Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G15334g6.69ON58258229480.0
Kwal_56.232566.69ON56752511681e-153
SAKL0A08206g6.69ON6451802233e-18
ZYRO0B01936gsingletonON8243131111e-04
ZYRO0E04708gsingletonON6112211000.002
ZYRO0A11132gsingletonON698116860.083
Kwal_55.20439singletonOFF7752720.54
TBLA0A042907.3ON39569770.82
KNAG0L011607.186ON117040771.1
ZYRO0G06600g5.702ON182088761.3
Kwal_55.215155.414ON56782751.8
KNAG0D043404.238ON2220199751.9
KLTH0D08580g2.591ON600223742.3
KAFR0F015501.136ON881150732.8
KLTH0F16500g5.414ON838133732.9
CAGL0J00693g5.267ON1884125733.3
Skud_4.1964.238ON1792126733.3
Smik_4.1764.238ON1795226733.4
YNL201C (PSY2)2.48ON858129733.5
TDEL0G045606.69ON482175723.5
SAKL0A09372g2.529ON70953706.3
TBLA0A104705.267ON1999131707.7
TBLA0C025603.443ON257880708.5
KLLA0A05621g1.216ON4065225699.3
KLTH0G07128g5.267ON1862169699.6
KNAG0A043208.443ON153091699.8
NOTE: 7 genes in the same pillar as KLTH0G15334g were not hit in these BLAST results
LIST: Skud_15.344 Smik_15.362 YOR177C Suva_8.233 AGR274C Ecym_3119 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G15334g
         (582 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON} cons...  1140   0.0  
Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {...   454   e-153
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    91   3e-18
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    47   1e-04
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    43   0.002
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    38   0.083
Kwal_55.20439 s55 complement(402467..402700) [234 bp, 77 aa] {OF...    32   0.54 
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    34   0.82 
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    34   1.1  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    34   1.3  
Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {...    33   1.8  
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    33   1.9  
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    33   2.3  
KAFR0F01550 Chr6 (307792..310437) [2646 bp, 881 aa] {ON} Anc_1.1...    33   2.8  
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    33   2.9  
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    33   3.3  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    33   3.3  
Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W...    33   3.4  
YNL201C Chr14 complement(260627..263203) [2577 bp, 858 aa] {ON} ...    33   3.5  
TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.6...    32   3.5  
SAKL0A09372g Chr1 (814740..816869) [2130 bp, 709 aa] {ON} simila...    32   6.3  
TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa]...    32   7.7  
TBLA0C02560 Chr3 (604893..612629) [7737 bp, 2578 aa] {ON} Anc_3....    32   8.5  
KLLA0A05621g Chr1 complement(516514..528711) [12198 bp, 4065 aa]...    31   9.3  
KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] ...    31   9.6  
KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {...    31   9.8  

>KLTH0G15334g Chr7 (1343754..1345502) [1749 bp, 582 aa] {ON}
           conserved hypothetical protein
          Length = 582

 Score = 1140 bits (2948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/582 (95%), Positives = 555/582 (95%)

Query: 1   MNSRSKCGPRFATMEMEADFSSQFILEGSGHPNSNSLPNALLRKDLSLKQWEDTNETEMD 60
           MNSRSKCGPRFATMEMEADFSSQFILEGSGHPNSNSLPNALLRKDLSLKQWEDTNETEMD
Sbjct: 1   MNSRSKCGPRFATMEMEADFSSQFILEGSGHPNSNSLPNALLRKDLSLKQWEDTNETEMD 60

Query: 61  FDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQTKLFD 120
           FDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQTKLFD
Sbjct: 61  FDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQTKLFD 120

Query: 121 MHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFLRCW 180
           MHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFLRCW
Sbjct: 121 MHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFLRCW 180

Query: 181 EACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEITEDFEECWIDLL 240
           EACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEITEDFEECWIDLL
Sbjct: 181 EACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEITEDFEECWIDLL 240

Query: 241 EALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDLRAA 300
           EALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDLRAA
Sbjct: 241 EALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDLRAA 300

Query: 301 VEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDR 360
           VEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDR
Sbjct: 301 VEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDR 360

Query: 361 ESQIKQLERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQSMLLSDLEEKSAL 420
           ESQIKQLERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQSMLLSDLEEKSAL
Sbjct: 361 ESQIKQLERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQSMLLSDLEEKSAL 420

Query: 421 AEAFNQELERAKNEIEGFKNQNIVSEASLNAAKEYIXXXXXXXXXXXXRISKLCLQVEGL 480
           AEAFNQELERAKNEIEGFKNQNIVSEASLNAAKEYI            RISKLCLQVEGL
Sbjct: 421 AEAFNQELERAKNEIEGFKNQNIVSEASLNAAKEYIEELELQNKELNQRISKLCLQVEGL 480

Query: 481 VEFXXXXXXXXXXXXXXXRESKQQNKKNARLIAALESRVEELATLSEVKENDNKQLFQEL 540
           VEF               RESKQQNKKNARLIAALESRVEELATLSEVKENDNKQLFQEL
Sbjct: 481 VEFKNKAKAKVALLKDAKRESKQQNKKNARLIAALESRVEELATLSEVKENDNKQLFQEL 540

Query: 541 QQYKKSLHGAKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF 582
           QQYKKSLHGAKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF
Sbjct: 541 QQYKKSLHGAKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF 582

>Kwal_56.23256 s56 complement(468118..469821) [1704 bp, 567 aa] {ON}
           YDL058W (USO1) - Integrin analogue gene [contig 183]
           FULL
          Length = 567

 Score =  454 bits (1168), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 241/525 (45%), Positives = 335/525 (63%), Gaps = 2/525 (0%)

Query: 58  EMDFDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQTK 117
           E DF+  S   D  L+ E  VSDVY+V+N NP+VE+FV ++M++K R +S++RFG N+TK
Sbjct: 45  ETDFEDTSSSADLGLQ-EDIVSDVYDVKNVNPLVEKFVAKRMKIKSRLNSMVRFGSNRTK 103

Query: 118 LFDMHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFL 177
           +FD   SI     ++P      +SIL+VK+Q P+YLEEDS SDW+QDIPI NPVVLEG L
Sbjct: 104 IFDKE-SILQVPKKEPPRLTPRDSILVVKEQNPQYLEEDSQSDWEQDIPISNPVVLEGLL 162

Query: 178 RCWEACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEITEDFEECWI 237
           RCW+ACGIP+ EFD ED+IMTVQKLSYGILQA  NQGT+NRLVK QQ S++TEDFE+CW+
Sbjct: 163 RCWDACGIPESEFDDEDLIMTVQKLSYGILQAFNNQGTINRLVKYQQVSKLTEDFEQCWL 222

Query: 238 DLLEALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDL 297
           DLLEAL+L DTV  ++ +L  Q SI A+ E RI SLE+Q++ LE QLE Q  LK+E+ + 
Sbjct: 223 DLLEALQLGDTVNELKDNLTTQVSINAKNEDRIHSLEDQIKTLEAQLEDQSTLKREHAEN 282

Query: 298 RAAVEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTV 357
            A  E   K FQ+L+ KYRD SLKL+ +QM+ DE++I++D L  ++  +  E+  C+ T+
Sbjct: 283 IATAEEANKKFQDLSSKYRDASLKLDTIQMDRDEIAIRYDCLKKDHLAISEELSNCKETL 342

Query: 358 KDRESQIKQLERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQSMLLSDLEEK 417
            DRE+Q+K+L+R + N  RE+++ L+ S   C++MA E +NAE  WKH   ++L   EE+
Sbjct: 343 NDRETQLKRLQRDVVNVQRESQEALDISNKHCSRMATELENAEATWKHNFFLILKQREEQ 402

Query: 418 SALAEAFNQELERAKNEIEGFKNQNIVSEASLNAAKEYIXXXXXXXXXXXXRISKLCLQV 477
            A++E    +  +A+ E+E  K +N  S  +LNA   YI            ++S L  ++
Sbjct: 403 MAISEGLKSQSMKARQELEDLKKRNTESLITLNATGNYIKSIELQNRELNDKVSMLSSRL 462

Query: 478 EGLVEFXXXXXXXXXXXXXXXRESKQQNKKNARLIAALESRVEELATLSEVKENDNKQLF 537
           E L++F               R  KQ  K     +  L  +  E   + EV+E   +QLF
Sbjct: 463 ETLLDFKKRAKTKILALRDAKRTVKQSIKDANLTVDQLRKQAAETREMCEVQEKQKEQLF 522

Query: 538 QELQQYKKSLHGAKVQTPSVLSPLKHKNAHNRRSLQLSDRRIGAF 582
            ELQ  KK L  +K+ TP   SPL HK     R L L++ RI AF
Sbjct: 523 LELQAAKKLLKESKISTPPSHSPLAHKGVRPHRPLMLANNRIDAF 567

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/180 (30%), Positives = 95/180 (52%), Gaps = 17/180 (9%)

Query: 64  YSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQ---MRVKGRPSSLLRFGCNQTKLFD 120
           Y+ D D  L  +  V+ VY ++N+NP +E+ +      + V    +  +RFG N  K+F 
Sbjct: 94  YNSDEDIALN-KVLVTPVYTIKNSNPFLEDAIASAICPLEVTNH-TPKIRFGENSVKMFY 151

Query: 121 MHASIGN----SHIRKPSGAIKPESILIV-----KDQEPRYLEEDSHS---DWDQDIPID 168
             + IGN    +  RKP+G +K +S+  V      D       +DS +   DW+ ++PI+
Sbjct: 152 SDSLIGNGLEENPPRKPNGNLKHDSVKSVLVEKNSDNACPLKSKDSDTADQDWEVNVPIE 211

Query: 169 NPVVLEGFLRCWEACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEI 228
           N V LE   RC+  C +P  + D +D++M++Q+LS+GI+ A   Q    + +  ++  EI
Sbjct: 212 NTVALEAITRCFNLCNVPLEDLDEDDLVMSLQRLSFGIVSAFKTQEMCYKYLGKKEKEEI 271

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
           weakly similar to uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport, coiled-coil protein necessary for protein
           transport from ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 142/313 (45%), Gaps = 45/313 (14%)

Query: 78  VSDVYEVRNTNPIVEEFVTEQMRVKGRP---SSLLRFGCNQTKLFDMHASI--------- 125
           V+  Y V+N+NPI++E +     +   P   S+ ++FG ++T  FD+   +         
Sbjct: 42  VTPAYGVKNSNPIIDEAIDNFSFLYSEPKSKSNKIQFGESRTITFDVDEEVDRLASKTKN 101

Query: 126 --GNSHIRKPSGAI-KPESILI-----VKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFL 177
               S   KP   I KP  + +     ++ ++  YL+E   SD +  +   N  V+    
Sbjct: 102 TENQSKDSKPLKTILKPGPVFVHDSELLETEDFAYLDE---SDEETQVKTSNQDVITLLQ 158

Query: 178 RCWEACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQQFSEITEDFE---- 233
           R +   GIP  E   ED++ T+Q+L+ G++ +   +    + V  +Q  E  ++ E    
Sbjct: 159 RIFTLHGIPPCEI-KEDLLGTLQRLARGVVASFKQREQCYKYVGRKQSIEELDELEYVND 217

Query: 234 --ECWIDLLEALELEDTVKCMEAD--LAHQTSITAEKEKRIQSLENQVRGLERQLETQVE 289
             +C +  L     ++ V+    D       S+ A+ E+ I + ++ ++ L  QL  + E
Sbjct: 218 KLKCEVAGLNKKLSQEKVRWEVVDEVFIENDSLKAKVEELITAKQHLLKEL--QLAPKWE 275

Query: 290 ----LKQENKDLRAAVEHNTKMFQELNEKYRDVSLKLN------VVQMNNDEVSI-KHDV 338
               L +E+K+L++ V+  T +  +L +KY  + +  +      V      ++ + K D+
Sbjct: 276 DVDGLLEEDKELKSRVKQLTFLNDDLKKKYAQIEITTSKRADELVSSKEKSDIELRKTDI 335

Query: 339 LMNENAELRHEIR 351
            +NE  E   E+R
Sbjct: 336 KLNETTEQVIELR 348

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 98/221 (44%), Gaps = 29/221 (13%)

Query: 87  TNPIVEEFVTEQMRVKGRPSSLLRFGCNQTKLFDMHASIGNSHIRKPS--GAIKPESILI 144
           +N I+ +F   Q      P   ++FG  +  +F+    IG+S     S    I P  IL 
Sbjct: 61  SNEIIGQFSKLQA-----PKGNVKFGDKEIVIFNEDERIGHSMKANSSVDNVILPLPILK 115

Query: 145 VKDQ---EPRYLEEDSHSDWDQDIPIDNPVVLEGFLRCWEACGIPDFEFDAEDMIMTVQK 201
           +  +   + +Y+E D+     Q+       + E F RC+  C +P  +FD  +   +++K
Sbjct: 116 ISQKGASDIKYMEPDNKMATQQE------RLFEVFRRCYTLCNLPMSQFDENNPFKSLKK 169

Query: 202 LSYGILQALANQGTVNRLVKAQQFSEITEDFEECWIDLLEALELEDTVKCMEADLAHQTS 261
           L  GI ++   +    + ++ ++   +++          E  +L+DT++ ++ D     S
Sbjct: 170 LCEGIKKSFKAKDECYKYIRYEENRRLSQ----------EIRKLKDTIQELKDD--RHNS 217

Query: 262 ITAEKEKRIQSLENQVRGLERQLETQV-ELKQENKDLRAAV 301
           +   +  ++Q   N+ R   + L  QV     EN +LR+ +
Sbjct: 218 LVLLQINKLQKHNNEYRNEIKDLTAQVTSTNYENSELRSNI 258

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 32/116 (27%)

Query: 109 LRFGCNQTKLFDMHASIGNSHIR----KPS---GAI-----KPESILIVKDQEPRYLEED 156
           LRFG N+T  FD++  +G   ++    KP+   GA+     K +SIL      PR +   
Sbjct: 85  LRFGENETITFDINEEVGKLVMKEAEYKPASQHGALDQKNTKNKSILKTN---PRTV--- 138

Query: 157 SHSDWDQDIPI---DNPVV---LEGFLRCWEACGIPDFEFDAEDMIMTVQKLSYGI 206
                   IP     NP +    E  ++C+  CGI     D + M  ++ KL +GI
Sbjct: 139 --------IPYRPHANPYIDACQEVMIKCYNMCGISVDYLDIDKMFDSLGKLMFGI 186

>Kwal_55.20439 s55 complement(402467..402700) [234 bp, 77 aa] {OFF}
           [contig 149] FULL
          Length = 77

 Score = 32.3 bits (72), Expect = 0.54,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 140 ESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLEGFLRCWEACGIPDFEFD 191
           ++++ V D  P  L E S+S++ + +PI + + +   L C + CG  DF F+
Sbjct: 15  DALVTVTDTPPPPLCEASYSEYSETVPICSTIPVNIVLCCADECG-SDFNFE 65

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 2/69 (2%)

Query: 164 DIPIDNPVVLEGFLRCWEACGIPDFEFDAEDMIMTVQKLSYGILQALANQGTVNRLVKAQ 223
           D+P+D   +++    CW A  I +F+  +  +++    +  GI+ AL   G  + +V   
Sbjct: 163 DLPLDIAALIQPIAVCWHALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVV--S 220

Query: 224 QFSEITEDF 232
           + ++I  DF
Sbjct: 221 EPAKIRRDF 229

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 27/40 (67%)

Query: 339 LMNENAELRHEIRTCRGTVKDRESQIKQLERTMSNDSREA 378
           L+ +N EL  EI  C+  +KD+ SQIKQL++ ++   ++A
Sbjct: 743 LIRKNEELESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDA 782

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (56%), Gaps = 11/88 (12%)

Query: 227 EITEDFEECWIDLLEALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLET 286
           E+T+  +E    L+E  +L D++   + + AH+ S+   K+K I  LENQV+ L  Q E 
Sbjct: 268 ELTKSLQE---KLMEMKDLSDSLYREKQEFAHEMSM---KQKLIDLLENQVKSL--QGEL 319

Query: 287 QVELKQENKDLRAAVEHNT---KMFQEL 311
              L ++N +L A+ E NT   K+ QEL
Sbjct: 320 NASLDKDNVELLASGERNTENEKLIQEL 347

>Kwal_55.21515 s55 complement(868702..870405) [1704 bp, 567 aa] {ON}
           YDR356W (SPC110) - component of the spindle pole body
           that interacts with Spc42p, calmodulin, and a 35 kDa
           protein [contig 129] PARTIAL
          Length = 567

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 11/82 (13%)

Query: 244 ELEDTVKCMEADLAHQTSITAEKEKRIQSLE----------NQVRGLERQLETQVELK-Q 292
           EL+  V+ +E DL+   S   ++++RI +LE          NQ+R L+ +++   ++K Q
Sbjct: 112 ELQQQVRSLEKDLSKANSHVKDRDERILTLEKQLDDLKQRSNQLRNLDGKIDDDRKIKDQ 171

Query: 293 ENKDLRAAVEHNTKMFQELNEK 314
           + K+LRA ++   K   ELN K
Sbjct: 172 KIKELRAQIQQVVKQKDELNRK 193

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 88/199 (44%), Gaps = 24/199 (12%)

Query: 244  ELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDLRAAVEH 303
            EL   +K  E  +   +S   ++EK IQ L   +  L  ++   VELK+ N++L   V  
Sbjct: 1148 ELNGIIKSHEETIQELSSSIDDREKNIQKLNTSINELNSEI---VELKETNQELEECVSR 1204

Query: 304  NTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDRESQ 363
            + K   ELNEK              +D +   ++    E  +L+ +I +    +  +E +
Sbjct: 1205 HEKTVTELNEKIE-----------KSDPIISSYEA---EIKDLKQKISSSEDKITSQELK 1250

Query: 364  IKQLERTMSNDSREAKKELETSKTQ---CNQMAFEYKNAEMNWKHRQSMLLSDLEEKSAL 420
             K+L+  ++      +KE+ET KT+     +   + K   ++   +   L  +L     L
Sbjct: 1251 YKELQEKVTL----LEKEIETFKTKREDFEKTILQSKELGVSLNEKNKSLSEELVSVHKL 1306

Query: 421  AEAFNQELERAKNEIEGFK 439
             E    EL + K+++EG +
Sbjct: 1307 QEKCQAELSKKKSKVEGLR 1325

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 92/223 (41%), Gaps = 40/223 (17%)

Query: 252 MEADLAHQ-TSITAEKEKRIQS------LENQVRGLERQLE--TQVELKQENKDLRAAVE 302
           +E D A + ++ITA+    IQS      L   V+ L    E  +Q   KQ     R    
Sbjct: 46  LEKDYARRLSAITAKFNSNIQSQPDYGKLGLSVKSLHSSQERLSQSHSKQAVAIYRDGFS 105

Query: 303 HNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKH--DVLMNENAELRHEIRTCRGTVKDR 360
                 Q+L  +Y+ +SLK     + ND+++ K   DVL  +  +   E+R C       
Sbjct: 106 ELKLFVQDLQARYKTISLKTR--NLCNDKITKKQLCDVLQGKLEKASTELRDC------- 156

Query: 361 ESQIKQLERTMSNDSREAKKELETSKTQCNQMAF-------EYKNAEMNWKHRQSMLLSD 413
             Q+ Q       DS +  + ++  ++  +++         EYKN+  +W H  S L  +
Sbjct: 157 --QLNQDNYLGKRDSSQNDRHIQKWRSIVDELQMKLDVLKQEYKNSTKHWLHEWSRLSLE 214

Query: 414 LEEKSALAEAFNQELERAKNEIEGFKNQNIVSEASLNAAKEYI 456
           L           QELER++ +    K Q    + S  A +E I
Sbjct: 215 L-----------QELERSRIQFIKVKLQEFSKQCSDAAVEEQI 246

>KAFR0F01550 Chr6 (307792..310437) [2646 bp, 881 aa] {ON} Anc_1.136
           YJL198W
          Length = 881

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 65/150 (43%), Gaps = 9/150 (6%)

Query: 275 NQVRGLERQLETQVELKQENKD-LRAAVEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVS 333
           N ++ +   L+T  ELK E    L   V +N + F  L ++++D   +       ND V 
Sbjct: 23  NDLKNMIYTLQTD-ELKSETGAVLDDTVSNNDEKFNNLAKRFKDAFKRGRANSTKNDAVM 81

Query: 334 IK----HDVLMNENAELRHEIRTCRGTVKDRESQIKQLERTMSNDSREAKKELETSKTQC 389
           ++    HD+  NE+ + ++ ++  RG   D  S     E+T+ N        L   K + 
Sbjct: 82  VETVELHDLNENEDVKKKNSLKKIRGKFFDSRSSSISSEKTLFNTYDSFVNSLTDEKLKV 141

Query: 390 NQMAFEYKNAEMNWKHRQSMLLSDLEEKSA 419
           +     YK  E  +  +   L+ DLE++  
Sbjct: 142 DDF---YKRMESKFYEKFESLIQDLEKEGV 168

>KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]
           {ON} weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component ortholog of human kendrin involved in
           connecting nuclear microtubules to SPB interacts with
           Tub4p-complex and calmodulin phosphorylated by Mps1p in
           cell cycle-dependent manner
          Length = 838

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 67/133 (50%), Gaps = 17/133 (12%)

Query: 308 FQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDRESQIKQL 367
           +QEL + YR + LK +  + + D+  ++ D   NE      E+R+ +  +++ + Q+ Q 
Sbjct: 170 YQELKKAYRSLQLKFDQSE-HKDQADLEQDARSNE-----KEMRSLQKKLQEYQEQVTQ- 222

Query: 368 ERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQSMLLSDLEEKSALAEAFNQE 427
                     +KK +E+ + +    A   K  +  ++H+ S+L   +++  +   A ++E
Sbjct: 223 ----------SKKLVESLENKLGNSASGSKEIKEQFEHKSSLLQERIDKLESELAAKDKE 272

Query: 428 LERAKNEIEGFKN 440
           LE  +NEI+  +N
Sbjct: 273 LEINRNEIKNLQN 285

>CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023w MYO1
          Length = 1884

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 65/125 (52%), Gaps = 19/125 (15%)

Query: 264  AEKEKRIQSLENQVRGLERQ--LETQVELKQENKDLRA-----AVEHNTK----MFQELN 312
            AE  +++ SLE++   + RQ  ++T+V  K EN+ +        + H+ K    +  EL 
Sbjct: 947  AELTRKLSSLESEKGDITRQISMDTEVLKKLENEKMEKERVIEKLSHDIKERDHIIDELK 1006

Query: 313  EK----YRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEI----RTCRGTVKDRESQI 364
            +K     +D+ +KL  ++ N +    K   L+NENAELR E+    +    T++   S+ 
Sbjct: 1007 QKEHISNKDLDIKLQTLEKNCNVALTKLKSLLNENAELREEVGKNKKLHANTIQQVSSKE 1066

Query: 365  KQLER 369
            K++ER
Sbjct: 1067 KEIER 1071

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
           (REAL)
          Length = 1792

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 65/126 (51%), Gaps = 15/126 (11%)

Query: 270 IQSLENQVRGLERQLET-QVELKQENKDLRAAVEHNTKMFQELNEKYRDVS--------- 319
           ++ L+ Q   L+ +L + Q E +  N DL   +E  +K  ++L EKY+ ++         
Sbjct: 732 VEELQKQCSKLKNELGSLQTETEATNGDLTKKLEALSKEHEDLMEKYQSLTSSHLLLKES 791

Query: 320 -----LKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDRESQIKQLERTMSND 374
                ++L  ++ + ++++   D L  ++ E +  I+ C+ T++ +E  I+ LE+ + N 
Sbjct: 792 FSSLEIELGTIKESLNKMTQLRDALETKDKENQALIQECKSTIQKQEEAIEILEKELDNV 851

Query: 375 SREAKK 380
           S + KK
Sbjct: 852 SSQKKK 857

>Smik_4.176 Chr4 (322038..327425) [5388 bp, 1795 aa] {ON} YDL058W
            (REAL)
          Length = 1795

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 104/226 (46%), Gaps = 28/226 (12%)

Query: 245  LEDTVKCMEADLAHQTSITAEKEKRIQ----SLENQVRGLERQ---LETQV-ELKQENKD 296
            LE T+KC E +L     +  E +++++    S E +++ L+ +   LETQ+ E K+E ++
Sbjct: 1511 LESTIKCNEKELKSSMKVMKESDEKLEQCRKSAEEEIKNLQNEKSTLETQIKESKKEIEE 1570

Query: 297  LRAAVEHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGT 356
            L   ++   K   EL    + +S     + +N  E ++    L +   EL+ +    +  
Sbjct: 1571 LERKLKIEAKSTTELETIEQQLSKANEKLNVNRKEDALLKSKLKDLERELKEKQVKIKNN 1630

Query: 357  VKDRE---SQIKQLERTMSNDSREAKK----------ELETSKTQCN----QMAFEYKN- 398
            ++++E   SQ+K LE+ + N  ++ +K          +L+  KT+ +    Q+  +Y N 
Sbjct: 1631 IEEKELLTSQLKTLEQELDNAQQKTQKCEEESKIEVRKLQAEKTESDERVVQLETKYNNL 1690

Query: 399  --AEMNWKHRQSMLLSDLEEKSALAEAFNQELERAKNEIEGFKNQN 442
               E NWK  +  +    + +    E    ELE+ K E    K  N
Sbjct: 1691 VAKEENWKKDEDAINKTTDSQKTEIEKLVIELEKLKTENSKLKEVN 1736

>YNL201C Chr14 complement(260627..263203) [2577 bp, 858 aa] {ON}
           PSY2Subunit of protein phosphatase PP4 complex; active
           complex is composed of catalytic subunit Pph3p and
           Psy2p, with Psy4p apparently providing additional
           substrate specificity in some cases; regulates recovery
           from the DNA damage checkpoint and also the gene
           conversion- and single-strand annealing-mediated
           pathways of meiotic double-strand break repair; Pph3p
           and Psy2p localize to foci on meiotic chromosomes;
           putative homolog of mammalian R3
          Length = 858

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 18/129 (13%)

Query: 226 SEITEDFEECWIDLLEA-------LELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVR 278
           SEI  D E C ID L+        +EL DT    E+        ++EKEK +Q  ++ +R
Sbjct: 317 SEIVMDLETCIIDFLQVGTFLDRLIELYDTKTLPES--------SSEKEKFVQKRKDGIR 368

Query: 279 GLERQLETQVELKQENKDLRAAVEHNTKMFQELNEKYRDVSLKLNVVQMNNDEV--SIKH 336
            L++ ++  + L   ++           +F+ L+  +  +    NV  +  D +   I+H
Sbjct: 369 LLQQCVQMSINLDAVDRSKFYKTLVRKGLFKVLDYAFH-METDSNVRILATDTIITIIEH 427

Query: 337 DVLMNENAE 345
           D+L+  N +
Sbjct: 428 DILLIHNVQ 436

>TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.69
           YOR177C
          Length = 482

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/175 (17%), Positives = 70/175 (40%), Gaps = 22/175 (12%)

Query: 57  TEMDFDLYSIDRDNDLRPETYVSDVYEVRNTNPIVEEFVTEQMRVKGRPSSLLRFGCNQT 116
           T++  +LY+ +  ++ RP+ Y++   E++  N  VE+ + +  R   +    LR+  N+ 
Sbjct: 23  TKIYQNLYNDENHSNARPQDYITGPLEIKGVNYAVEKALRDFEREGRKDRKALRYITNK- 81

Query: 117 KLFDMHASIGNSHIRKPSGAIKPESILIVKDQEPRYLEEDSHSDWDQDIPIDNPVVLE-- 174
           K+  + +  G+  + +P+     + +         + E D         PI    +L+  
Sbjct: 82  KIVGISSQTGSLPLTRPATKYVVKKVTFGLSSVVHFEESDIVPKKSVGGPIRGKSILKRS 141

Query: 175 -------------------GFLRCWEACGIPDFEFDAEDMIMTVQKLSYGILQAL 210
                                 R +  C +P   F  +D +++++ L+ G+  A 
Sbjct: 142 SFNSPSTDYEKIGRRELQNAIARIYNLCDLPFTLFRKDDPLLSLELLARGVCNAF 196

>SAKL0A09372g Chr1 (814740..816869) [2130 bp, 709 aa] {ON} similar
           to uniprot|P36013 Saccharomyces cerevisiae YKL029C MAE1
           Mitochondrial malic enzyme catalyzes the oxidative
           decarboxylation of malate to pyruvate which is a key
           intermediate in sugar metabolism and a precursor for
           synthesis of several amino acids
          Length = 709

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 515 LESRVEELATLSEVKENDNKQ-LFQELQQYKKSLHGAKVQTPSVLSPLKHKNA 566
           + + V++LA LS +KE D+K  L   L+Q   +   AKV T  +L  LK  NA
Sbjct: 606 ISAAVDQLAALSPLKEGDSKPGLLPPLEQINDT--SAKVATAVILQALKEGNA 656

>TBLA0A10470 Chr1 complement(2572729..2578728) [6000 bp, 1999 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1999

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 64/131 (48%), Gaps = 14/131 (10%)

Query: 242  ALELEDTVKCMEADLAHQTSITAEKEKRIQSLENQVRGLERQLETQVELKQENKDLRAAV 301
            A +LE  +K ++A+L  +   + + +  I SL  ++  LE  L       + +K++   +
Sbjct: 1005 ADKLESQLKDLQANLISKDKKSKDDKSLIDSLNTKITKLEESL------TKRDKEI-ITL 1057

Query: 302  EHNTKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNENAELRHEIRTCRGTVKDRE 361
            + NTK   +L  K + +  +L+  + +       + +L + N  L  EI + +  V  ++
Sbjct: 1058 KTNTKTNDDLTNKLKKLETELSTKEKS-------YKLLFDSNKSLETEIHSIKKVVASKD 1110

Query: 362  SQIKQLERTMS 372
            SQIK L  T+S
Sbjct: 1111 SQIKNLNDTLS 1121

>TBLA0C02560 Chr3 (604893..612629) [7737 bp, 2578 aa] {ON} Anc_3.443
            YPR117W
          Length = 2578

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)

Query: 336  HDVLMNENAELRHEIRTCRGTVKDRESQIKQLERTMSNDSREAKKELETSKTQCNQMAFE 395
            H  L+++N   R + R     +K+ E  I++L + +++       ++E+ K + NQM  +
Sbjct: 1737 HSCLIDKNHPERTQERLTEKRIKELEDHIEKLSKELNHLQSGTNSQIESRKNKINQMNHQ 1796

Query: 396  YKNAEMNWKHRQSMLLSDLE 415
                +  W+  Q + LSDL+
Sbjct: 1797 LHEVKHRWRILQGV-LSDLK 1815

>KLLA0A05621g Chr1 complement(516514..528711) [12198 bp, 4065 aa] {ON}
            similar to uniprot|P36022 Saccharomyces cerevisiae
            YKR054C DYN1 Cytoplasmic heavy chain dynein microtubule
            motor protein required for anaphase spindle elongation
            involved in spindle assembly chromosome movement and
            spindle orientation during cell division targeted to
            microtubule tips by Pac1p
          Length = 4065

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 100/225 (44%), Gaps = 32/225 (14%)

Query: 236  WIDLLEALELEDTVKCMEADLAHQ---TSITAEKEKRIQSLENQVRGLERQLETQVELKQ 292
            ++D L+ L +E T K  E+D   +     +   KE  I      V+ L +++E++  + Q
Sbjct: 2968 FLDSLKVLRIEYTKKLTESDNNQRFIRNGLIKLKESVIM-----VKKLNKEMESKKNILQ 3022

Query: 293  ENK-DLRAAVEHNTKMFQELNEKYR--DVSLKL-NVVQMNNDEVSIKHDVLMNENAELRH 348
            E K + R  ++   +M  + NE  R  + S+++  ++ +   E+S + DV+MN+ A+   
Sbjct: 3023 EKKIEARKTLD---QMLHDQNESERKQEASIEIQKILNLQEQEISKRRDVVMNDLAKAEP 3079

Query: 349  EIRTC-RGTVKDRESQIKQLERTMSNDSREAKKELETSKTQCNQMAFEYKNAEMNWKHRQ 407
             I    RG    ++ Q+ +L RTM N     K  LE     C  + F+       WK  Q
Sbjct: 3080 AILEAQRGVKNIKKQQLTEL-RTMINPPEAVKITLEAV---CVLLGFQIG----TWKDIQ 3131

Query: 408  SMLLSD--------LEEKSALAEAFNQELERAKNEIEGFKNQNIV 444
              +  D         E ++ L++     ++        FK +N++
Sbjct: 3132 QTIRKDDFIARIVTFETETMLSQELKHYIQTHYLNRSNFKYENVL 3176

>KLTH0G07128g Chr7 complement(569563..575151) [5589 bp, 1862 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023W MYO1 Type II myosin heavy chain required for
            wild- type cytokinesis and cell separation localizes to
            the actomyosin ring binds to myosin light chains Mlc1p
            and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1862

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 79/169 (46%), Gaps = 29/169 (17%)

Query: 245  LEDTVKCMEADLAHQTSITAEKEKRIQS----LENQVRGLERQLETQ----VELKQENKD 296
            L D +K +++ ++ +  IT E ++++ +    LE  ++GLE++  +       L +ENK 
Sbjct: 951  LLDQIKLLKSSISEKDRITGELKEKLSASDKELERSLQGLEKKFTSTSKRLTSLVEENKS 1010

Query: 297  LRAAVE---------HNT-----KMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMNE 342
            LR  V+         HN      K  + LNE+       +  +     +++ +H+ ++NE
Sbjct: 1011 LRETVDRAKKEQNELHNGLQAKEKELRRLNERSDQNQTLIASLNKERADLAAEHEKILNE 1070

Query: 343  NAELRHEIRTCRGTVKDRESQIKQLERTMSNDSREAKKELETSKTQCNQ 391
              ELR E     G  K    + ++LE T S+   + K+ L+  K+   +
Sbjct: 1071 AKELRKE---ASGYKK----RYQELEETCSSLKDDLKRSLQEPKSNSGE 1112

>KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {ON}
            Anc_8.443 YDL197C
          Length = 1530

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 14/91 (15%)

Query: 289  ELKQE---NKDLRAAVEHN----TKMFQELNEKYRDVSLKLNVVQMNNDEVSIKHDVLMN 341
            ELK+E   NK+LR  ++ N    +K  Q L +   DVSLK N+       +S  +  L  
Sbjct: 1317 ELKKEKEMNKNLRVLIDSNNVTTSKQMQVLTQHLNDVSLKFNI-------LSNTYRQLFE 1369

Query: 342  ENAELRHEIRTCRGTVKDRESQIKQLERTMS 372
            E    + ++R  R T K  E+  + LE T++
Sbjct: 1370 EYTVQKSKLRLLRQTGKQMETTQRDLEDTIT 1400

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,059,716
Number of extensions: 2615957
Number of successful extensions: 13392
Number of sequences better than 10.0: 904
Number of HSP's gapped: 13378
Number of HSP's successfully gapped: 1498
Length of query: 582
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 467
Effective length of database: 40,294,809
Effective search space: 18817675803
Effective search space used: 18817675803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)