQIYSDLCSYEQKLANLVNSVDKFKP 69

Query: 51  DLELARALIEADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDL 110
           D+  AR LIE D+ L+++L+   +YD+ID   K L+ E  + D +T  IL  L EC  +L
Sbjct: 70  DMNAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDEL 129

Query: 111 NALPMLEQVEFERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAE 170
           NALPML+QVEFE ET+L+QR K+ + VLLDYA KL+KFT +PPTFDKG++GPNNF+WPAE
Sbjct: 130 NALPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAE 189

Query: 171 DAMRRGMLAIASLR 184
           DA+RRGMLA+ASL 
Sbjct: 190 DALRRGMLALASLH 203

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  210 bits (534), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 129/165 (78%)

Query: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78
           E+ LSK+Q+Y D+C +EDTL KLV SVDRF P+L++A+ LI  D+ L+++++ L +YD I
Sbjct: 34  EDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNI 93

Query: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138
               + +D++  + D KT +ILE L EC  +L ALPMLEQVEFE+ T+L+QR K+ +  L
Sbjct: 94  YRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTEL 153

Query: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASL 183
           LDYA KL+KFT +PPTFDKG VGPNNF+WPAEDA+RRGMLA+ASL
Sbjct: 154 LDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASL 198

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  209 bits (532), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 96/166 (57%), Positives = 127/166 (76%)

Query: 19  ENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEI 78
           E+ LSK+Q+Y D+C +E  L KLV SVDRF PDL++AR LI AD+ L+ +++ L  YD I
Sbjct: 34  EDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNI 93

Query: 79  DTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVL 138
           D   + +D++  + D K+ +ILE L EC  +L+ LP LEQVEFE+ T+L+QR K+ +  L
Sbjct: 94  DRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTAL 153

Query: 139 LDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           LDYA KL+KFT +PPTFDKGTVGPNNF+WPAEDA+RRGMLA+ASL 
Sbjct: 154 LDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLH 199

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  198 bits (504), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 134/191 (70%), Gaps = 9/191 (4%)

Query: 1   MSTSTGHRNP--------GPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDL 52
           ++ S GH+          G D +   E+ L K+++Y+ I E+EDTL  LV SVD + PD+
Sbjct: 12  LAVSAGHKRASSVSLLQEGTDAAALAED-LKKVRIYSGIVEYEDTLAALVESVDSYKPDM 70

Query: 53  ELARALIEADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNA 112
            +A+ L++ADK+L+ SL+   +YDEI TR   L  +    D KT  ILE L EC  +LN 
Sbjct: 71  AVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNK 130

Query: 113 LPMLEQVEFERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDA 172
           LP LEQV+FE +T+L+QREK+ +  LLDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA
Sbjct: 131 LPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDA 190

Query: 173 MRRGMLAIASL 183
           +R+GMLAIA+L
Sbjct: 191 LRKGMLAIAAL 201

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  199 bits (506), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 90/170 (52%), Positives = 126/170 (74%)

Query: 15  SDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPK 74
           +DS ++ LS++++Y+DI  +E  L +L+ SVD+F P+L +A+ LI+ADK L+ +L    +
Sbjct: 69  NDSSKDVLSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQ 128

Query: 75  YDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVF 134
           YDEID   K L+ +    DE T   L+TL EC  DLN LP L Q+EFE  T+L QR K+ 
Sbjct: 129 YDEIDLHLKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKIN 188

Query: 135 TDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           + +LLDYA KL+KFT +PPTFDKG++GPNNF+WPAED++RRGMLA+ASL+
Sbjct: 189 STILLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMASLK 238

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  196 bits (498), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 123/169 (72%)

Query: 16  DSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKY 75
           + V   L  + +Y D+  +E+T+ +L  SVD F PDL L   +IE DK+LY++LE   +Y
Sbjct: 26  EQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEY 85

Query: 76  DEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFT 135
            +I+     LD+E ++ D KT  ILETL  C + LN LPMLEQVEFE++ MLKQREK+ +
Sbjct: 86  YKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHS 145

Query: 136 DVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
            V+LDYAMKLAKFT  PPTFDK  +GPNNF+WPAED++R+GMLA+ASL+
Sbjct: 146 KVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLK 194

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  196 bits (498), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 126/163 (77%)

Query: 22  LSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTR 81
           L+ + +YNDI  +EDTL KLV+S+D F PD+E+A+ LIE DK+LYK+L    +YDEIDT+
Sbjct: 57  LANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTK 116

Query: 82  AKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDY 141
              + ++    D +T  IL+ L +  + LN+LPMLE++ FER+ M ++++K+ + +LLDY
Sbjct: 117 ISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDY 176

Query: 142 AMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           A K++KFT +PPTF+KG++GPNNF+WPAEDA+RRGMLA+AS+ 
Sbjct: 177 ATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVASIH 219

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  194 bits (492), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 130/165 (78%)

Query: 20  NPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEID 79
           N + ++ +Y D+C+FE+ L KLV SVD+F+PDL+ A+ LI +D +LY +LE LP YD ID
Sbjct: 20  NHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSID 79

Query: 80  TRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLL 139
            + K LD E ++ DE+T +IL  L +C ++LN LPM+EQVEFE + M KQ+EK+ + VLL
Sbjct: 80  IQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLL 139

Query: 140 DYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLR 184
           +YAMKLAKFT VPPTF+K  +GPNNF+WPAEDA+RRGMLA+ASL+
Sbjct: 140 EYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLK 184

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  194 bits (492), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 150/249 (60%), Gaps = 15/249 (6%)

Query: 2   STSTGHRNPGPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEA 61
           STS  + N   D +      ++K+ +Y+D+ ++E+TL +L+ S+D + PD ++A+ LI+ 
Sbjct: 22  STSITNSN-NIDSASGASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDI 80

Query: 62  DKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEF 121
           D +L+ SL+   +YD I +R K  +++ +++  KT  ILETL EC + LN LP ++QV F
Sbjct: 81  DSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHF 140

Query: 122 ERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIA 181
           E  TML+QR+K+ + VLLDYA KL+KFT +PPTFDKG++GPNNFVWPAEDA+RRGMLA+A
Sbjct: 141 EMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALA 200

Query: 182 SLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTDIRSPDTKEEPV-------ARRPSFGF 234
           +                                +I+S D  E P+       +RR S+ F
Sbjct: 201 ASHTDELTKIAGVEMSLSDDNSIALD-------EIKSVDAGEGPIPEKKDSSSRRGSYIF 253

Query: 235 DGSGAKDHE 243
            G   K+ E
Sbjct: 254 AGQSGKNAE 262

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  173 bits (439), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 87/158 (55%), Positives = 110/158 (69%), Gaps = 3/158 (1%)

Query: 26  QVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTL 85
           QVY D+  +E+ LG+LV SVD+F PDL  AR L+EAD+ L KSL+    YDE+D   + L
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 86  DEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDYAMKL 145
           D E    +  T R LETL EC   L+ALPMLEQV+FE+  +L+QR +V + VLL+YA KL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 146 AKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASL 183
           +KFT  P       VGPNNFVWPAEDA+RRG LA+A+L
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAAL 157

>NCAS0B02970 Chr2 complement(513418..513882) [465 bp, 154 aa] {ON}
           Anc_8.409 YDR201W
          Length = 154

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 11/92 (11%)

Query: 34  FEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYD----------EIDTRAK 83
           F+D + +L  SVD    + E    L E   Q  +  E +P+YD          E+D   K
Sbjct: 12  FQDMISQLQGSVDTLKSNSEENNYLTETMLQSRRVFELVPEYDVQRAKLSLIEEVDPVVK 71

Query: 84  TLDEEHRDTDEKTIRILETLTECGSDLNALPM 115
           TL+E+ R +  K  R LETL +   +LN L +
Sbjct: 72  TLEEKLRKSLSKMQRELETLQQ-SCELNELRL 102

>KAFR0I00480 Chr9 (100612..102273) [1662 bp, 553 aa] {ON} Anc_4.313
           YLR433C
          Length = 553

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 43/76 (56%), Gaps = 3/76 (3%)

Query: 30  DICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTLDEEH 89
           D+ ++E   G++V++ DR   +++   + + AD++L+     LP ++ +    K+   E 
Sbjct: 35  DLTKYELENGQMVSTTDRVITNVQPVSSKLPADEELFCPDTGLPNHEFLRNHFKS---EG 91

Query: 90  RDTDEKTIRILETLTE 105
           R T+ + +RIL+  TE
Sbjct: 92  RITEAQALRILQMATE 107

>ABR002C Chr2 complement(400235..400879,400946..401005) [705 bp, 234
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YKL002W (DID4); 1-intron
          Length = 234

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 67/140 (47%), Gaps = 18/140 (12%)

Query: 40  KLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTLD---EEHRDTDEKT 96
           +LV  + +   + ++  A I+A K L ++   + K++ + T+ + +    +  R +D+  
Sbjct: 45  RLVQDIKKSAKNGQINAAKIQA-KDLVRTKRYIEKFNGMKTQLQAISLRIQAVRSSDQMA 103

Query: 97  IRILET---LTECGSDLNALPMLEQV--EFERET-MLKQREKVFTDVLLDYAMKLAKFTH 150
           I + E    L+     +N LP L+++  EFER+  M+ QR++ F D  +D AM       
Sbjct: 104 ISMREATGLLSSMNRSMN-LPQLQRISMEFERQNDMMDQRQE-FMDEAIDDAMGDELEED 161

Query: 151 ------VPPTFDKGTVGPNN 164
                 +    D+  VG NN
Sbjct: 162 EEAEEIINKVLDEIGVGLNN 181

>SAKL0C02222g Chr3 (197312..200773) [3462 bp, 1153 aa] {ON} weakly
           similar to Saccharomyces cerevisiae YLR187W SKG3 Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cell periphery,
           cytoplasm, bud, and bud neck; potential Cdc28p substrate
           And to YNL278W uniprot|P53836 Saccharomyces cerevisiae
           YNL278W CAF120 Part of the evolutionarily- conserved
           CCR4-NOT transcriptional regulatory complex involved in
           controlling mRNA initiation, elongation, and degradation
          Length = 1153

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 13/126 (10%)

Query: 13  DRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDR-FNPDLELARALIEADKQLYKSLEC 71
           +R+D++  P S L    D   F+D+ G   A     F+PD      ++E++ + Y + E 
Sbjct: 773 ERNDAIA-PASSLA---DDFNFDDSRGSAPAEPQNVFDPDFMEENQMLESESR-YTAEEN 827

Query: 72  LPKY--DEIDTRAKTLDEEHR-----DTDEKTIRILETLTECGSDLNALPMLEQVEFERE 124
             +Y  D +   A  L E         TD+ T  +   L   G   N+LP    + +  +
Sbjct: 828 KFQYANDRLAGSANHLGERENTQPFYKTDQSTSSLYSPLDGAGGSSNSLPKTGGLGYAPQ 887

Query: 125 TMLKQR 130
           +M KQR
Sbjct: 888 SMPKQR 893

>NDAI0K02050 Chr11 complement(460673..461386) [714 bp, 237 aa] {ON}
           Anc_2.509 YKL002W
          Length = 237

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 56/112 (50%), Gaps = 10/112 (8%)

Query: 40  KLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTLD---EEHRDTDEKT 96
           KL+  + +   + ++  A I+A K L ++   + K+D + T+ + +    +  R +D+ T
Sbjct: 45  KLILEIKKSAKNGQIKAAKIQA-KDLVRTRNYMEKFDNMKTQLQAISLRIQAVRSSDQMT 103

Query: 97  IRILET---LTECGSDLNALPMLEQV--EFERETMLKQREKVFTDVLLDYAM 143
             + E    L      +N LP L+ +  EFE++T L  + + F D  +D AM
Sbjct: 104 RSMREATGLLAGMNRSMN-LPQLQTISMEFEKQTDLMDQRQEFMDEAIDNAM 154

>SAKL0A08822g Chr1 (774870..774929,775006..775227,775290..775697)
           [690 bp, 229 aa] {ON} highly similar to uniprot|P36108
           Saccharomyces cerevisiae YKL002W DID4 Class E Vps
           protein of the ESCRT- III complex required for sorting
           of integral membrane proteins into lumenal vesicles of
           multivesicular bodies and for delivery of newly
           synthesized vacuolar enzymes to the vacuole involved in
           endocytosis
          Length = 229

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 60/112 (53%), Gaps = 10/112 (8%)

Query: 40  KLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTLD---EEHRDTDEKT 96
           KLV+ + +   + +++ A I+A K L ++ + + K++ + T+ + +    +  R +D+ T
Sbjct: 45  KLVSEIKKSAKNGQISAAKIQA-KDLVRTKKYVEKFNNMKTQLQAISLRIQAVRSSDQMT 103

Query: 97  IRILET---LTECGSDLNALPMLEQV--EFERETMLKQREKVFTDVLLDYAM 143
             + E    L      +N LP L+++  EFE+++ L  + + F D  +D AM
Sbjct: 104 QSMREATGLLASMNRSMN-LPQLQRISMEFEKQSDLMDQRQEFMDEAIDDAM 154

>Kpol_1024.18 s1024 (60564..63068) [2505 bp, 834 aa] {ON}
           (60564..63068) [2505 nt, 835 aa]
          Length = 834

 Score = 30.0 bits (66), Expect = 7.8,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 28/54 (51%)

Query: 31  ICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKT 84
           I +++D   KL   +   +P  E     I+  K   KS+E + +Y+E DT+ K+
Sbjct: 114 ISKYDDLDNKLSNVIQVLSPLGEKVENSIKQKKNYIKSIELIAQYNEFDTKGKS 167

>NCAS0A04990 Chr1 complement(993133..993834) [702 bp, 233 aa] {ON}
           Anc_2.509 YKL002W
          Length = 233

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 10/112 (8%)

Query: 40  KLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTRAKTLD---EEHRDTDEKT 96
           K++  + +     ++  A I+A K L ++   + K+D + T+ + +    +  R +D+ T
Sbjct: 45  KIIQEIKKSAKQGQINAAKIQA-KDLVRTRNYMEKFDNMRTQLQAISLRIQAVRSSDQMT 103

Query: 97  IRILET---LTECGSDLNALPMLEQV--EFERETMLKQREKVFTDVLLDYAM 143
             + E    L      +N LP L+ +  EFE++T L  + + F D  +D AM
Sbjct: 104 SSMREATGLLAGMNRSMN-LPQLQNISMEFEKQTDLMDQRQEFMDEAIDNAM 154

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,983,399
Number of extensions: 919894
Number of successful extensions: 2568
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2626
Number of HSP's successfully gapped: 52
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)