Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13882g8.254ON68767331970.0
Kwal_56.235778.254ON68367327000.0
SAKL0H17248g8.254ON66067223470.0
YLR083C (EMP70)8.254ON66767622790.0
NDAI0B023708.254ON72267122770.0
Smik_12.1428.254ON66367422680.0
Suva_10.1678.254ON68467422640.0
KLLA0F18931g8.254ON66567822540.0
NCAS0B049708.254ON66667422130.0
Skud_12.1518.254ON66467522010.0
YDR107C (TMN2)8.254ON67267121700.0
KAFR0B026808.254ON66467521510.0
Kpol_543.358.254ON65867921450.0
ZYRO0C01848g8.254ON64767321240.0
Smik_4.3538.254ON69067121250.0
Suva_2.2678.254ON67267721090.0
CAGL0B01683g8.254ON69167920990.0
Skud_4.3688.254ON67267420880.0
KNAG0G019908.254ON66767420340.0
NCAS0B038908.254ON66367320040.0
TBLA0E043708.254ON67667420030.0
TPHA0A018408.254ON68567619870.0
AGR097W8.254ON65367119720.0
TBLA0H014508.254ON67367519680.0
TDEL0F038108.254ON65666918350.0
NDAI0J014208.254ON61964317490.0
Ecym_43178.254ON60545412121e-158
NDAI0A015107.411ON6797083028e-28
CAGL0G03487g7.411ON7047352682e-23
Smik_5.2587.411ON7065182663e-23
NCAS0A145207.411ON6704912653e-23
ZYRO0B03784g7.411ON6584832644e-23
YER113C (TMN3)7.411ON7065162619e-23
KNAG0C034307.411ON6805092564e-22
KLTH0C06226g7.411ON6945912431e-20
Suva_5.2347.411ON7065202431e-20
TDEL0C027107.411ON6785052413e-20
Skud_5.2667.411ON7075162378e-20
KLLA0E20835g7.411ON6764992243e-18
SAKL0F12914g7.411ON7073912073e-16
KAFR0K019507.411ON6644911984e-15
Kwal_27.107467.411ON6903421861e-13
Ecym_71437.411ON6765221824e-13
Kpol_1045.287.411ON6815081323e-07
AGL295C7.411ON6571571323e-07
TBLA0I003307.411ON7133211315e-07
TPHA0K007307.411ON7331501182e-05
SAKL0E06226g2.345ON75447771.1
NCAS0A137007.279ON33770751.6
NCAS0B075601.303ON49558733.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13882g
         (687 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...  1236   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...  1044   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   908   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   882   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   881   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   878   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   876   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   872   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   857   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   852   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   840   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   833   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   830   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   822   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   823   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   816   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   813   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   808   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   788   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    776   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   776   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   769   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   764   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   762   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   711   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   678   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   471   e-158
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   120   8e-28
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   107   2e-23
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   107   3e-23
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   106   3e-23
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   106   4e-23
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   105   9e-23
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   103   4e-22
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    98   1e-20
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...    98   1e-20
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...    97   3e-20
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...    96   8e-20
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    91   3e-18
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...    84   3e-16
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    81   4e-15
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    76   1e-13
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    75   4e-13
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    55   3e-07
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    55   3e-07
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    55   5e-07
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    50   2e-05
SAKL0E06226g Chr5 complement(505827..508091) [2265 bp, 754 aa] {...    34   1.1  
NCAS0A13700 Chr1 (2692827..2693840) [1014 bp, 337 aa] {ON} Anc_7...    33   1.6  
NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602) [...    33   3.7  

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score = 1236 bits (3197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/673 (91%), Positives = 619/673 (91%)

Query: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK 74
           QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK
Sbjct: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK 74

Query: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134
           FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI
Sbjct: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134

Query: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXX 194
           TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMN            
Sbjct: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDDSG 194

Query: 195 XXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254
               TKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG
Sbjct: 195 SHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254

Query: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314
           NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK
Sbjct: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314

Query: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374
           YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL
Sbjct: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374

Query: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALF 434
           IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFA             TTVMFILYALF
Sbjct: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYALF 434

Query: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494
           GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM
Sbjct: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494

Query: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554
           CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI
Sbjct: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554

Query: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQ 614
           FPFGSIAVELYFIYSSLWFNKIFYMFG                         CLENWKWQ
Sbjct: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWKWQ 614

Query: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674
           WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL
Sbjct: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674

Query: 675 WFVRRIYSSVKVD 687
           WFVRRIYSSVKVD
Sbjct: 675 WFVRRIYSSVKVD 687

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score = 1044 bits (2700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/673 (76%), Positives = 574/673 (85%), Gaps = 5/673 (0%)

Query: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK 74
           +V GFYLPGVAPTTYHEGD+IPLLVNHLTP+MY++H D+DG D GD+ES LYSYDYYY K
Sbjct: 16  RVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTGDRESFLYSYDYYYDK 75

Query: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134
           FHFC+PEKLEKQRESLGSIIFGDRIYNSPF++EMLK+KEC +LCS  IPA+DAKFINKLI
Sbjct: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135

Query: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXX 194
            NGFFQNWLVDGLPAARKTTD RTKSEFYTPGFELG++ +GG++LRM+            
Sbjct: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA 195

Query: 195 XXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254
               TK V++ DYLD P +K    KRK++ + KELVKQLET YFANHF IEVQYHDRGNG
Sbjct: 196 ----TKPVAQDDYLDRP-SKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNG 250

Query: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314
           +YRVVGVIVNP SIKR+S ++C  TGELLKLSE E T VHFSYSVKFTPS+TVWATRWDK
Sbjct: 251 DYRVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDK 310

Query: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374
           YLHVYDPKIQW+SLINFS+VV+ LS+V+IH LY TL DDLSRYNQ+NLDDDFQEETGWKL
Sbjct: 311 YLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKL 370

Query: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALF 434
           +HGDVFRTP +SL+LSVLVGSG QLF+MAACTI FA             TTVMFILYALF
Sbjct: 371 VHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALF 430

Query: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494
           GS GSYTSMATYKFFGG YWKVNM+LTPILVPGLLFCV+L LNFFL++VESAGAIPFGTM
Sbjct: 431 GSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTM 490

Query: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554
           C IVLLWF+FSIPLS+AGSLIA+KKC+W+EHPTKT+QIPRQIPFQPWYLKT PA+LIAGI
Sbjct: 491 CAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGI 550

Query: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQ 614
           FPFGSIAVELYF+YSSLWFNKIFYMFG                         CLENWKWQ
Sbjct: 551 FPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQ 610

Query: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674
           WRGFWIGGAGCALY+F+HAILFTKF+LGGF TIVLYVGYSLV+SLL+CLITG VGF+SSL
Sbjct: 611 WRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSL 670

Query: 675 WFVRRIYSSVKVD 687
           WFVRRIYSS+KVD
Sbjct: 671 WFVRRIYSSIKVD 683

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/672 (66%), Positives = 508/672 (75%), Gaps = 26/672 (3%)

Query: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKF 75
           S FYLPGVAPTTYH+GD IPLLVNHLTP+ Y+QHAD++G+ + GDKE  LYSYDYYY KF
Sbjct: 14  SAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKF 73

Query: 76  HFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLIT 135
           HFCRPE L KQ ESLGSIIFGDRIYNSPF++ ML+NK C  LC   IP DDAKFINKLI 
Sbjct: 74  HFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIR 133

Query: 136 NGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXX 195
           NGFF NWLVDGLPAAR+  D RT S FY  GFELG+V +                     
Sbjct: 134 NGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDV----------------VDTIE 177

Query: 196 XXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGN 255
              TK+VSESDY++   A + L +R          K  E  YF NHF+I+++YHDRG  N
Sbjct: 178 DPDTKKVSESDYIEIADADKELKERS--------AKLTELSYFINHFDIKIEYHDRGEDN 229

Query: 256 YRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKY 315
           YRVVGV V P SIKR+S D+CD  GE L LSE     VHF+YSV F PS+T+WATRWDKY
Sbjct: 230 YRVVGVSVIPASIKRDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKY 289

Query: 316 LHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLI 375
           LHVYDP+IQWFSLI+FSL+V+ LS+VM+H L+  L +DLSRYN++NLDD+FQEETGWKL+
Sbjct: 290 LHVYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLV 349

Query: 376 HGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFG 435
           HGDVFRTPER+++LSVLVGSGAQLFLMA  TI FA             TTVMFILYALFG
Sbjct: 350 HGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFG 409

Query: 436 SFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMC 495
           SFGSYTSMA YKFF G  WK+NM+LTPIL+P ++F  ML LN FLV V S+GAIPFGTM 
Sbjct: 410 SFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTML 469

Query: 496 VIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIF 555
            IV+LWF+FSIPLSVAGS+I+RKK +WD  PT T QI RQIPFQPWYLKTVPASLIAG F
Sbjct: 470 AIVVLWFVFSIPLSVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTF 528

Query: 556 PFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQW 615
           PFGSI VELYFIYSSLWFNKIFYMFG                         C+ENWKWQW
Sbjct: 529 PFGSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQW 588

Query: 616 RGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLW 675
           RGFWIGGAGCA Y+F+HAILFTKF+LGG TT+VLY+GYS+V+S L CLITG VGFLSSLW
Sbjct: 589 RGFWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLW 648

Query: 676 FVRRIYSSVKVD 687
           FVR+IY S+KVD
Sbjct: 649 FVRKIYGSIKVD 660

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/676 (64%), Positives = 501/676 (74%), Gaps = 32/676 (4%)

Query: 16  VSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPK 74
           V  FYLPGVAPTTY E D IPLLVNHLTP+M YQH DEDGN++ GDKE+ LYSYDYYY +
Sbjct: 20  VKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNR 79

Query: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134
           FHFC+PEK+EKQ ESLGS+IFGDRIYNSPFQ+ ML+ KEC SLC   IP DDAKFINKLI
Sbjct: 80  FHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLI 139

Query: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXX 194
            NGFFQNWL+DGLPAAR+  D RTK+ FY  GF LG+V                      
Sbjct: 140 KNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFV---------------------- 177

Query: 195 XXXXTKEVSESDYLDAPPAKRSLAKRK---QVSNTKELVKQLETPYFANHFEIEVQYHDR 251
                 +V++   ++A P       +    +  N + +VK  E PYFANHF+I ++YHDR
Sbjct: 178 ------QVTQGTDIEATPKGAETTDKDVELETRNDRNMVKTYELPYFANHFDIMIEYHDR 231

Query: 252 GNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATR 311
           G GNYRVVGVIV P SIKR SP TC+ TG  L L E    EV+F+YSVKF  S T WATR
Sbjct: 232 GEGNYRVVGVIVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATR 291

Query: 312 WDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETG 371
           WDKYLHVYDP IQWFSLINFSLVVV LS+V+IH L   L  D +RYN++NLDDDFQE++G
Sbjct: 292 WDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSG 351

Query: 372 WKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILY 431
           WKL HGDVFR+P +SL LS+LVGSG QLFLM  C+I FA              TVMFILY
Sbjct: 352 WKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILY 411

Query: 432 ALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPF 491
           ALFG  GSYTSM  YKFF GPYWK N++LTP+LVPG +  +++ALNFFL+ V S+G IP 
Sbjct: 412 ALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPA 471

Query: 492 GTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLI 551
            T+  +V LWFLFSIPLS AGSLIARK+C WDEHPTKT QI RQIPFQPWYLKT+PA+LI
Sbjct: 472 STLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLI 531

Query: 552 AGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW 611
           AGIFPFGSIAVELYFIY+SLWFNKIFYMFG                         CLENW
Sbjct: 532 AGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENW 591

Query: 612 KWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFL 671
           KWQWRGF IGGAGCALY+FIH+ILFTKF+LGGFTTIVLYVGYS V+SLL CL+TG++GF+
Sbjct: 592 KWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFI 651

Query: 672 SSLWFVRRIYSSVKVD 687
           SS+ FVR+IYSS+KVD
Sbjct: 652 SSMLFVRKIYSSIKVD 667

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/671 (64%), Positives = 501/671 (74%), Gaps = 21/671 (3%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFH 76
            FYLPGVAPTTYH  D IPLLVNHLTP+MY+QH +EDG  +  DKE  LYSYDYYY +FH
Sbjct: 72  AFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYYYDRFH 131

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PE +EKQ ESLGSIIFGDRIYNSPFQI ML++K C SLC  +IP  DAKFINKLI N
Sbjct: 132 FCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFINKLIKN 191

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFFQNWL+DGLPAAR+  D RTK+EFY  GFELG+V +                      
Sbjct: 192 GFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDV--------------------VQ 231

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNY 256
             T   + +     P     L    + +   +++K  E PYFANHF+I+V+YHDRG  NY
Sbjct: 232 GTTTGDNANTVAKKPTTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNY 291

Query: 257 RVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYL 316
           RVVGVIVNP SIKR +P TC+ +G  L LSE +  +V+F+YSVKF PSET+WATRWDKYL
Sbjct: 292 RVVGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYL 351

Query: 317 HVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIH 376
           H+YDP IQWFSLINFS+VV+ LS+V+IH L   L  D +RYN++NLDDDFQEE GWKL H
Sbjct: 352 HIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGH 411

Query: 377 GDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGS 436
           GDVFR P RSL+LSVLVGSG QLFLM  C+I FA              TVMFILYALFG 
Sbjct: 412 GDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGF 471

Query: 437 FGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCV 496
            GSYTSM  YKFFGGPYWKVNMLLTPILVPGL+FC ++ALN FL+ V S+G IP  T+  
Sbjct: 472 VGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFF 531

Query: 497 IVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFP 556
           ++LLWF+FSIPL++AGSLIA KKC WDEHPTKT QI RQIPFQPWYLKT PA+LIAGIFP
Sbjct: 532 MILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFP 591

Query: 557 FGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 616
           FGSIAVELYFIYSSLWFNKIFYMFG                         CLENW WQWR
Sbjct: 592 FGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWR 651

Query: 617 GFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWF 676
           GF IGG GCA+Y+FIH+ILFTKF+LGGFTTIVLYVGYS ++SLL C++TG +GFLSS++F
Sbjct: 652 GFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFF 711

Query: 677 VRRIYSSVKVD 687
           +R+IYSS+KV+
Sbjct: 712 IRKIYSSIKVE 722

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/674 (63%), Positives = 503/674 (74%), Gaps = 32/674 (4%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFH 76
            FYLPGVAPTTY E D IPLLVNHLTP+MYYQH DE+GN++ GDKE+ LYSYDYY  +FH
Sbjct: 18  AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFH 77

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PEK+EKQ ESLGSIIFGDRIYNSPFQ++ML+ KEC SLC ++IP +DAKFINKLI N
Sbjct: 78  FCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKN 137

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFFQNWL+DGLPAAR  +D RTK+ FY  GFELG+V                        
Sbjct: 138 GFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFV------------------------ 173

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVSNTKE---LVKQLETPYFANHFEIEVQYHDRGN 253
               EV++    +A P       +    +T++   +V+  E PYF NH++I ++YHDRG 
Sbjct: 174 ----EVTQGTASEATPNTAETTNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGE 229

Query: 254 GNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWD 313
           GNYRVVGVIVNP SIKR  P+TC+  G  L L E    EV+F+YSVKF  SET WATRWD
Sbjct: 230 GNYRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWD 289

Query: 314 KYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK 373
           KYLHVYDP IQWFSLINFSLVVV LS+V+IH L   L  D +RYN++NLDDDFQE++GWK
Sbjct: 290 KYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWK 349

Query: 374 LIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYAL 433
           L HGDVFR P RSL LS+LVGSG QLF M  C+I FA              TVMF+LYAL
Sbjct: 350 LSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYAL 409

Query: 434 FGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGT 493
           FG  GSYTSM  YKFF GPYWK N++LTP+LVPG +  +++ALNFFL+ V S+G IP  T
Sbjct: 410 FGFVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPAST 469

Query: 494 MCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           +  +V LWFLFSIPLS AGSL+ARKKC WDEHPTKT QI RQIPFQPWYLKTVPA+LIAG
Sbjct: 470 LFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAG 529

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKW 613
           +FPFGSIAVELYFIY+SLWFNKIFYMFG                         CLENWKW
Sbjct: 530 VFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKW 589

Query: 614 QWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSS 673
           QWRGF +GGAGCALY+FIH+ILFTKF+LGGFTTIVLYVGYS V+SLL CL+TG++GF+SS
Sbjct: 590 QWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISS 649

Query: 674 LWFVRRIYSSVKVD 687
           ++F+R+IYSS+KVD
Sbjct: 650 MFFIRKIYSSIKVD 663

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/674 (63%), Positives = 502/674 (74%), Gaps = 11/674 (1%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFH 76
            FYLPGVAPTTY E D IPLLVNHLTP+MYYQH DEDGN++ GDKE  LYSYDYYY KFH
Sbjct: 18  AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKFH 77

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PE +EKQ ESLGSIIFGDRIYNSPF++ ML+ KEC SLC   IP DDAKFINKLI N
Sbjct: 78  FCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIKN 137

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFFQNWL+DGLPAAR+  D RTK++FY  GF LG+V +                      
Sbjct: 138 GFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVA-------QVVDSETEQVQVAS 190

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVS---NTKELVKQLETPYFANHFEIEVQYHDRGN 253
             T++   +D    P   +S  +  ++      K +VK  E PYFANHF+I+++YHDRG 
Sbjct: 191 GETEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGE 250

Query: 254 GNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWD 313
           GNYRVVGVIVNP SIKR SP TC+  G  L L E    EV+F+YSVKF  S T WATRWD
Sbjct: 251 GNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWD 310

Query: 314 KYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK 373
           KYLHVYDP IQWFSLINFSLVVV LS+V+IH L   L  D +RYN++NLDDDFQE++GWK
Sbjct: 311 KYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWK 370

Query: 374 LIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYAL 433
           L HGDVFR P +SL+LS+LVGSG Q+FLM  C+I FA              TVMFILYAL
Sbjct: 371 LNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYAL 430

Query: 434 FGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGT 493
           FG  GSYTSM  YKFF GPYWK N+++TP+L+PG +  V++ALNFFL+ V S+G IP  T
Sbjct: 431 FGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPAST 490

Query: 494 MCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           +  +V LWFLFSIPLS AGSL+ARKKC WDEHPTKT QI RQIPFQPWYLKT+PA+LIAG
Sbjct: 491 LFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAG 550

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKW 613
           IFPFGSIAVELYFIY+SLWFNKIFYMFG                         CLENWKW
Sbjct: 551 IFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKW 610

Query: 614 QWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSS 673
           QWRGF +GG GCALY+FIH+ILFTKF+LGGFTTIVLY+GYS V+SLL CL+TG++GF+SS
Sbjct: 611 QWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISS 670

Query: 674 LWFVRRIYSSVKVD 687
           ++F+R+IYSS+KVD
Sbjct: 671 MFFIRKIYSSIKVD 684

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/678 (62%), Positives = 500/678 (73%), Gaps = 38/678 (5%)

Query: 16  VSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKF 75
           V  FYLPGVAPTTYHEGD +PLLVNHLTP+ +Y+H D D +D GDKE  LYSYDYYY KF
Sbjct: 20  VEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHDTGDKEGFLYSYDYYYKKF 79

Query: 76  HFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLIT 135
           HFC+P +L+KQ ESLGSIIFGDRIYNSPF++++LKN EC SLC   IP  DAKFINKLI 
Sbjct: 80  HFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLIL 139

Query: 136 NGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXX 195
           NGFFQNW++DGLPAARK  D +T   FY  GFELG V +                     
Sbjct: 140 NGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV--------------------- 178

Query: 196 XXXTKEVSESDYLDAPPAKRSLAKRKQVS-NTKELV-----KQLETPYFANHFEIEVQYH 249
                    SDY    P  RSL    ++  N K+ V     K  E PYF NH++I+++YH
Sbjct: 179 --------LSDY---EPDTRSLHDELELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYH 227

Query: 250 DRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWA 309
           DRG  NYR+VGV VNP SIKR+SPD+C+ TG+ L LSETE  EV+F+YSVKF  S+TVWA
Sbjct: 228 DRGENNYRIVGVTVNPASIKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWA 287

Query: 310 TRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEE 369
           TRWDKYLHVYDPKIQWFSLINFS +VV LS+VM+H LY  L +DL+RYN++NLD DF+EE
Sbjct: 288 TRWDKYLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEE 347

Query: 370 TGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFI 429
           TGWKLIHGDVFR+P ++L+LSVLVGSG QL LM   TI FA             +TVMF+
Sbjct: 348 TGWKLIHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFL 407

Query: 430 LYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAI 489
           LYA+FGSFGS+TSMATYKFF G  W++N++LTP+LVPG +  V+L LNFFL+ V S+GAI
Sbjct: 408 LYAIFGSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAI 467

Query: 490 PFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPAS 549
           PF TM V+VLLWF+ SIPLS  GS+IA KKC W+EHPTKT QI RQIPFQPWYLKT+P +
Sbjct: 468 PFQTMLVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVA 527

Query: 550 LIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLE 609
           L+AGIFPFGSIAVELYFIYSSLWFNKI+YMFG                         C+E
Sbjct: 528 LLAGIFPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCME 587

Query: 610 NWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVG 669
           NWKWQWR F IGG GCA Y+F H+ILFTKFRLGG TTIVLY+GYS+++S L CL+TG +G
Sbjct: 588 NWKWQWRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIG 647

Query: 670 FLSSLWFVRRIYSSVKVD 687
           FLSSL  VR+IYS VKVD
Sbjct: 648 FLSSLILVRKIYSCVKVD 665

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/674 (60%), Positives = 492/674 (72%), Gaps = 30/674 (4%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHF 77
            FYLPGVAPTTYHEGD IPLLVNHLTP++Y+Q  D +G    +KE  LYS+DYY+ + HF
Sbjct: 19  AFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS-KNKEHFLYSFDYYFDRLHF 77

Query: 78  CRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNG 137
           C+PE +EKQ ESLGSIIFGDRIYNSPF+++ML+ K C SLC  +IP  DAKFINKLI NG
Sbjct: 78  CKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNG 137

Query: 138 FFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV----GIGGSELRMNXXXXXXXXXXX 193
           FFQNWL+DGLPAA +  D +TKSEFY  GFELG+V     I G                 
Sbjct: 138 FFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA--------------- 182

Query: 194 XXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGN 253
                TK    ++          L    + +   ++VK +E  YF NH++I+V+YHDRG 
Sbjct: 183 --PATTKPKQTTN--------EGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGE 232

Query: 254 GNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWD 313
           G YRVVGVIVNP SIKR +P TC+ TG+ L LSE    +V+F+YSVKF PSETVWATRWD
Sbjct: 233 GTYRVVGVIVNPVSIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWD 292

Query: 314 KYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK 373
           KYLH YDP IQWFSL+NFS++V+ LS+V+IH L   L  D +RYN+ NL+DDFQE+ GWK
Sbjct: 293 KYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWK 352

Query: 374 LIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYAL 433
           L HGDVFR P +S++LSVLVGSG QLFLM +C+I FA              TVMFILYAL
Sbjct: 353 LGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYAL 412

Query: 434 FGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGT 493
           FG  GSYTSMA YKFF GPYWKVNMLLTP ++PG +F  ++ LNFFL+   S+G +P GT
Sbjct: 413 FGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGT 472

Query: 494 MCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           +  ++LLWF+FSIPL+ AGSLIA KKC WDEHPTKT QI RQIPFQPWYLKT PA++IAG
Sbjct: 473 LFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAG 532

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKW 613
           IFPFGSIAVELYFIY+SLWFNKIFYMFG                         CLENW+W
Sbjct: 533 IFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQW 592

Query: 614 QWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSS 673
           QWRGF +GG GCA+Y+F+H+ILFTKF+LGGF TIVLYVGYS ++SLL C++TG +GFLSS
Sbjct: 593 QWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSS 652

Query: 674 LWFVRRIYSSVKVD 687
           L FVR+IYS++KVD
Sbjct: 653 LIFVRKIYSAIKVD 666

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/675 (62%), Positives = 489/675 (72%), Gaps = 33/675 (4%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFH 76
            FYLPGVAPTTY E D IPLLVNHLTP+MYYQH DE GN + GDKE+ LYSYDYYY +FH
Sbjct: 18  AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRFH 77

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FCRP+ +EKQ ESLGS+IFGDRIYNSPF++ ML+ KEC  LC+ +IP +DAKFINKLI N
Sbjct: 78  FCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIKN 137

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFFQNWL+DGLPAAR+  D RTK+ FY  GFELG V                        
Sbjct: 138 GFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDV------------------------ 173

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVSNTK----ELVKQLETPYFANHFEIEVQYHDRG 252
               EVS+       P +           T+     +V+  E PYFANHF+I ++YHDRG
Sbjct: 174 ----EVSQGTRSKTAPKQAETTNEGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRG 229

Query: 253 NGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRW 312
            G+YRVVGVIVNP SIKR    TC+     L L E    EV F+YSVKF  S T WATRW
Sbjct: 230 GGDYRVVGVIVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRW 289

Query: 313 DKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGW 372
           DKYLHVYDP IQWFSLINFSLVVV LS+V+IH L   L  D +RYN++NL+DDFQE++GW
Sbjct: 290 DKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGW 349

Query: 373 KLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYA 432
           KL HGDVFR P  SL+LS+LVGSG QLFLM  C+I FA              TVMFILYA
Sbjct: 350 KLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYA 409

Query: 433 LFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFG 492
           LFG  GSYTSM  YKFF GPYWK N+LLTP+LVPG +  +++ALNFFL+VV S+G IP  
Sbjct: 410 LFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPAR 469

Query: 493 TMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIA 552
           T+  +V LWFLFSIPLS  GSLIARKKC WDEHPTKT QI RQIPFQPWYLKT+PA+LIA
Sbjct: 470 TLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIA 529

Query: 553 GIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK 612
           GIFPFGSIAVELYFIY+SLWFNKIFYMFG                         CLENWK
Sbjct: 530 GIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWK 589

Query: 613 WQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLS 672
           WQWRGF +GG GCALY+FIH+ILFTKF+LGGF TIVLYVGYS V+SLL CL+TG++GF+S
Sbjct: 590 WQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFIS 649

Query: 673 SLWFVRRIYSSVKVD 687
           S++F+RRIYSS+KVD
Sbjct: 650 SMFFLRRIYSSIKVD 664

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/671 (59%), Positives = 488/671 (72%), Gaps = 17/671 (2%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFH 76
           GF LPG++PTTYH GD IPLLVN LTP++Y+QH DE+GND+ GDKE  LYSYDYY  +FH
Sbjct: 18  GFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFH 77

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FCRPE +EKQ ESLGS+IFGDRIYNSPFQ+ ML+ KEC +LC  +IP  DAKFIN LI +
Sbjct: 78  FCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKS 137

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFFQNWLVDGLPAARK  D RTK+ +Y  GFELG+  +  +                   
Sbjct: 138 GFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQT--------VDGKAVPSTME 189

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNY 256
             T E S  D +        L  R   +    LVK +E PYF NHF+IEV++HDRGN NY
Sbjct: 190 ELTSEASNEDVI--------LDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNY 241

Query: 257 RVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYL 316
           RVVGVIVNP SI+R SP  C  TG+ L L E +  EV+F+YSVKF  S+TVWATRWDKYL
Sbjct: 242 RVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYL 301

Query: 317 HVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIH 376
           H+YDP+IQWFSLINFS++V+ LS+V++H L   L  DL+RYN++NLD++F E++GWKL H
Sbjct: 302 HIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGH 361

Query: 377 GDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGS 436
           GDVFRTP +S++LS+LVGSG QLFLM  C+I FA              TVMF+LYALFG 
Sbjct: 362 GDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGF 421

Query: 437 FGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCV 496
            GSY SM  YKFF GPYWK NM+LTPIL+PG +F +++ +NFFL+   S+G IP  ++  
Sbjct: 422 VGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFF 481

Query: 497 IVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFP 556
           I+LLWFL S+PLS AGS++A K+C WDEHPTKT QI RQIP+QPWYL+T  A+LIAGIF 
Sbjct: 482 IILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFS 541

Query: 557 FGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 616
           FGSIAVELYFIYSSLWFNKIFYMFG                         CLENW WQWR
Sbjct: 542 FGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWR 601

Query: 617 GFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWF 676
            F IGG GC++Y FIH+ILFTKF+LGG  T+VLY+GYSL++S L C++TG +GF SS++F
Sbjct: 602 SFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFF 661

Query: 677 VRRIYSSVKVD 687
           +R+IYS++KV+
Sbjct: 662 IRKIYSAIKVE 672

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/675 (60%), Positives = 500/675 (74%), Gaps = 32/675 (4%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYYPKFH 76
            FYLPGVAPTTYHEGD IPLLVNHL+P+MY+QH +++G D+  DK   LYSYDYYY +FH
Sbjct: 17  AFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRFH 76

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PEK+EKQ ESLGSI+FGDRIYNSPFQ+ ML+ K+CASLC  +IP +DAKFINKLI N
Sbjct: 77  FCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIKN 136

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV----GIGGSELRMNXXXXXXXXXX 192
           GFFQNWL+DGLPAA +  D RT ++FY  GFELG V     +  +E R            
Sbjct: 137 GFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTK---------- 186

Query: 193 XXXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRG 252
                     ++   LDA  AK          N K  +K +E  YF NH++I ++YHDRG
Sbjct: 187 ------VAAANQGAELDARDAK----------NVKT-IKNVELVYFVNHYDIRIEYHDRG 229

Query: 253 NGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRW 312
           NG+YRVVGVIVNP SI+R SP +C+ TG+ L L E E  +V+F+YSV F PSET WATRW
Sbjct: 230 NGDYRVVGVIVNPVSIQRSSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRW 289

Query: 313 DKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGW 372
           DKYLHVYDP IQWFSL+NFSL+V+ LSTV++H L   L +D +RYN+ NLDD+FQE+ GW
Sbjct: 290 DKYLHVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGW 349

Query: 373 KLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYA 432
           KL HGDVFR P +S++LSVLVGSG QLF+M + TI FA              TVMF+LYA
Sbjct: 350 KLCHGDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYA 409

Query: 433 LFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFG 492
           LFG  GSYTSM  YKFF GPYWK NM+LTPILVPG +F  ++A+NFFL+ V S+G IP  
Sbjct: 410 LFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAK 469

Query: 493 TMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIA 552
           T+  +VLLWF+FSIP + AGSL+A KKC W+EHPTKT+QI RQIPFQPWYLKT+PA+ IA
Sbjct: 470 TLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIA 529

Query: 553 GIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK 612
           GIFPFGSIAVE+YFIY+SLW+NKIFYMFG                         CLENW 
Sbjct: 530 GIFPFGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWN 589

Query: 613 WQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLS 672
           WQWR F +GG GCA+Y+FIH+ILFTKF+LGGFTT+VLY+GYS ++SLL C++TG++GFLS
Sbjct: 590 WQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLS 649

Query: 673 SLWFVRRIYSSVKVD 687
           S++FVR+I+SS+KVD
Sbjct: 650 SMFFVRKIFSSIKVD 664

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/679 (59%), Positives = 484/679 (71%), Gaps = 46/679 (6%)

Query: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKF 75
           S FYLPGVAPTTY +GD IPLLVNHLTP++ +QH D+ GND+ G+KE  LYS+DYY+PK 
Sbjct: 18  SAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKL 77

Query: 76  HFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLIT 135
           HFC+PE +EKQ ESLGSI+FGDRIYNSPF I+ML+N+EC SLC  +IPADDAKFINKLI 
Sbjct: 78  HFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIK 137

Query: 136 NGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV-------GIGGSELRMNXXXXXX 188
           NGFFQNWL+DGLPAARK  DV+TKS+FY  GF LG V       G+  S+L +       
Sbjct: 138 NGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLEN----- 192

Query: 189 XXXXXXXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQY 248
                                  PA+       +  N   +V  +E P+  NH++I V+Y
Sbjct: 193 -----------------------PAR-------EAKNVNNMVHNVEIPFLFNHYDINVEY 222

Query: 249 HDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVW 308
           HDRG GNYRVVGV V+P   K  + D C K    L L ETE  EV FSYSV+F PSETVW
Sbjct: 223 HDRGEGNYRVVGVTVDP---KSSTGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVW 279

Query: 309 ATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQE 368
           ATRWDKYLHVYDP IQWFSLINFS+VV+ LS V+IH L   L  D +RY + NLDD FQ+
Sbjct: 280 ATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQ 339

Query: 369 ETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMF 428
           ++GWKL HGDVFR P++S++LS+LVGSG QLFLM A +I FA              + MF
Sbjct: 340 DSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMF 399

Query: 429 ILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGA 488
           ILYALFG  GSY SM  YKFF GPYWK NM+LTPILVPGLLF  ++ LNFFL+   S+G 
Sbjct: 400 ILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGT 459

Query: 489 IPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPA 548
           IP   +  +++LWF+ SIPLS+AGSLIA KKC W EHPTKT +I RQIPFQPWYLKTVPA
Sbjct: 460 IPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPA 519

Query: 549 SLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCL 608
           +LIAG+FPFGSIAVELYFIYSSLWFNKIFYMFG                          L
Sbjct: 520 TLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNL 579

Query: 609 ENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTV 668
           ENW+WQWR F +GG GCA Y+F+H+I+FTKF+LGGFTTIVLYVGYSL++S L  ++TG +
Sbjct: 580 ENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAI 639

Query: 669 GFLSSLWFVRRIYSSVKVD 687
           GF+SS+ FV++IYSSVKVD
Sbjct: 640 GFISSMLFVKKIYSSVKVD 658

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/673 (60%), Positives = 489/673 (72%), Gaps = 42/673 (6%)

Query: 16  VSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPK 74
           V  FYLPGVAPTTYH  D I LLVNHLTP+M +QH DEDGN + GDKE  LYSYDYYY K
Sbjct: 16  VKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYSK 75

Query: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134
           FHFC+PE + +Q  SLGS+IFGDRI+NSPF++ ML+ KEC  LCS  IP +DAKF+NKLI
Sbjct: 76  FHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLI 135

Query: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXX 194
            NGF QNWL+DGLPA R+  D RT S FY  GF+LG+V +                    
Sbjct: 136 KNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDV-------------------- 175

Query: 195 XXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254
               T+  S+S+                    K+++K LE PY ANH++I ++YHDRGN 
Sbjct: 176 ----TEGFSDSN-----------------DEEKKIMKTLEVPYLANHYDINIEYHDRGND 214

Query: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314
           NYRVVGV V+P SIKR S D+C      L LSETE  EVHF+YSVKF  S+TVWATRWDK
Sbjct: 215 NYRVVGVTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDK 274

Query: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374
           YLHVYDP IQWFSLIN S++VV LS+V++H L   L +DLSRYN+ NLD++F E++GWKL
Sbjct: 275 YLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKL 334

Query: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALF 434
            HGDVFR P RSL+LS+LVGSG QLFLM AC+I FA              TVMF+LYALF
Sbjct: 335 SHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALF 394

Query: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494
           G  GSYTSMA YKFF GP WKVN+LLTP+LVPG +F  ++ LNFFLV V S+GAIP GT+
Sbjct: 395 GFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTL 454

Query: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554
             I+LLWF+FSIPLS AGSLIA K+C+ D HPTKT QI RQIP QPWYLKT+P SLIAG+
Sbjct: 455 FTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGV 514

Query: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQ 614
           FPF SIAVELYFIY+SLWFNKIFYMFG                         CLENWKWQ
Sbjct: 515 FPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQ 574

Query: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674
           WR F IGG GCA+Y+FIH+ILFTKF+LGGFTT+VLY+GYS ++S+L C++TG++GF+SS+
Sbjct: 575 WRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSM 634

Query: 675 WFVRRIYSSVKVD 687
           +F+R+IYSSVKVD
Sbjct: 635 FFIRKIYSSVKVD 647

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/671 (58%), Positives = 484/671 (72%), Gaps = 17/671 (2%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYYPKFH 76
            F LPG++PTTYH+ D IPLLVN LTP++Y+QH DE+G D+  DKE  LYSYDYY  +FH
Sbjct: 36  AFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNERFH 95

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FCRPE +E+Q ESLGSIIFGDRIYNSPFQ+ ML+ KEC +LC  +IP  DAKFINKLI +
Sbjct: 96  FCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKLIKS 155

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFFQNWLVDGLPAARK  D RTK+ +Y  GFELG   +  +                   
Sbjct: 156 GFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNT-------------IDGKVI 202

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNY 256
             T E  +S+  +   A   L  R+  +    LVK +E PYF NHF+IEV++HDRG+ NY
Sbjct: 203 PSTMEELDSETSNTGAA---LDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNY 259

Query: 257 RVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYL 316
           RVVGV VNP SI+R SPD+C K  + L L E    E++F+YSVKF  S+TVWATRWDKYL
Sbjct: 260 RVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYL 319

Query: 317 HVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIH 376
           H+YDP+IQWFSLINFS+++V LS+V++H L   L  DLSRYN++NLD++F E++GWKL H
Sbjct: 320 HIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGH 379

Query: 377 GDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGS 436
           GDVFRTP +S++LSVLVGSG QLFLM  C+I  A              TVMF+ YALFG 
Sbjct: 380 GDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGF 439

Query: 437 FGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCV 496
            GSYTSM  YKFF GPYWK N++LTPIL+PG +F +++A+NFFL+   S+G IP  T+  
Sbjct: 440 VGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFF 499

Query: 497 IVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFP 556
           I+ LWF  SIPLS AGS+IA K C WDEHPTKT QI RQ+P+QPWYL+T+ A+LIAGIF 
Sbjct: 500 IIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFC 559

Query: 557 FGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 616
           FGSIAVELYFIYSSLWFNKIFYMFG                         CLENW+WQWR
Sbjct: 560 FGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWR 619

Query: 617 GFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWF 676
            F IGG GC++YMFIH+ILFTKF+LGGF TIVLY GYS ++S L C++TG +GF S + F
Sbjct: 620 SFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLF 679

Query: 677 VRRIYSSVKVD 687
           +R+IYS+VK++
Sbjct: 680 IRKIYSAVKIE 690

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/677 (58%), Positives = 482/677 (71%), Gaps = 29/677 (4%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYYPKFH 76
            F LPGV+PTTY   D IPLLVN LTP++Y+QH DE+G D+  DKE  LYSYDYY  KFH
Sbjct: 18  AFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKFH 77

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PE +EKQ ESLGS+IFGDRIYNSPFQ++ML++KEC +LC  +IP  DAKFIN LI N
Sbjct: 78  FCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIKN 137

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGI----GGSELRMNXXXXXXXXXX 192
           GFFQNWLVDGLPAAR   D RTK+ +Y  GFELG+  +    GG  +             
Sbjct: 138 GFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIP------------ 185

Query: 193 XXXXXXTKEVSESDYLDAPPAKR--SLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHD 250
                     S  + LD+  +K   +L  R   +    LV+ +E  +F NHF I+V+YHD
Sbjct: 186 ----------STMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHD 235

Query: 251 RGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWAT 310
           RGNGNYRVVGV VNP SI+R SP  C  TGE L L E +  +V+F+YSVKF  S+TVWAT
Sbjct: 236 RGNGNYRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWAT 295

Query: 311 RWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEET 370
           RWDKYLHVYDP+IQWFSLINFS++V+ LS+V+IH +   +  D +RYN++NLD++F E+ 
Sbjct: 296 RWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDA 355

Query: 371 GWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFIL 430
           GWKL HGDVFR P +S++LSVLVGSG QLFLM  C+I FA              TVMF+L
Sbjct: 356 GWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVL 415

Query: 431 YALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIP 490
           YALFG  GSYTSM  YKFF GPYWK N+++TPIL+PG +F +++A+NFFL+   S+G IP
Sbjct: 416 YALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIP 475

Query: 491 FGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASL 550
             T+  I+ LWF  SIPLS AGS IA K+CKWDEHPTKT QI RQ P QPWYL+T+ A+L
Sbjct: 476 ARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATL 535

Query: 551 IAGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLEN 610
           IAGIF FGSIAVELYFIYSSLWFNKIFYMFG                         CLEN
Sbjct: 536 IAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLEN 595

Query: 611 WKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGF 670
           W WQWR F IGG GC++YMFIHAILFTKF+LGGF T+VLYVGYS ++S L C++TG +GF
Sbjct: 596 WSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGF 655

Query: 671 LSSLWFVRRIYSSVKVD 687
            SS+ F+R+IYS +KV+
Sbjct: 656 FSSMIFIRKIYSRIKVE 672

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/679 (57%), Positives = 483/679 (71%), Gaps = 13/679 (1%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFH 76
           GFYLPG AP TY +GDAIPLLVNHLTP++ +QH D+DGN++ GDK  +LY YDYY  K H
Sbjct: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PEK+EKQ ESLGS+IFG++IYNSPF ++ML++ EC  LCS +IP  DAKFINKLI N
Sbjct: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV----GIGG---SELRMNXXXXXXX 189
           GF QNWL+DGLPAARK  D RT +EFY  GFELG+V     +GG   SE           
Sbjct: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196

Query: 190 XXXXXXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYH 249
                     +  S  + +D      +L  R+  +    +V  +E P FANHF+IEV+YH
Sbjct: 197 AKNIIDFTDIEIRSPKNLVDL----SNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYH 252

Query: 250 DRGNGNYRVVGVIVNPYSIKRESPDTCDKTGE-LLKLSETEATEVHFSYSVKFTPSETVW 308
           DRGNG++RVVGVIVNP S+      +C    +  L L E +  EV F+YSVKFTPS+T W
Sbjct: 253 DRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPW 312

Query: 309 ATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQE 368
           ATRWDKYLH+YDPKIQWFSLINFS++V+ LS+V IH L   L  D+SRYN+ NL D+F+E
Sbjct: 313 ATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEE 372

Query: 369 ETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMF 428
           ++GWKL+HGDVFRTP+ S++LSVLVGSG QLFLM   +I  +              T MF
Sbjct: 373 DSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAMF 432

Query: 429 ILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGA 488
           + YA+FG  GSYTSM  YKFF GPYWK NM+LTP+L+PG++F  ++ +N  L  V S+  
Sbjct: 433 MFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNV 492

Query: 489 IPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPA 548
           IP  T+  +V LW LFSIPL+ AGSLI+ KKC WDEHPTKT +IPRQIPFQPW+LKTVPA
Sbjct: 493 IPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPA 552

Query: 549 SLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCL 608
           +LI G+  FGSIAVELYFIYSSLWFNKIFYMFG                         C 
Sbjct: 553 TLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCS 612

Query: 609 ENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTV 668
           ENW WQWR F+IGG GC++Y+FIH+ILFT+F+LGGF TIVLYVGYS ++S L+C++TG +
Sbjct: 613 ENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAI 672

Query: 669 GFLSSLWFVRRIYSSVKVD 687
           GF+ S++FVRRI++S+KVD
Sbjct: 673 GFICSMFFVRRIFASIKVD 691

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/674 (57%), Positives = 481/674 (71%), Gaps = 23/674 (3%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYYPKFH 76
            F LPG++PTTYH  D IPLLVN LTP++Y+QH DE+GND+  DKE  LYSYDYY  +FH
Sbjct: 18  AFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERFH 77

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FCRPE +EKQ ESLGS+IFGDRIYNSPFQ+ ML+ KEC +LC  +IP  DA+FIN+LI +
Sbjct: 78  FCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLIIS 137

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGI---GGSELRMNXXXXXXXXXXX 193
           GFFQNWLVDGLPAAR   D RTK+ +Y  GFELG+  +    G E   N           
Sbjct: 138 GFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNT---------- 187

Query: 194 XXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGN 253
                   + E+D +DA  A  +L  R   +     VK +E PYF NHFEI V++H+RGN
Sbjct: 188 --------MEEAD-MDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGN 238

Query: 254 GNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWD 313
            +YR+VGV VNP SI+R SP +C +T + L L E    EV+F+YSVKF  S TVWATRWD
Sbjct: 239 DSYRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWD 298

Query: 314 KYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK 373
           KYLH+YDP+IQWFSLI FS++V+ LS+ +IH L   L  DL+RYN++NL+++F E+ GWK
Sbjct: 299 KYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWK 358

Query: 374 LIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYAL 433
           L HGDVFRTP +S++LSVLVGSG QLFLM  C+I FA              TVMF+LYAL
Sbjct: 359 LSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYAL 418

Query: 434 FGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGT 493
           FG  GSYTSM  YKFF GPYWK N+++TPIL+PG +  +++A+N FL+   S+G IP  +
Sbjct: 419 FGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKS 478

Query: 494 MCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           +  I+ LWF+ SIPLS  GS++A K+C W+EHPTKT QI RQIP QPWYL+T  A+++AG
Sbjct: 479 LFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAG 538

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKW 613
           IF FGSIAVELYFIYSSLWFNKIFYMFG                         CLENW W
Sbjct: 539 IFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLW 598

Query: 614 QWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSS 673
           QWR F IGG GC++YMFIH+ILFTKF+LGGF T+VLY+GYS +MS+L C++TG +GF SS
Sbjct: 599 QWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSS 658

Query: 674 LWFVRRIYSSVKVD 687
           + F+R+IY +VKV+
Sbjct: 659 MIFIRKIYYAVKVE 672

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/674 (59%), Positives = 484/674 (71%), Gaps = 25/674 (3%)

Query: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYP 73
           QV+ FYLPGVAPTTY   D IPLLVNHL+P+MY+QH  EDG ++ GDK   LYSYDYYY 
Sbjct: 18  QVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYD 77

Query: 74  KFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKL 133
           +FHFC+PEK+ K+ ESLGSIIFGDRIYNSP+QI+ML+ K C  LC+  IP  DA+FINKL
Sbjct: 78  RFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKL 137

Query: 134 ITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXX 193
           I NGFFQNWL+DGLPAAR   D  T S+FY  GFELG V +                   
Sbjct: 138 IKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEV------------------V 179

Query: 194 XXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGN 253
                 K   + D  D+  AK S    K V    +++K +E PYFANH +I V+YHDRG 
Sbjct: 180 QAVAQAKTHPKED--DSGSAKLSTRDAKNV----QMLKNVELPYFANHHDITVEYHDRGE 233

Query: 254 GNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWD 313
           GN RVVGV V+P SIKR SP TC  +G+ L L E    EV+F+YSV+F  S+TVWATRWD
Sbjct: 234 GNLRVVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWD 293

Query: 314 KYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK 373
           KYLH YDP IQWFSL+NFS+VVV LS+V+IH L   L  D +RYN++NLD++FQE++GWK
Sbjct: 294 KYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWK 353

Query: 374 LIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYAL 433
           L HGDVFR P +S++LS+LVGSG QLFLM + +I FA              TVMF+LYAL
Sbjct: 354 LTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYAL 413

Query: 434 FGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGT 493
           FG  GSYTSM  YKFF GPYWK NM+LTP+LVPG L   ++ LN FL+   S+G IP  T
Sbjct: 414 FGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKT 473

Query: 494 MCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           +  IVLLWF+ S+P ++AGSLIA KKC WDEHPTKT Q+ RQ+PFQPWYLKTV A+ IAG
Sbjct: 474 LFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAG 533

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKW 613
           IFPFGSIAVELYFIY+SLW+NKIFYMFG                          LENW+W
Sbjct: 534 IFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQW 593

Query: 614 QWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSS 673
           QWR F +GG GCA+YMF+H+ILFTK +LGGF TIVLYVGYS V+SLL CL+TG++GFLSS
Sbjct: 594 QWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSS 653

Query: 674 LWFVRRIYSSVKVD 687
           ++FVRRIYSS+KV+
Sbjct: 654 MFFVRRIYSSIKVE 667

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/673 (55%), Positives = 464/673 (68%), Gaps = 25/673 (3%)

Query: 16  VSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGD-KESLLYSYDYYYPK 74
           V  F LPG+ P TY +GD IPLLVNHLTP+M++ H +E+G D+   K+ +++SYDYYY K
Sbjct: 15  VEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYYYEK 74

Query: 75  FHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134
           FHFC+P  +EK   S+GSI+FGDRIYNSPFQ+ ML+NK C  LC   IP  DA+FINKLI
Sbjct: 75  FHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFINKLI 134

Query: 135 TNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXX 194
            NG++QNW +DGLPAAR+  D RTKS FY  GFELG V     E+R              
Sbjct: 135 KNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLV-----EIR-------------- 175

Query: 195 XXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNG 254
                +   +    D+      LAKR   +  + L+K++E PYF NHF+I ++YH+RGNG
Sbjct: 176 -----QTTGDKLLPDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNG 230

Query: 255 NYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDK 314
           NYRVVG  VNP SI R+S   C  TG+ L L+E E   VH +YSV F PS+T W TRWDK
Sbjct: 231 NYRVVGATVNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDK 290

Query: 315 YLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKL 374
           YLHVYDPKIQWFSLINFSL+V+ LS ++I+ L   L  D +RYN INLDDD +EE+GWKL
Sbjct: 291 YLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKL 350

Query: 375 IHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALF 434
           +HG VFR P+  +ILS+LVGSG QLFL+  CT+  A              T M ILY LF
Sbjct: 351 VHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILF 410

Query: 435 GSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTM 494
           G   SY SM  YKFF GPYWKVNMLLTPILVPGL+    LALN FL+  ES+  +P  T+
Sbjct: 411 GFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTI 470

Query: 495 CVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGI 554
             ++LLWF  SIPLSVAGSL+A+KKC WDEHPT T QI + IP Q WYLKT+PASLI G+
Sbjct: 471 MTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGL 530

Query: 555 FPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQ 614
           F FGSI+V+LYFIY+SLWFN IFYM+G                         C ENWKWQ
Sbjct: 531 FSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQ 590

Query: 615 WRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSL 674
           WRGF+IGG GC++Y+ +H++ F + +LGGFT I+LY+GYS V++ L  L+TG+VGFLSS+
Sbjct: 591 WRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSM 650

Query: 675 WFVRRIYSSVKVD 687
           +F++RI+SSVKVD
Sbjct: 651 FFIKRIFSSVKVD 663

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/674 (56%), Positives = 478/674 (70%), Gaps = 19/674 (2%)

Query: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYYPKF 75
           +GFYLPGVAPTTYHE D+IPLLVNHLTP+M+++H D DGN+L  DKE+ LYSYDYYY K 
Sbjct: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78

Query: 76  HFCRP--EKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKL 133
           HFC+P   +++KQ ESLGSI+FGDRIYNSPF+++ML ++ C  LCS +IP DDAKFIN L
Sbjct: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138

Query: 134 ITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXX 193
           I +GF QNWL+DGLPAAR+  D  TKS FY  GFELG V        M            
Sbjct: 139 IKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSV-------EMIQVVDEAPSHTT 191

Query: 194 XXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGN 253
                 ++V   + LD   A    A +        LV  +E  YFANHF+I ++YHDRGN
Sbjct: 192 PKQPIVEDVLSQE-LDEEQATEKRANQM-------LVSSVERTYFANHFDIHIEYHDRGN 243

Query: 254 GNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWD 313
             YR+VGV VNP S+KR+S   CD     L LSE   T+V F+YSV F  S+TVWATRWD
Sbjct: 244 NEYRIVGVTVNPISMKRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWD 302

Query: 314 KYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK 373
           KYLH+YDP IQWFSLINF+++VV LS +++H L   L +D  RYN+ NL+D F E++GWK
Sbjct: 303 KYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWK 362

Query: 374 LIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYAL 433
           L HGDVFR P +S++LS+ VGSG QLF M +  +  A              T+MFILYA+
Sbjct: 363 LAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAV 422

Query: 434 FGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGT 493
           FG  GSYTSM  Y+FF GPYWK NM+LTP++VPG +F  ++++N FLV V S+  +P GT
Sbjct: 423 FGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGT 482

Query: 494 MCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           + ++VLLW + S+PLS AGSLI+ K+C W +HPTKT ++ RQIPFQPWYLKTVPA+LI G
Sbjct: 483 LSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGG 542

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKW 613
           IFPFGSIAVELYFIYSSLWFNKIFYMFG                         CLENW+W
Sbjct: 543 IFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRW 602

Query: 614 QWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSS 673
           QWR F IGG GC++Y+FIH+ILFT+F+LGGF TIVLYVGYS ++++L  ++TG +GF+S+
Sbjct: 603 QWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISN 662

Query: 674 LWFVRRIYSSVKVD 687
           ++FV++IYSS+KV+
Sbjct: 663 MFFVKKIYSSIKVE 676

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/676 (55%), Positives = 471/676 (69%), Gaps = 11/676 (1%)

Query: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFH 76
           + FYLPGVAP+TY+EGD +PLLVNHLTP++ YQ  D+ G  +  +E +LYS+DYY+PK H
Sbjct: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH 75

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
           FC+PEK+ KQ +SLGSI+FGDRIYNSPF I+MLK +    LCS +IP  DAKFINKLI N
Sbjct: 76  FCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKN 135

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV----GIGGSELRMNXXXXXXXXXX 192
           GFFQNWL+DGLPAARK  D  T +EFY  GF LG+V     +GG  + M+          
Sbjct: 136 GFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGKKN 195

Query: 193 XXXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRG 252
                      + D      + +   ++++     +LV  +E PY ANH+ I V+ HDRG
Sbjct: 196 SNSDKKKDSKKKDDSQKKEDSNKK--EKREPKRISKLVHNVEFPYLANHYVINVEVHDRG 253

Query: 253 NGNYRVVGVIVNPYSIKRESPDTCD-KTGELLKLSETEATEVHFSYSVKFTPSETVWATR 311
            GNYRVVGV V+PYS    + D+ + + G  L L E +  EV FSYSV F  SETVWATR
Sbjct: 254 EGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVTFSYSVNFIESETVWATR 309

Query: 312 WDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETG 371
           WDKYLH Y+P IQWFSL+NFS++V+ LS ++ + L   L  D +RY + NLD+ F E++G
Sbjct: 310 WDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNEDSG 369

Query: 372 WKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILY 431
           WKL HGDVFR P +S++LS+LVGSGAQLFLM   +I  A              + MF  Y
Sbjct: 370 WKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFTFY 429

Query: 432 ALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPF 491
           ALFG +GSY SM+ YKFF GPYWK NM+LTP+LVPG +   +L LNFFL+ V S+G IP 
Sbjct: 430 ALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTIPM 489

Query: 492 GTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLI 551
             + +IV++WF+ S+PLS  GSL+A K+  W EHPTKT QI RQIPFQ WYLKT+PA LI
Sbjct: 490 TALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAILI 549

Query: 552 AGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW 611
           AGIFPFG+IAVELYFIY+SLWFNKIFYMFG                         C+ENW
Sbjct: 550 AGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCMENW 609

Query: 612 KWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFL 671
            WQWR F IGG GC+LY+FIH+ILFTKF+LGGFTT++LY+GY+L++S+LSC++TG VGF+
Sbjct: 610 NWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVGFI 669

Query: 672 SSLWFVRRIYSSVKVD 687
           SS+ FVR+IYS+V+VD
Sbjct: 670 SSMIFVRKIYSNVRVD 685

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/671 (57%), Positives = 474/671 (70%), Gaps = 34/671 (5%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQ-HADEDGNDLGDKESLLYSYDYYYPKFH 76
           GFYLPG APTTY  GDAIPLLVNH+TPT++    A  DG    DKE  LY+YDYYYP+ H
Sbjct: 16  GFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQR--DKERYLYAYDYYYPRLH 73

Query: 77  FCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITN 136
            CRP+K+EK  ESLGSIIFGDR++NSPF+++ML+ K C +LC +++PA+DAKFIN+LI +
Sbjct: 74  MCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRS 133

Query: 137 GFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXX 196
           GFF NWLVDGLPA R+  D RT + FY  GFELG V I G+E                  
Sbjct: 134 GFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-IRGTE------------------ 174

Query: 197 XXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNY 256
                    D     P +  L  R+ +   + +V     PYF NHFEI V YH R     
Sbjct: 175 ---------DRNQEEPGEIELQTRRVLQPGESVVA---VPYFINHFEITVDYHKRAEDEL 222

Query: 257 RVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYL 316
           RVVGV V P S++    D C  +G  L LSET  T+V F+YSV+F  S+  WATRW KYL
Sbjct: 223 RVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYL 282

Query: 317 HVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIH 376
           HVYDPK+QW+SLINFSLVV+ LS++M+H L+  L  DL RYN  NLD++FQE+ GWKL+H
Sbjct: 283 HVYDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLH 342

Query: 377 GDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGS 436
            DVFR+P ++L+LSV VGSG QLFLM+ACT+  A              T+MF+LYA+FG 
Sbjct: 343 SDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGG 402

Query: 437 FGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCV 496
           FGSY SM+TYK FGG  WKVNM+LTP+LVPG++F  ML +NFFLV+V+S+GA+PFGTM  
Sbjct: 403 FGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLA 462

Query: 497 IVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFP 556
           IV+LWF+ SIP+S+ GSL ARKK  WD+HPTKT QI +QIP QPWYL+T PA+ IAG+FP
Sbjct: 463 IVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFP 522

Query: 557 FGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWR 616
           FG+IAVELYFIY+S+WFN +FYMFG                         C+ENW WQWR
Sbjct: 523 FGAIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWR 582

Query: 617 GFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWF 676
            F IGG GC+ Y+FI++ILFTKFRLGGF TIVLYVGYSL++S L CL+TGT+GF+SSLWF
Sbjct: 583 SFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWF 642

Query: 677 VRRIYSSVKVD 687
           VR+IYSS+KVD
Sbjct: 643 VRKIYSSIKVD 653

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/675 (53%), Positives = 468/675 (69%), Gaps = 27/675 (4%)

Query: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLG-DKESLLYSYDYYYPKF 75
           + FY+PG++  TYH GD I L VN LTP+MY++H DE+G  +  DKE  LYSYDYYY KF
Sbjct: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79

Query: 76  HFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLIT 135
           HFCRPEK+E++ ESLGS++FGDRIYNSPF++ ML+ KEC  LC  +IPADDAKFINKLI 
Sbjct: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139

Query: 136 NGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGI----GGSELRMNXXXXXXXXX 191
           NGFF NWL+DGLP+ARK  D +T+S FY+ GF LG V +    GGS++ +          
Sbjct: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTI---------- 189

Query: 192 XXXXXXXTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDR 251
                  +K V+E        A ++  KR+  +    L+   E  YFANHF I ++YHDR
Sbjct: 190 ----PGVSKLVNE--------AVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDR 237

Query: 252 GNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATR 311
           GN NYRVVGV V+P SIKR+  ++C  TG  L L+E    +V F+YSV F  SET WATR
Sbjct: 238 GNNNYRVVGVTVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATR 297

Query: 312 WDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETG 371
           WDKYLH YDP IQWFSLINF++VVV LST++IH L   L  D+SRY  +NLD+ F E++G
Sbjct: 298 WDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSG 357

Query: 372 WKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILY 431
           WKL HGDVFR P ++++LS+ VGSG QLFLM  C +  A              T MF+LY
Sbjct: 358 WKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLY 417

Query: 432 ALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPF 491
           A+FG  GSYTSM  YKFF GPYWK NM+LTP+LVPG +  +++ LNFFL+ V S+G IP 
Sbjct: 418 AIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPA 477

Query: 492 GTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLI 551
            T+ +++ LW L S+PLS  GS +A KKC W+++PT   +IPR+IP QPWY++++P  L+
Sbjct: 478 STIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLL 537

Query: 552 AGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW 611
           +GI PFG+IAVELYFIYSSLW+NKIFYMFG                         CLENW
Sbjct: 538 SGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENW 597

Query: 612 KWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFL 671
           +WQWR F  GG GCA Y+F+++I FT+F+  GF +I+LY+GYS ++ ++SCLITG V F+
Sbjct: 598 RWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFM 657

Query: 672 SSLWFVRRIYSSVKV 686
            +++FV+RI++S+KV
Sbjct: 658 CNMFFVKRIFTSIKV 672

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/669 (51%), Positives = 444/669 (66%), Gaps = 32/669 (4%)

Query: 20  YLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYYPKFHFC 78
           +LPG++PT Y     I L VNHLTP+ ++QH D+DGN++  DKE  LYSYDYY  K HFC
Sbjct: 19  FLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFC 78

Query: 79  RPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGF 138
           +PE + +Q ESLGS++FGDR+YNSPF++ ML++K C SLC   IP +DA FINKLI NGF
Sbjct: 79  KPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGF 138

Query: 139 FQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXX 198
             NWLVDGLPA     + R  S   T GF LG V I                        
Sbjct: 139 LHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEI------------------------ 174

Query: 199 TKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYRV 258
             +   +  +  P  +  ++     ++   +V  LE P+  NH++I +QYH+   G YR+
Sbjct: 175 -MQGVHNGAMATPREETGIS-----AHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRI 228

Query: 259 VGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYLHV 318
           VGV V P SIK+ S ++C+ TGE + LSE +  EV ++YSV++      WATRWD Y   
Sbjct: 229 VGVEVEPKSIKQTS-NSCEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFS 287

Query: 319 YDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGD 378
           YD  +QWFSLI+  +VV+ LS+V++H L   L  D +RYN++NLDD+F EE+GWKL HGD
Sbjct: 288 YDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGD 347

Query: 379 VFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGSFG 438
           VFR P +SL+LSVLVGSG QL L+A   I  A              T+ F+LYALFG  G
Sbjct: 348 VFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVG 407

Query: 439 SYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIV 498
           SY SM  Y+FF GPY KVNM+LTP L+PGL+   +++LNFFL++  S+ AIPF  +  +V
Sbjct: 408 SYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVV 467

Query: 499 LLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFPFG 558
           LLW + S+PLS+AGSL A K C WD+HPTKT QI RQIPFQPWYLKT+PA+L+AGIFPF 
Sbjct: 468 LLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFA 527

Query: 559 SIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGF 618
           SIAVELYFIY+SLWF++ FYMFG                         CLENW+WQWR F
Sbjct: 528 SIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSF 587

Query: 619 WIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVR 678
            +GG G A+Y+FIH+I FT+F+L GFTTIVLYVGYS+++S+L CL TG VGF SS++ VR
Sbjct: 588 IVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVR 647

Query: 679 RIYSSVKVD 687
           +I+SSVKVD
Sbjct: 648 KIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/643 (51%), Positives = 421/643 (65%), Gaps = 25/643 (3%)

Query: 46  MYYQHADEDGNDLG-DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPF 104
           M+Y H +++G D+  D +  +YSYDYYY K HFC+PE +EK   S+GS++FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 105 QIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYT 164
           Q+ MLKNK C  LC+ +I   DAKFINKLI NG++QNWL+DGLPAAR+  D RTKS FY 
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 165 PGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXXTKEVSESDYLDAPPAKRSLAKRKQVS 224
            GFELG V     E+R                   +   E    ++    R L KR   +
Sbjct: 121 NGFELGLV-----EIR-------------------QTTGEKLLPNSADTFRDLHKRDAKN 156

Query: 225 NTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLK 284
             + L++ +E PYF NHF+I ++YHDRGN NYRVVGV VNP SI R     C  TG+ L 
Sbjct: 157 IVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALS 216

Query: 285 LSETEATEVHFSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIH 344
           LSE+E   +HF+YSV+F PSET W TRWDKYLHVYDP IQW S++NFS+VV+ LS  +  
Sbjct: 217 LSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVAR 276

Query: 345 RLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAA 404
            L   L  D SRY ++NLD+  +E+  WKL HGDVFR P+  ++LS+LVGSG QLFLM  
Sbjct: 277 SLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMII 336

Query: 405 CTIGFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPIL 464
           CTI                 TVMF+LY  F    S+ SM  YKFF G  W +N +LTP L
Sbjct: 337 CTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFL 396

Query: 465 VPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDE 524
           VPGLL  V++ LN FL+ V S+G IP  T   ++LLWF   +PLS+ GSL+ARK C WD 
Sbjct: 397 VPGLLLLVIIGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDI 456

Query: 525 HPTKTKQIPRQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXX 584
           HPTKT  + + IP Q WYL+T+PASLI G+F FGS++VELYF+Y+SLWFNKIFYM+G   
Sbjct: 457 HPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLF 516

Query: 585 XXXXXXXXXXXXXXXXXXXXXXCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGF 644
                                   ENW+WQWR F I G GC+ Y+F+H++LFT+ +LGGF
Sbjct: 517 GSAILFTLTVSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGF 576

Query: 645 TTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687
           T  +LY+GYS V++ L+ ++TG +GFLSS+ FVR IYS+VKVD
Sbjct: 577 TNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  471 bits (1212), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 226/454 (49%), Positives = 316/454 (69%)

Query: 234 ETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEV 293
           E  Y  NHF+I + Y+DRG G YRVV     P S+ R   + C K  + + +       +
Sbjct: 152 EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDAKPVPIGSGNHENI 211

Query: 294 HFSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDD 353
            F+YSV F  S+  W+TRWD+YLHVYD  IQ   LI+FSLVV+ LS+V++H L+  L  D
Sbjct: 212 TFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFRVLKRD 271

Query: 354 LSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXX 413
           ++ Y++ NLDD+FQ++  WK+IHG+VFR+P ++L+LSV VGSG+QLF MA CT+      
Sbjct: 272 IAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVLLGSCG 331

Query: 414 XXXXXXXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVM 473
                      TVMF+LYALFG  GSYTSM+ YKFFGG  WK+N++LTP+L+P  LF   
Sbjct: 332 FLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVTT 391

Query: 474 LALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIP 533
           + LNFFL+  +S+GA+PFGTM  I++LWF+ S+P+S+ GSL++ K  +WDEHP KT QI 
Sbjct: 392 VLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAKTNQIA 451

Query: 534 RQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGXXXXXXXXXXXX 593
           RQ+P QPWY+KT  A+ +AG+FPFG++AVELY+IY+S+W   IF+M+G            
Sbjct: 452 RQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFILLTLT 511

Query: 594 XXXXXXXXXXXXXCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGY 653
                        C+ENWKWQWR F IGG GC++Y+F+H++ F KF+  GF ++VLY+GY
Sbjct: 512 TSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGY 571

Query: 654 SLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687
           S ++S++ CL+TG++GFL++LWFVR+IYS++KVD
Sbjct: 572 SAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

 Score =  121 bits (304), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 75/132 (56%), Gaps = 21/132 (15%)

Query: 18  GFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHF 77
           GFY PGV+P TYH GD IPLLVN+L+                     L++ DYY      
Sbjct: 16  GFYFPGVSPVTYHIGDEIPLLVNYLS------------------SDFLWNIDYYSDSIGL 57

Query: 78  CRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNG 137
           C+P  +++Q ESLGS+IFGDR+YNSPF++ MLKN EC  LC  +I   D    N      
Sbjct: 58  CKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFFGYR 114

Query: 138 FFQNWLVDGLPA 149
           +  NWLVDGLP 
Sbjct: 115 YSYNWLVDGLPV 126

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  120 bits (302), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 163/708 (23%), Positives = 277/708 (39%), Gaps = 128/708 (18%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y +GD + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 41  LQPNFYFQGDEVELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 81

Query: 84  EKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQN 141
            K+    SL  II GDR + S + ++  ++  C  LC+     +  K   KL+ +G+   
Sbjct: 82  HKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQ 141

Query: 142 WLVD-GLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXXTK 200
           WL+D  LPAA        + ++Y  GF LG+V     ++ +N                  
Sbjct: 142 WLIDEELPAATTFISTIDQKKYYASGFPLGFVDPDTGKVYLNTHVM-------------- 187

Query: 201 EVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVG 260
                                       LV +  T     H  +  + + +   ++   G
Sbjct: 188 ----------------------------LVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPG 219

Query: 261 VIVN--PYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETV-WATRWDKYLH 317
              N  PY I             ++  ++ + T + F+YSV +     V W  RWD YL+
Sbjct: 220 ASKNYEPYEI-------------VIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLN 266

Query: 318 VYD------PKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETG 371
             +       +  W SL N + +V  +S V+   L  +          IN  ++ +    
Sbjct: 267 SGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLV 326

Query: 372 WKLIHGDVF--RTPERSLILSVLVGSGAQLF--LMAACTIGFAXXXXXXXXXXXXXTTVM 427
           +++    +   RTP  +L++ + V  G Q    ++ + TI  +               V+
Sbjct: 327 YEVARNWIINERTPLANLLI-LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVL 385

Query: 428 -FILYALFGSF-GS----YTSMATYKFFGGPYWKVNMLLTPIL----VPGLLFCVMLALN 477
            F+L A   S+ GS      + AT K    P  K   L   IL    +PG++  V L LN
Sbjct: 386 CFVLGAFMSSYIGSVLLRLKNKATMK--KQPIKKGFHLFFAILCGSFLPGIVMIVTLLLN 443

Query: 478 FFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIAR-KKCKWDEHPTK-------- 528
             +   +S  A+PF T+ + + ++F+  IPLS+ G  +A   K K      K        
Sbjct: 444 SIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPEL 503

Query: 529 ----TKQIPRQIPF----QPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNK--IFY 578
                K  P++  F    +   +K     L++GIFPF  I VEL ++Y S+W  K   +Y
Sbjct: 504 ELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYY 563

Query: 579 MFGXXXXXXXXXXXXXXXXXXXXXXXXXCL---ENWKWQWRGFWIGGAGCALYMFIHAIL 635
            +G                          +    N  W+W  F++ G+ CA YM ++++ 
Sbjct: 564 FYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFM-GSSCAWYMELYSLY 622

Query: 636 FTKFRLG--GFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIY 681
           +  F L   GF++I + V Y  + + L     G++  L+S +FV ++Y
Sbjct: 623 YVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 157/735 (21%), Positives = 273/735 (37%), Gaps = 155/735 (21%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           V P  Y  GD + L+VN +                   ES L    Y Y    F  P   
Sbjct: 51  VNPNLYKIGDHVELIVNKV-------------------ESDLTQLPYAYYDLPFICPPTK 91

Query: 84  EKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQN 141
           EK+    SL  I  GDR + S +++    +  C  LC+     +      +L+  G+   
Sbjct: 92  EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQ 151

Query: 142 WLVD-GLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXXTK 200
           WL+D  LPAA         +++Y  GF +G                              
Sbjct: 152 WLIDESLPAATTFISSTNHNKYYAAGFPVG------------------------------ 181

Query: 201 EVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVG 260
                 Y+D    K                      +  NH  + ++YH      + +VG
Sbjct: 182 ------YVDDRTGK---------------------TFLNNHVMLVIRYHPVSEEEFTIVG 214

Query: 261 VIVNPYSIKR----ESPDTCDKTGELLKLSETEATEVHFSYSVKFTPS-ETVWATRWDKY 315
             V P S+       +    DK   ++   + E T + F+YSV +    E  W  RW+ +
Sbjct: 215 FEVYPKSVSDYHCPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYF 274

Query: 316 LHVYD------PKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQ-----INLDD 364
           L+  +       +  W S +N S+ +  ++T ++  + + +     R ++      NL  
Sbjct: 275 LNNGELSNSKANQFHWMSFLN-SVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQ 333

Query: 365 DFQEETGWKLIHGDVFRTPE-----------RSLILSVLVGSGAQLFLMAACTIGFAXXX 413
           D +++   K I G VF   +           ++LI    +G      ++ +  I  +   
Sbjct: 334 DNEDDNDDK-ISGSVFVNAKTWITVGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSK 392

Query: 414 XXXXX-XXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPIL-------- 464
                      + + FI  A    +        Y+   G Y +  +  T +         
Sbjct: 393 LHNIRFTVLTMSLICFICGAAISGYIGSRLYIEYQILKG-YLRNEVNRTKVYKFSVVCGS 451

Query: 465 -VPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWD 523
            +PGLL  +  +LN  ++  +S  A+PF T   +V ++F+  IPLS+ G ++A   CK D
Sbjct: 452 SLPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLAL-NCKVD 510

Query: 524 EHP---------------------TKTKQIPRQIPFQPWYLK-TVPASLIAGIFPFGSIA 561
            +                      TK   + +++ F   +   T   +L  G F F  I 
Sbjct: 511 SYNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIW 570

Query: 562 VELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK-----WQ 614
           VEL ++Y S+W  K   +Y +G                           +N +     W 
Sbjct: 571 VELQYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWG 630

Query: 615 WRGFWIGGAGCALYMFIHAILFTKFRLG--GFTTIVLYVGYSLVMSLLSCLITGTVGFLS 672
           W+ F + G+ CA YM ++++ +  F L   GF++I + V YSL+ + +     G++ +L+
Sbjct: 631 WKSF-LMGSSCAWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLT 689

Query: 673 SLWFVRRIYSSVKVD 687
           S   V +IY   KVD
Sbjct: 690 SYMLVTQIY---KVD 701

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 123/518 (23%), Positives = 221/518 (42%), Gaps = 71/518 (13%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLS----ETEATE 292
           Y  NH  + +++H   NG   +VG  V P S+         KT E  +++    E E T 
Sbjct: 192 YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPEDENELTY 251

Query: 293 VHFSYSVKFTPS-ETVWATRWDKYLHVYD------PKIQWFSLINFSLVVVFLSTV-MIH 344
           + F+YSV +    E  W  RWD +L+  +       +  W S  N  ++V+ +S + +I 
Sbjct: 252 LPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISLITLII 311

Query: 345 RLYVTLTDDLSRYNQ---IN---------LDDDFQEETGWKLIHGDVFRTPERSLI---- 388
            + V  TD  + ++    IN         L++D   +    ++  D  +  +  L     
Sbjct: 312 YIGVMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVYMVAKDWIQNGKPDLFSLKG 371

Query: 389 LSVLVGSGAQLF--LMAACTIGFAXXXXXXXXXXXXXTTVM-FILYALFGSF-GSYTSMA 444
           L VLV  G Q    ++ + TI  +               ++ F++ A   SF G+  S+ 
Sbjct: 372 LIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMASFVGTRLSIV 431

Query: 445 T------YKFFG-GPYWKVNMLLTPIL-------VPGLLFCVMLALNFFLVVVESAGAIP 490
           +        +FG    +K     +PI        +PG++      LN  +   +S  A+P
Sbjct: 432 SKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVWAHDSTNALP 491

Query: 491 FGTMCVIVLLWFLFSIPLSVAGSLIARK---------KCKWDEHPTKTKQIPRQIPFQPW 541
           F T+   + ++F+  IPLS+ G ++A               DE  +K  ++   +P  P 
Sbjct: 492 FKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKL--FLPKSPN 549

Query: 542 YLKTVPASLI--AGIFPFGSIAVELYFIYSSLWFNKI----FYMFGXXXXXXXXXXXXXX 595
               +    I   G+FP   I VE+ ++Y SLW  K     FY F               
Sbjct: 550 KFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEI 609

Query: 596 XXXXXXXXXXXCLENW----KWQWRGFWIGGAGCALYMFIHAI--LFTKFRLGGFTTIVL 649
                      C E+      W+W+ F +G +G  +YM ++++  +F    + GF++I++
Sbjct: 610 SVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILI 668

Query: 650 YVGYSLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687
            + YSL+ +++  L  G + +L++ WF+ +IY  VKV+
Sbjct: 669 SICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 66/159 (41%), Gaps = 22/159 (13%)

Query: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFH 76
           S  Y   + P  Y  GD + L+VN +                   ES L    Y Y    
Sbjct: 45  SNLYDGWITPNFYKNGDPLELIVNKV-------------------ESDLTQLPYAYYDLP 85

Query: 77  FCRPEKLEKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLI 134
           F  P  + K     SL  II GDR + S +++   ++  C  LC+     +  + ++KLI
Sbjct: 86  FTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLI 145

Query: 135 TNGFFQNWLVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
             G+   WL+D  LPAA          ++Y  GF LG++
Sbjct: 146 REGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFM 184

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 121/491 (24%), Positives = 198/491 (40%), Gaps = 54/491 (10%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----SETEATE 292
           Y   H  I ++Y+      + + G  + P S          K  E  +L    ++ + T 
Sbjct: 182 YLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTF 241

Query: 293 VHFSYSVKFTPSETV-WATRWDKYLHVYD------PKIQWFSLINFSLVVVFLSTVMIHR 345
           + F+YSV +     V W  RWD YL+  +       +  W SL N   +V  +S++    
Sbjct: 242 IPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITAVI 301

Query: 346 LYVTLTDDLSRYNQINLDDD-----FQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLF 400
           LY T       ++ I+ ++D     +     W L      +TP  + +L + V  G Q  
Sbjct: 302 LYRTFKISRRSFSDISKEEDDKGSIYVVARKWLLNE----QTPLAN-VLIIFVSMGVQFL 356

Query: 401 LMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMATYK----------FFG 450
                ++  +              T+  + +       S+T     K             
Sbjct: 357 FTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCSESQMKP 416

Query: 451 GPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSV 510
             Y+ V  LL   L+P  +  V L LN  +   +S  A+PFGT+  ++ ++F+  IPLS+
Sbjct: 417 TRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSL 476

Query: 511 AGSLIARKKCKWDEHPTKTKQIP---------RQIPFQPWYLKTVPASLIA----GIFPF 557
            G  IA K    +  P+ +  I          + I   P  L   P S +A    G+FPF
Sbjct: 477 LGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILAGGLFPF 534

Query: 558 GSIAVELYFIYSSLWFNKI----FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENW-K 612
             I VEL ++Y SLW  K     FY F                            +N   
Sbjct: 535 IIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNN 594

Query: 613 WQWRGFWIGGAGCALYMFIHAILFTKFRLG--GFTTIVLYVGYSLVMSLLSCLITGTVGF 670
           W+W  F I GA CA YM ++++ +  F L   GF++I + V Y  + +++    TG++  
Sbjct: 595 WRWTSFQI-GASCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIAC 653

Query: 671 LSSLWFVRRIY 681
           L+S WFV++IY
Sbjct: 654 LTSHWFVQKIY 664

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 63/150 (42%), Gaps = 22/150 (14%)

Query: 26  PTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKLEK 85
           P  Y +GD + L+VN +                   ES L    Y Y    F  P  + K
Sbjct: 44  PNYYSKGDPVELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTMHK 84

Query: 86  Q--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNWL 143
           +    SL  II GDR + S + +   ++ +C  LC+     +  K   +L+ NG+   WL
Sbjct: 85  KPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWL 144

Query: 144 VDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           +D  LPA           ++Y  GF LG+V
Sbjct: 145 IDDELPAVTTFISTTDHKKYYASGFPLGFV 174

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  106 bits (264), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 114/483 (23%), Positives = 205/483 (42%), Gaps = 46/483 (9%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHF- 295
           +F NH  + ++Y+   +    +VG    P S+         K  +  ++++    E+ + 
Sbjct: 181 FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPGASKDFKPFEITDPPLEEIVYI 240

Query: 296 --SYSVKFTP-SETVWATRWDKYLH------VYDPKIQWFSLINFSLVVVFLSTVMIHRL 346
             +YSV +   +E  W+ RW  Y++             W +L N   +V+F++ ++I  L
Sbjct: 241 PVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLFVTFIVIVNL 300

Query: 347 YVTL---TDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMA 403
            +      + L      +  D F     W L     F+       L V V  G Q+  M 
Sbjct: 301 IMIFRNPNEQLESKENEDSSDIFNVANNW-LRARQGFQLNR----LIVCVSMGIQVMFMI 355

Query: 404 ACTIGFAXXXXXXXXXXXXXTTVM---FILYALFGSF-GSYTSM----ATYKFFGGPYWK 455
              +  +              T+    F+  A   SF G++  M    + Y F+      
Sbjct: 356 LGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYTFYN----P 411

Query: 456 VNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLI 515
           V  +L    +PG +  + L+LN  + + +S  A+PFGTM V V  +F+  I +S+ G  +
Sbjct: 412 VFAVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAV 471

Query: 516 A---RKKCKWDEHPTKT---KQIPRQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYS 569
           A    +  + D  P  T   +++ R+       L    A LI+G  PF  I VEL ++Y 
Sbjct: 472 AAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVELEYLYK 531

Query: 570 SLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLE-----NWKWQWRGFWIGG 622
           S+W  K  ++Y++                           L      +  W+WR F I  
Sbjct: 532 SVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNWRWRCFVIS- 590

Query: 623 AGCALYMFIHAILFTKF--RLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRI 680
            GC+ YM I+++ +  F   + G + + + V YS + ++L  L TG++G+L+S WFV++I
Sbjct: 591 TGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSSWFVKKI 650

Query: 681 YSS 683
           + +
Sbjct: 651 HRT 653

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/160 (26%), Positives = 66/160 (41%), Gaps = 22/160 (13%)

Query: 26  PTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKLEK 85
           P  Y  GD + L+VN +                   ES +    + Y    F  P   EK
Sbjct: 43  PNVYSIGDPLELVVNTV-------------------ESEITDIPFGYYDLPFTCPPTPEK 83

Query: 86  Q--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNWL 143
           +    SL  II GDR + S +++ + ++  C  LC+     +  +    LI +G+   W+
Sbjct: 84  KPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQWM 143

Query: 144 V-DGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMN 182
           + D LPAA          ++Y PGF LG V    S +  N
Sbjct: 144 IDDDLPAATTYISTTDNLKYYAPGFPLGSVDPRSSRVFFN 183

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  105 bits (261), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 123/516 (23%), Positives = 212/516 (41%), Gaps = 72/516 (13%)

Query: 234 ETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----SETE 289
           +  Y  NH  + +++H   N    +VG  V P S+         K  E  ++     E E
Sbjct: 189 DKTYLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENE 248

Query: 290 ATEVHFSYSVKFTPS-ETVWATRWDKYLHVYD------PKIQWFSLINFSLVVVFLS--- 339
            T + F+YSV +    E  W  RWD +L+  +       +  W SL N   +V+ +S   
Sbjct: 249 LTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIVLSISFIT 308

Query: 340 -TVMIHRLYVTLTDDLSRYNQIN---------LDDDFQEETGWKLIHGDVFRTPERSL-- 387
             + +  +Y   ++  S    IN         LDDD   +     +  D  +    +L  
Sbjct: 309 LIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKDWIQNGRPNLFG 368

Query: 388 --ILSVLVGSGAQLF--LMAACTIGFAXXXXXXXXXXXXXTTVMF-ILYALFGSF-GSYT 441
             +L +LV  G Q    ++ + TI  +               ++F +L A   SF G+  
Sbjct: 369 LKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILFFVLGAFMASFVGTRL 428

Query: 442 SMATY-KFFGGPYWKVNMLL------TPIL-------VPGLLFCVMLALNFFLVVVESAG 487
           SM T  K     Y   N  L      +PI        +PG++      LN  +   +S  
Sbjct: 429 SMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTS 488

Query: 488 AIPFGTMCVIVLLWFLFSIPLSVAGSLIARK---KCKWDEHPTKTKQ--------IPR-Q 535
           A+PF T+   + ++F+  IPLS+ G ++A        W    TK +         +P+ +
Sbjct: 489 ALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDESNSDGNGLFVPKSR 548

Query: 536 IPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKI----FYMFGXXXXXXXXXX 591
             F P     +    + GIFP   I VE+ ++Y SLW  K     FY F           
Sbjct: 549 AKFNPLVYCGI---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVL 605

Query: 592 XXXXXXXXXXXXXXXCLENW----KWQWRGFWIGGAGCALYMFIHAI--LFTKFRLGGFT 645
                          C E+      W+W+ F +G +G  +YM ++++  +F    + GF+
Sbjct: 606 TMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFS 664

Query: 646 TIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIY 681
           +I++ + YSL+ +++  L  G + +L++ WF+ +IY
Sbjct: 665 SILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 68/152 (44%), Gaps = 22/152 (14%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y +GD + L+VN +                   ES L    Y Y    F  P  +
Sbjct: 52  ITPNFYRKGDPLELIVNKV-------------------ESDLTQLPYAYYDLPFTCPPTM 92

Query: 84  EKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQN 141
            K+    SL  II GDR + S ++++  ++  C +LC+     +  + ++KL+  G+   
Sbjct: 93  HKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQ 152

Query: 142 WLVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           WL+D  LPAA          ++Y  GF LG++
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFI 184

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  103 bits (256), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 124/509 (24%), Positives = 210/509 (41%), Gaps = 67/509 (13%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKR----ESPDTCDKTGELLKLSETEATE 292
           Y  NH  + ++YH   + N+ +VG  + P S+       +    D+   ++     E T 
Sbjct: 173 YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYEVVVPEIANEDTF 232

Query: 293 VHFSYSVKFTPSETV-WATRWDKYLHV------YDPKIQWFSLINFSLVVVFLSTVMIHR 345
           + F+YSV +     V W  R++ +            K  W SL N S  + FL T ++  
Sbjct: 233 IPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWISLAN-SASIAFLMTFIVSL 291

Query: 346 LYVTLT---DDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLM 402
           +++ +T   + L    +      F     W   + D    P    I  V +G      ++
Sbjct: 292 IFIKITGIPNRLETKKESPKASIFVIARNW--FYDDRPVMPHL-FICIVSMGVHFLFTVI 348

Query: 403 AACTIGFAXXXXXXXXXXXXXTTVMF-ILYALFGSF-GSYTSMATYKFF--GGPYWKV-- 456
            + TI  +               ++F +L A   SF G    +   K     G    V  
Sbjct: 349 GSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGGTLLIENNKLIMRRGSLKNVFS 408

Query: 457 NMLLTPI----LVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAG 512
           N+LL  +    L+PG++    + LN  + +  S   +PF T+  ++ ++F+  IPLSV G
Sbjct: 409 NILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLG 468

Query: 513 SLIARKKCK----------------------WDEHPTKTKQIPRQIPFQ-PWYLK----- 544
             IA  K                         DE      +  R++ ++  W LK     
Sbjct: 469 GSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLD 528

Query: 545 --TVPASLIAGIFPFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXX 600
             TV + L +GIFPF  I VEL F+Y S+W+ K   +Y +G                   
Sbjct: 529 TVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAII 588

Query: 601 XXXXXXCLENW----KWQWRGFWIGGAGCALYMFIHAI--LFTKFRLGGFTTIVLYVGYS 654
                  + +      W+W+ F +  + CA YM  ++I  +F    +  F++I++ V YS
Sbjct: 589 CSYLMMTVSSKDNSDSWKWKTFQL-SSSCAWYMEAYSIYYVFKVLNMRDFSSILISVCYS 647

Query: 655 LVMSLLSCLITGTVGFLSSLWFVRRIYSS 683
           L+ + L  L  G++G+L+SLWFV+R+Y S
Sbjct: 648 LLFNALCGLAMGSIGYLASLWFVKRVYRS 676

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 22/152 (14%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + PT Y  GD + ++VN +         + D   L         Y YY     F  P  +
Sbjct: 33  LTPTIYRHGDPVEIIVNKI---------ESDATQL--------PYGYY--DLPFTCPPTV 73

Query: 84  EKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQN 141
           +K+    SL  +I GDR + S +++E  K+ EC  LC+     D  + ++K I   +   
Sbjct: 74  DKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQ 133

Query: 142 WLVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           W +D  LPAA        + ++Y  GF LG+V
Sbjct: 134 WFIDKELPAATTFISTVDQKKYYGSGFPLGFV 165

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 138/591 (23%), Positives = 225/591 (38%), Gaps = 139/591 (23%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y  GD + L VN +                 + E     Y YY  +F  C P + 
Sbjct: 44  IKPNVYKRGDKVDLTVNKV-----------------ESEITNLPYGYYDLRF-VCPPSET 85

Query: 84  EKQRE-SLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNW 142
           +K    SL  +I GDR + S + +E    ++C  LC      D  +  ++LI   +  +W
Sbjct: 86  KKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHW 145

Query: 143 LVDG-LPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXXTKE 201
           L+DG LPAA      R+  +FYT GF LG V                             
Sbjct: 146 LIDGDLPAATTFASTRSGKKFYTAGFPLGRVD---------------------------- 177

Query: 202 VSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVGV 261
             E+D             +  + N   LV + +   F  +  +  + + R   +Y+  G 
Sbjct: 178 -HETD-------------KTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGA 223

Query: 262 --IVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETV-WATRWDKYLH- 317
                PY I  E               ETE T + F+YSV +     + W+ RW+ +   
Sbjct: 224 SKSFEPYVINTE---------------ETEVTYIPFTYSVYWREESNIDWSHRWNLFFDG 268

Query: 318 ---VYDPKIQ---WFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETG 371
              + +  +    W SL N S +VV L T+ I  +++ +             DDF     
Sbjct: 269 GSMLPNGNVSFFYWISLAN-SAIVVALMTLFIALIFLKIR-----------ADDFVGTLA 316

Query: 372 WKLIHGDVFRTPERSLILSVLVGSGAQLF--LMAACTIGFAXXXXXXXXXXXXXT-TVMF 428
           ++     V+   + +L  S+    G Q    ++ + TI  +             T  + F
Sbjct: 317 FEWASQPVYYLTQLNLAASM----GIQFLFSIIGSSTISCSLCKVHNIRSWELSTAAICF 372

Query: 429 ILYALFGSFGSYTSMATYKFFG-GPYWKVNM---LLTPILVPGLLFCVMLALNFFLVVVE 484
           +L       G+YTS         GP  K+N+   +L    +P L   V+   N  + + +
Sbjct: 373 VL-------GAYTSSLVGSLLAPGP--KMNLGTSVLCGCTLPALALVVVAVFNSVVWIKD 423

Query: 485 SAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQ--IP----RQIPF 538
           S+ A+PFGT+  ++  +F+  +PLS  G   ARK      +    +Q  +P      I +
Sbjct: 424 SSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQSKVPFSFLLSIEY 483

Query: 539 QPWYL------KTVPA--------SLIAGIFPFGSIAVELYFIYSSLWFNK 575
             + L      K +PA        +++ G  PF     EL F+Y SLW  K
Sbjct: 484 HEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQK 534

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 612 KWQWRGFWIGGAGCALYMFIHAILFTKF--RLGGFTTIVLYVGYSLVMSLLSCLITGTVG 669
            W+W+ F + GA  A Y  ++++ +  F   L  F++I+L+V Y+ + +L+     G +G
Sbjct: 618 SWRWKAF-MAGASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALG 676

Query: 670 FLSSLWFV 677
           +L+ LWF+
Sbjct: 677 YLTCLWFL 684

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 120/520 (23%), Positives = 214/520 (41%), Gaps = 82/520 (15%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----SETEATE 292
           Y  NH  + +++H   N    +VG  V P S+         K  E  ++     E E T 
Sbjct: 192 YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVVPEDENELTY 251

Query: 293 VHFSYSVKFTPS-ETVWATRWDKYLHVYD------PKIQWFSLINFSLVVVFLSTVMIHR 345
           + F+YSV +    E  W  RWD +L+  +       +  W S  N S+ +V   + +   
Sbjct: 252 LPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHWMSFAN-SMGIVLSISFITAV 310

Query: 346 LYVTL------TDDLSRY--------NQINLDDDFQEETGWKLIHGDVFRTPERSL---- 387
           +Y+ +        D ++Y         + NLDDD   +    ++  D  +    ++    
Sbjct: 311 IYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNSVYMVTKDWIQNGRPNMFGLK 370

Query: 388 ILSVLVGSGAQLF--LMAACTIGFAXXXXXXXXXXXXXTTVM-FILYALFGSF-GSYTSM 443
           +L VLV  G Q    ++ + TI  +               ++ F+L A   SF G+  S+
Sbjct: 371 VLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAILCFVLGAFMASFVGTRLSI 430

Query: 444 ATYKFFGGPYWKVNML-----------LTPIL-------VPGLLFCVMLALNFFLVVVES 485
            T +       ++N L            +P+        +PGL+      LN  +   +S
Sbjct: 431 VTKR----RSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLVMVSTFLLNSIVWAHDS 486

Query: 486 AGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARK---KCKWDEHPTKTKQ--------IPR 534
             A+PF T+   + ++F+  IPLS+ G  +A        W    TK +         +PR
Sbjct: 487 TNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGITKDETCGNSSRLFVPR 546

Query: 535 -QIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKI----FYMFGXXXXXXXX 589
            +  F P     +    + G+FPF  I VEL ++Y S+W  K     FY F         
Sbjct: 547 SRTKFNPLVYCGI---YLCGLFPFLVIYVELQYVYKSVWLEKTTFYYFYGFLLLNIILLC 603

Query: 590 XXXXXXXXXXXXXXXXXCLENW----KWQWRGFWIGGAGCALYMFIHAI--LFTKFRLGG 643
                            C E+      W+W+ F +G +G  +YM ++++  +F    + G
Sbjct: 604 VLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHG 662

Query: 644 FTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIYSS 683
           F++ ++ + YSL+ +++  L  G + +L++ WF+ +IY S
Sbjct: 663 FSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 70/161 (43%), Gaps = 22/161 (13%)

Query: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK 74
           Q + +Y   + P  Y +GD + L+VN +                   ES L    Y Y  
Sbjct: 43  QDNTYYDGWITPNFYKKGDPLELIVNKV-------------------ESDLTQLPYAYYD 83

Query: 75  FHFCRPEKLEKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINK 132
             F  P  + K+    SL  II GDR + S + +   ++  C +LC+     +  + ++K
Sbjct: 84  LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDK 143

Query: 133 LITNGFFQNWLVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           L+  G+   WL+D  LPAA          ++Y  GF LG+V
Sbjct: 144 LVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFV 184

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 108/505 (21%), Positives = 203/505 (40%), Gaps = 64/505 (12%)

Query: 234 ETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----SETE 289
           E  Y   H  + ++Y+      + +VG  V P S+         K  E  +L    +E E
Sbjct: 178 EKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQYELIVPENEDE 237

Query: 290 ATEVHFSYSVKFTPSETV-WATRWDKYLH------VYDPKIQWFSLINFSLVVVFLSTVM 342
            T + F+YSV +     V W+ RW+ +L+          +  W +L N   +   L  ++
Sbjct: 238 LTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVGISFLLMLIV 297

Query: 343 IHRLYVTLT---DDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSL---ILSVLVGSG 396
           I  LY  +    +  S   Q   D++ + ++ + +    + +T   S+   IL++ V  G
Sbjct: 298 IANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISFKILTIFVSIG 357

Query: 397 AQLFLMAACTIGFAXXXXXXXXXXXXXTTVM--------FILYALFGSFGSYTSMATYKF 448
            Q       ++ F+              +V         ++ +   G++       T   
Sbjct: 358 VQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLHIDHRTTNDG 417

Query: 449 FGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPL 508
             G     ++L    L PGL+      LN+ +   ES+ A+PF T+ + V ++F+  IPL
Sbjct: 418 SAGRCRTFSILCGSAL-PGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIPL 476

Query: 509 SVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLK--TVPASL---------------- 550
           S+ G  ++ +      H  + +  P         +K    P +L                
Sbjct: 477 SLLGEEVSHRV-----HRKQAQNFPILSSLGARSIKPCRAPTTLAPRKISERLTFDFATF 531

Query: 551 -IAGIFPFGSIAVELYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXX-------XXXX 600
            I G  PF  I VEL +IY S+W  K   +Y++G                          
Sbjct: 532 AICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMMR 591

Query: 601 XXXXXXCLENWKWQWRGFWIGGAGCALYMFIHAI--LFTKFRLGGFTTIVLYVGYSLVMS 658
                   ++W+W+    ++ G  CA YM ++++  +F   ++ GF +I + V YSL+ +
Sbjct: 592 KHKRVATFDSWRWK---CFMMGTSCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFN 648

Query: 659 LLSCLITGTVGFLSSLWFVRRIYSS 683
           ++     G++G+L+S W V R++ +
Sbjct: 649 IMCGCGMGSLGYLTSCWLVNRVFCT 673

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 65/152 (42%), Gaps = 22/152 (14%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y  GD + LLVN +                   ES L  + Y Y    F  P   
Sbjct: 41  LQPNVYRWGDHVELLVNKV-------------------ESDLTQFPYGYYDLPFTCPPTE 81

Query: 84  EKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQN 141
           +K+    SL  II GDR + S ++++  ++  C +LC+        +   +L+  G+   
Sbjct: 82  DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQ 141

Query: 142 WLVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           WL+D  LPAA          ++Y  GF LG+V
Sbjct: 142 WLIDQELPAATTFISTIDHKKYYVSGFPLGFV 173

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 119/516 (23%), Positives = 212/516 (41%), Gaps = 72/516 (13%)

Query: 234 ETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----SETE 289
           +  Y  NH  + +++H  G+    VVG  V P S+         K  E  ++     E +
Sbjct: 190 DKTYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQYEIVVPEDEHD 249

Query: 290 ATEVHFSYSVKFTPS-ETVWATRWDKYLHVYD------PKIQWFSLIN---FSLVVVFLS 339
            T + F+YSV +    E  W  RW+ +L+  +       +  W SL N     L + F++
Sbjct: 250 LTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFIT 309

Query: 340 TVMIHRLYVTLTDDLSRYNQI----------NLDDDFQEETGWKLIHGDVFRTPERSL-- 387
            V+  R+  T   +   +  +          +LDDD   +    ++  D  +  +  L  
Sbjct: 310 FVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDWIQNGKPDLFG 369

Query: 388 --ILSVLVGSGAQLF--LMAACTIGFAXXXXXXXXXXXXXTTVM-FILYALFGSF-GSYT 441
             +L VLV  G Q    ++ + TI  +               ++ F+L A   SF G+  
Sbjct: 370 LKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRL 429

Query: 442 SMATYK-------FFGGPYWKVNMLLTPIL-------VPGLLFCVMLALNFFLVVVESAG 487
            + T +             +K     +PI        +PG++      LN  +   +S  
Sbjct: 430 GIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTN 489

Query: 488 AIPFGTMCVIVLLWFLFSIPLSVAGSLIARK------------KCKWDEHPTKTKQIPRQ 535
           A+PF T+   + ++F+  IPLS+ G ++A              K + D + +K  +   +
Sbjct: 490 ALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSR 549

Query: 536 IPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKI----FYMFGXXXXXXXXXX 591
             F P     V    + GIFP   I VE+ ++Y SLW  K     FY F           
Sbjct: 550 TRFNPLVHCGV---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVL 606

Query: 592 XXXXXXXXXXXXXXXCLENWK----WQWRGFWIGGAGCALYMFIHAI--LFTKFRLGGFT 645
                          C ++ +    W+WR F +G +G  +YM ++++  +F    + GF+
Sbjct: 607 TMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFS 665

Query: 646 TIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIY 681
           +I++ + YSL+ ++L  L  G +  L++ WF+ RIY
Sbjct: 666 SILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 69/161 (42%), Gaps = 22/161 (13%)

Query: 15  QVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPK 74
           Q + +Y   + P  Y + D + L+VN +                   ES L    Y Y  
Sbjct: 44  QNNLYYDGWITPNFYKKNDFLELIVNKV-------------------ESDLTQLPYAYYD 84

Query: 75  FHFCRPEKLEKQ--RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINK 132
             F  P  + K+    SL  II GDR + S +++   ++  C +LC+        + ++K
Sbjct: 85  LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDK 144

Query: 133 LITNGFFQNWLVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           L+  G+   WL+D  LPAA          ++Y  GF LG+V
Sbjct: 145 LVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFV 185

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 118/499 (23%), Positives = 195/499 (39%), Gaps = 71/499 (14%)

Query: 232 QLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSET-EA 290
           + +  Y  NH  I ++YH    G   +VG  V P S+         K     K+  T E 
Sbjct: 192 ETDEAYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNED 251

Query: 291 TE-VHFSYSVKFTPSETV-WATRWDKYLHVYDPK------IQWFSLINFSLVVVFLSTVM 342
            E + F+Y+V +     V W  RW+ +++  + K        W +  N  +V   L  ++
Sbjct: 252 IEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWITFANGIIVTSCLLLIV 311

Query: 343 IHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLM 402
           I  L    TD              Q    W      +F        L++LV  G      
Sbjct: 312 IAILKRQETDG---------SITTQLAAEWSKARVPLF------FQLNLLVSMGIHFLFT 356

Query: 403 AACTIGFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPYWK---VNML 459
              T+G               ++V+     LF S GS+TS        G   +   VN +
Sbjct: 357 ---TLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-GSFTSSFIGALLEGQMSQHKLVNSI 412

Query: 460 LTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKK 519
           +    +PG+   ++L LN+ L    +A  +P GT+ ++   +F+  +P+S+ G   A + 
Sbjct: 413 IFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRF 472

Query: 520 CK---------------WDEHPTKTKQIPRQIPFQPWYLKT-VPASLIAGIFPFGSIAVE 563
            K                ++H T+   +  +    P+ LK  +  +L  G+ PF  I VE
Sbjct: 473 LKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSI-PFVLKNPIAITLTFGLIPFALIYVE 531

Query: 564 LYFIYSSLWFNK--IFYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLEN------W---- 611
           L F Y SLW  K  ++Y++G                            N      W    
Sbjct: 532 LLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVI 591

Query: 612 --------KWQWRGFWIGGAGCALYMFIHAILFTKF--RLGGFTTIVLYVGYSLVMSLLS 661
                    W+W+ F +GGA  A YM  ++IL+  F  R   F +  L+V YS + ++L 
Sbjct: 592 GRVLEACHSWRWKAFHMGGA-VAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILC 650

Query: 662 CLITGTVGFLSSLWFVRRI 680
               G++ +LSSLWF+ ++
Sbjct: 651 WTAFGSLSYLSSLWFIGKL 669

 Score = 61.2 bits (147), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 42  LTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRP--EKLEKQRESLGSIIFGDRI 99
           L+P  +Y++ D+    +   ES L  + Y Y   HF  P  + ++    +   I++G++ 
Sbjct: 57  LSPN-FYEYGDKVDITVNKVESDLTHFSYGYYDLHFTCPPSQDMKPLPLTFSDILYGNKK 115

Query: 100 YNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNWLV-DGLPAARKTTDVRT 158
           + S +Q+   K+++C  LC      +  K   +LI   +   WL  D LP A    + + 
Sbjct: 116 WQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTKD 175

Query: 159 KSEFYTPGFELG 170
           K ++Y+ GF LG
Sbjct: 176 KKKYYSSGFPLG 187

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 96/391 (24%), Positives = 172/391 (43%), Gaps = 69/391 (17%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVH-- 294
           Y  NH  + ++YH      + +VG+ V P S+         K  +  +++  E    +  
Sbjct: 196 YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASKNFDHYEVNTEETETTYIP 255

Query: 295 FSYSVKFTPSETV-WATRWDKYLHVYD------PKIQWFSLINFSLVVVFLSTVMIHRLY 347
           F+YS+ +     V W  RW+ +++  +       +  W SL N S+V+V L T+++  + 
Sbjct: 256 FTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLAN-SVVIVTLMTLVVALIL 314

Query: 348 V--TLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAAC 405
                TD+    +   +   +  +  + L H +VF       + ++L GS     L+ +C
Sbjct: 315 AKSVSTDETVSTSTSQVASQWVVQHSYLLNHLNVFTAMGVQFLFTIL-GS-----LIISC 368

Query: 406 TIGFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPY---WKVNMLLTP 462
           ++                 +V+ +    F S G+YTS          +    K+++    
Sbjct: 369 SMN---------KLHNIRNSVLTMALMCFIS-GAYTSSFVGALLSANHNTTIKISIACGS 418

Query: 463 ILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIA---RKK 519
            L PG   CV+L LN  +   +S  A+PFGT+ +++ ++F+  IPLS+ G + A   R+K
Sbjct: 419 AL-PGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATYTRRK 477

Query: 520 C-----------------KWDEHPTKTKQI--PR-----QIPF---QPWYLKTVPASLIA 552
           C                  +D+ P    ++  PR     ++P    QP     V  ++I+
Sbjct: 478 CLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLMLRQP-----VLLTVIS 532

Query: 553 GIFPFGSIAVELYFIYSSLWFNK--IFYMFG 581
           GI PF  I VEL F+Y SLW  K   +Y++G
Sbjct: 533 GIVPFIVIYVELLFVYKSLWLEKTTFYYLYG 563

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 70/162 (43%), Gaps = 22/162 (13%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHF-CRPEK 82
           + P  Y E D + ++VN +                   ES L  + Y Y +  F C P  
Sbjct: 56  IRPNVYEENDPVEIIVNKI-------------------ESDLTQFPYAYYELPFTCPPTN 96

Query: 83  LEKQRE-SLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQN 141
           ++K    SL  II GDR + S + +   K++ C  LC      D  +  ++LI  G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 142 WLVDG-LPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMN 182
           WL+D  LPAA      +   ++Y  GF LG++     +  +N
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMDKDTGKTYLN 198

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 612 KWQWRGFWIGGAGCALYMFIHAILF--TKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVG 669
           +W+W+ F IGG+  A Y+  +++ +  T  ++  F++I+L+  YS + + L     G +G
Sbjct: 631 QWRWKSFQIGGS-VAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALG 689

Query: 670 FLSSLWFVRRIYSSVK 685
           +LS  WFV RI+++ K
Sbjct: 690 YLSCCWFVNRIHTNSK 705

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 105/491 (21%), Positives = 200/491 (40%), Gaps = 51/491 (10%)

Query: 234 ETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL---SETEA 290
           ET Y  NH  + ++YH   + ++ +VG+ V P S+         +  E  +L    + E 
Sbjct: 174 ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDEEV 233

Query: 291 TEVHFSYSVKFTPS-ETVWATRWDKYLHVYD------PKIQWFSLINFSLVVVFLSTVMI 343
           T + F+YSV +    +  W  R+  + +  +       K +W  L N S + +F+S ++ 
Sbjct: 234 TYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITDKFRWILLANSSGLALFISMIV- 292

Query: 344 HRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSL---ILSVLVGSGAQLF 400
                 +   +S+ N+ N +   + + G   +    +   +R++    L VLV  G    
Sbjct: 293 ----SVIFLRISKKNK-NENSAIESKKGSMDVIARKWLRNDRTIHFNFLIVLVSFGVHFA 347

Query: 401 LMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGSFGSY--TSMATYK---FFGGPYWK 455
                ++  +              T++ + + L G   S+  T +   K    + G   +
Sbjct: 348 FTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTCLIMQKNKTMYKGSLKR 407

Query: 456 VN-----MLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSV 510
           ++      +    L+P ++  + + LN  +    S+ A+P  T+  ++ ++F+  IPLS+
Sbjct: 408 LHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSL 467

Query: 511 AGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASL-----------IAGIFPFGS 559
            G   A   C+       +    +++      L     S+           I G+FPF  
Sbjct: 468 LGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLASIGGLFPFFI 527

Query: 560 IAVELYFIYSSLWFNKI-------FYMFGXXXXXXXXXXXXXXXXXXXXXXXXXCLENWK 612
           I VEL  +Y  +W  K        F                              LEN  
Sbjct: 528 IYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-S 586

Query: 613 WQWRGFWIGGAGCALYMFIHAILFTKFRLG--GFTTIVLYVGYSLVMSLLSCLITGTVGF 670
           W+WR F I  + CA YM ++++ +  + L   GF++I+L V  S + + L     G++G+
Sbjct: 587 WRWRSFQISSS-CAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGY 645

Query: 671 LSSLWFVRRIY 681
           L++ WFV R+Y
Sbjct: 646 LATCWFVGRVY 656

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 94/239 (39%), Gaps = 31/239 (12%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y +GD + L+VN +         + D   L         Y YY   F  C P   
Sbjct: 37  LTPNIYRKGDDVELIVNKI---------ESDLTKL--------PYGYYDLPF-ICPPTNQ 78

Query: 84  EKQ-RESLGSIIFGDRIYNSPFQIEMLKNKECASLCS-ESIPADDAKFINKLITNGFFQN 141
            K    SL  I+ GDR + S + +   K+ +CA LC+ ++ P    K IN L+   +   
Sbjct: 79  RKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQ 137

Query: 142 WLVDG-LPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXXTK 200
           W +D  LPA+          ++Y PGF LG+V        +N                  
Sbjct: 138 WSIDNDLPASTTFISTSENRKYYIPGFSLGFVDPDTETAYLNNHVMLVIRYHAIDDEHFT 197

Query: 201 EV-------SESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFAN-HFEIEVQYHDR 251
            V       S SDY   P A R+  + + V+N  E V  +   Y      E +V++ DR
Sbjct: 198 IVGLEVYPKSVSDY-HCPGASRNYEQFELVANDDEEVTYIPFTYSVYWREEFDVEWKDR 255

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/342 (21%), Positives = 129/342 (37%), Gaps = 88/342 (25%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y +GD + +++N +                   E+  + Y YY  +F  C P   
Sbjct: 40  IKPNVYKKGDKVDVIINKVV-----------------SETARFPYGYYDLQF-VCPPSDK 81

Query: 84  EKQRE-SLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNW 142
           +K    SL  II GDR + S + +   +  +C  LC      +  K  + LI  G+  +W
Sbjct: 82  KKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHW 141

Query: 143 LV-DGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNXXXXXXXXXXXXXXXXTKE 201
           L+ D LPAA      ++  +FYT GF LG V                             
Sbjct: 142 LIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD---------------------------- 173

Query: 202 VSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVGV 261
                         ++  + ++ N   LV + +T     H  I  + + +   +    G 
Sbjct: 174 --------------AVTGKTRLYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGA 219

Query: 262 IVN--PYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETV-WATRWDKYLH- 317
             +  PY I  E               E+E T + F+YS+ +     + W+ RW+ ++H 
Sbjct: 220 NKDYQPYEINTE---------------ESEITYIPFTYSIYWREESNIDWSHRWNFFIHD 264

Query: 318 ------VYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDD 353
                        W SL N ++VVV +S + I  ++V + +D
Sbjct: 265 DTSSHSKRQSLFHWISLANSAIVVVLMS-LFIATIFVKIKND 305

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 67/139 (48%), Gaps = 22/139 (15%)

Query: 465 VPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARK-KCKWD 523
           +PGL+   +L LN  + + +S+ AIPFGT+ V V  +F+ S PLS+ G   ARK K    
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAK 459

Query: 524 EHPTK----------------TKQIPRQI---PFQPWYLKTVPASLIAGIFPFGSIAVEL 564
             P                  T+  P      PF       +  +++AGI PF  I VEL
Sbjct: 460 LAPANAISKSPFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICVEL 519

Query: 565 YFIYSSLWFN--KIFYMFG 581
           +++Y S+W      +Y++G
Sbjct: 520 FYVYKSMWLQTTNFYYLYG 538

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 40/75 (53%), Gaps = 3/75 (4%)

Query: 613 WQWRGFWIGG--AGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGF 670
           W+W+ F  GG  A       ++ ++F    L   ++I+L+V Y+ + + +     G +G+
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFV-LHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 671 LSSLWFVRRIYSSVK 685
           LS LWF+  I SS K
Sbjct: 674 LSCLWFLSHISSSSK 688

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 115/522 (22%), Positives = 195/522 (37%), Gaps = 101/522 (19%)

Query: 232 QLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTC-----DKTGELLKLS 286
           + +  Y  NHF + ++Y+      Y +VG  V P S+   S D C     D     +  S
Sbjct: 175 ETDVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSV---SDDHCPGSSKDYENYAVNPS 231

Query: 287 ETEATEVHFSYSVKFTPSETV-WATRWDKYLHVYDPKIQ---WFSLINFSLVVVFLSTVM 342
           E +   +  +YSV +     V W  RW+ YL   D  +     F  I  ++V + L+ + 
Sbjct: 232 EKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVNKSLCFRGIKVTMVFIILTLM- 290

Query: 343 IHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLM 402
                 +L   +SR   +     F      + +     R     L L+  V  G Q+   
Sbjct: 291 ------SLAIIVSRLG-LGTGSMFITAVASEWVR----RGAPCLLFLNTFVSMGIQVIFA 339

Query: 403 AACTIGFAXXXXXXXXXXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNML--- 459
           A  T+                  +  + Y + G F S         FGG     N+L   
Sbjct: 340 APATLLLICSMGKLHNISNFLVCIAALCY-MTGIFMSA--------FGGILLSGNLLDNK 390

Query: 460 --------LTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVA 511
                   L    +P L   V++  N    ++E    +PF  + +++ L+F+ S+PLS+ 
Sbjct: 391 AQIRKYSVLYGSALPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLL 450

Query: 512 GSLIARKKCKWDEH----------------PTK----------TKQIP----RQIPFQPW 541
           G   A  K K D+H                P+K          T+  P     QIP   W
Sbjct: 451 GGTSASYKLK-DQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--W 507

Query: 542 YLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNK----------IFYMFGXXXXXXXXXX 591
             K    + I GI PF +I +++ FI+  LW +           I  M            
Sbjct: 508 LSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICI 567

Query: 592 XXXXXXXXXXXXXXXCLENW-----------KWQWRGFWIGGAGCALYMFIHAILFTKF- 639
                          C ++             W+W+ F++GGA  A Y   +++ +  F 
Sbjct: 568 LIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKAFYMGGAA-AWYWEAYSLYYMIFI 626

Query: 640 -RLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRI 680
            RL  F +I+LY+ Y  ++++      G++G+L+  WF+ ++
Sbjct: 627 LRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 66/151 (43%), Gaps = 20/151 (13%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           V P  Y +G+ + +L+N +               +G    L  SY YY  +F  C P K 
Sbjct: 40  VRPRIYQDGEEVEMLLNQV---------------VGKPGEL--SYGYYDLQFT-CTPTKS 81

Query: 84  EKQ-RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNW 142
            +    SL  +  GDR + S +++   +  +C++LC            + LI   +    
Sbjct: 82  RRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQL 141

Query: 143 LVDG-LPAARKTTDVRTKSEFYTPGFELGYV 172
           L+D  +PA++    +R    +Y PGF LG+V
Sbjct: 142 LIDEIMPASKTYVSMRDNKRYYVPGFPLGFV 172

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 92/508 (18%), Positives = 190/508 (37%), Gaps = 66/508 (12%)

Query: 231 KQLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----S 286
           K     Y  NH  + ++Y+   +  + +VG  V   S+         K  E  +L    +
Sbjct: 183 KDKNKVYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYELVIPEN 242

Query: 287 ETEATEVHFSYSVKFTPS-ETVWATRW---DKYLHVYDPKIQWFSLINFSLVV------- 335
           + + T + F+YSV +    +  W +RW   D  +   DPK     LIN S++        
Sbjct: 243 DDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPK-----LINKSMLSNIMQPTR 297

Query: 336 --VFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLV 393
             +FL  ++I  + +    +    N+   +     +  W   +    ++   + IL++++
Sbjct: 298 TGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQLASKC-WIESNNINLKSSFSASILTLVI 356

Query: 394 GSGAQ--LFLMAACTIGFAXXXXXXXXXXXXXTTVMFILYALFGS--FGSYTSMATYKFF 449
             G Q    L+    +  +                ++ +  +  S   G++  M      
Sbjct: 357 SMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGTWLRMNILNKK 416

Query: 450 GGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLS 509
              Y     +L   L+P LL   +  ++  + ++ES+   PF T+ +++  +++  +P S
Sbjct: 417 SINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICVPFS 476

Query: 510 VAGSLIARKKCKW----------------DEHPTKTKQIPRQIPFQPWYLKTVPASLIAG 553
           + G  +A+K  K                 ++   + K   R        L T+  SLI  
Sbjct: 477 IIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKLGTLVYSLITA 536

Query: 554 IFPFGSIAVELYFIYSSLWFNKIFYM-------FGXXXXXXXXXXXXXXXXXXXXXXXXX 606
           I PF  I  ELY+I+++ W N   ++                                  
Sbjct: 537 IVPFFIIKSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTSLVGLFVNIMMTKK 596

Query: 607 CLENWK-----WQWRGFWIGGAGC------ALYMFIHAILFTKFRLGGFTTIVLYVGYSL 655
            +  W+      +W  F      C      +LY  I  I     R+ GF+  VL + Y++
Sbjct: 597 GISQWRDDPISLRWSCFLNSFNICYLTGLYSLYYIIEVI-----RIHGFSMTVLTIFYTI 651

Query: 656 VMSLLSCLITGTVGFLSSLWFVRRIYSS 683
            ++++  +  G + +++  W + ++Y +
Sbjct: 652 ALNVILGISCGAIAYMTCYWLIIKLYKN 679

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 59/149 (39%), Gaps = 18/149 (12%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y  GD + LLVN    T+   +AD            L  Y Y+   F  C P  +
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL---NAD------------LKPYIYHDLPF-VCPPTSV 90

Query: 84  EKQRE-SLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNW 142
            K       S+  GD +  S ++++   + EC  LC+     +       +I   +   W
Sbjct: 91  RKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQILW 150

Query: 143 LVDG-LPAARKTTDVRTKSEFYTPGFELG 170
            +D  LP +       T+ + Y PGF LG
Sbjct: 151 SIDDELPISMPYISTITQRKKYIPGFPLG 179

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 20/157 (12%)

Query: 26  PTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKLEK 85
           P+ Y  G+ + LLV+               N   D+E     + YY   F    P +   
Sbjct: 39  PSAYTRGERVQLLVD---------------NIWTDREV----WGYYETLFTCPPPAEARA 79

Query: 86  QRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNWLVD 145
              SLG +   +  + S + + +    +C  LC   +  D  + + ++I +G    W +D
Sbjct: 80  IYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLD 139

Query: 146 GLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMN 182
           GLPAA    D R  S  Y  GF+LG V      +R++
Sbjct: 140 GLPAATTYPD-RQSSYRYEAGFKLGEVDAETGHVRLH 175

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 108/492 (21%), Positives = 175/492 (35%), Gaps = 89/492 (18%)

Query: 240 NHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLS-ETEAT-EVHFSY 297
           NH  + V+Y    +G Y +VG    P S+  E         E   L+ + +A   V F+Y
Sbjct: 176 NHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNPDAQAMIMVPFTY 235

Query: 298 SVKFTPSETV-WATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSR 356
           +V +     V W  RW  Y       +Q  + I  S   + LS  +   +  TL   ++ 
Sbjct: 236 AVYWRYQSAVKWNERWRLY-----SDLQQLTGIVQSPGSLVLSRGLFAAMVGTLVLGMAS 290

Query: 357 YNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAXXXXXX 416
              +N        T   L+  D+      S     LVG+G Q   +AA            
Sbjct: 291 -AYLNKRCPATMHTLVTLLQEDMVG----SEFFHGLVGAGLQTMSLAAAY----ALVECE 341

Query: 417 XXXXXXXTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNM-----------LLTPILV 465
                  T V  +L A   + G+Y +     F+G   W               ++    +
Sbjct: 342 NDKAHGVTHVTIVLAATICALGAYLA----AFYGVWTWATTQSVVVHRYIKRSVICGSAI 397

Query: 466 PGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIA--------- 516
           P LLF     ++  +++ +    IPF T   ++ L+   S  LSV G   A         
Sbjct: 398 PILLFVTAAIVHLIVMLSDRTRGIPFATELAVLALYIPASAILSVFGGFTAFSILRTRED 457

Query: 517 -----RKKCKW----------DEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIFPF---- 557
                  K KW          +E+ T   ++ R        + +V  SL+AG+ PF    
Sbjct: 458 RVALLDSKGKWASATSEQKTTNENSTGRSRLTR--------IASVLYSLLAGVPPFILAK 509

Query: 558 ------------GSIAVEL-YFIYSSLWFNKIFYM---FGXXXXXXXXXXXXXXXXXXXX 601
                          A+EL  FI+S+L    +  +    G                    
Sbjct: 510 SLVQATYSTVAVAKSALELDAFIFSALALQCLVVVEVCIGTMLAQIFWSQIFQITGCEYP 569

Query: 602 XXXXXCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLG--GFTTIVLYVGYSLVMSL 659
                 L +W+W+   F +GGA  A Y+  HAI   +      G   I+L + Y+ V+++
Sbjct: 570 KPRKGVLYSWRWKL--FGVGGAA-AWYLEAHAIHSIRHAYAHLGSPNIILAIFYATVLNI 626

Query: 660 LSCLITGTVGFL 671
              L+ G  G+L
Sbjct: 627 AYWLVFGAFGYL 638

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 122/321 (38%), Gaps = 40/321 (12%)

Query: 231 KQLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKL----S 286
            Q    Y   H    V+YH   +  + +VG+ V P SI   +     K    L++    +
Sbjct: 197 NQTGQAYLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPLEVKVPEN 256

Query: 287 ETEATEVHFSYSVKFTPS-ETVWATRWDKY------LHVYDPKIQWFSLINFSLVVVFLS 339
             + T + FSYSV +    +  W  RWD +      L   D    W+SLIN + + V + 
Sbjct: 257 NDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWYSLINSNSITVGVI 316

Query: 340 TVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWK-----LIHGDVFRTPERSLILSVLVG 394
           T +   L +++      YN+            WK     +      R P    I ++ + 
Sbjct: 317 TFLC--LVISMNRMRILYNK-----------SWKKRQLSITTTTTTRYPN---IFTICIT 360

Query: 395 SGAQLFLMAACTIGFAXXXXXXXXXXXXXTTVMF------ILYALFGSFGSYTSMATYKF 448
           SG Q F +   ++                   +F      I+    G+    T + T   
Sbjct: 361 SGIQFFFLLISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTLIQRTFILTN-- 418

Query: 449 FGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPL 508
           F   Y+  N +L    +P  +   M  +N  + + E   A PF         +F+ SIPL
Sbjct: 419 FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSIPL 478

Query: 509 SVAGSLIARKKCKWDEHPTKT 529
           S+   +++ +   + ++P+++
Sbjct: 479 SIISGVLSTRFISFPKYPSRS 499

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 59/161 (36%), Gaps = 17/161 (10%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           + P  Y  GD + +  N   P           +D    +  L  YD  +     C P   
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-----------DDPAVSQPALCYYDLPF----VCPPSDT 104

Query: 84  EKQ-RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNW 142
           ++    SL  +  GD +  S + +E  K++ C  LCS        +    LI N +   W
Sbjct: 105 KRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQW 164

Query: 143 LVDG-LPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMN 182
            VD  LP        +   + Y PGF LGY      +  +N
Sbjct: 165 YVDNDLPVGTTYISNKVNKKQYLPGFSLGYFDNQTGQAYLN 205

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 65/150 (43%), Gaps = 13/150 (8%)

Query: 24  VAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDLGDKESLLYSYDYYYPKFHFCRPEKL 83
           V P TY  GD + ++VN +          ++ + LGD    + SY Y+   +  C P   
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV---------QEKDMLGDSNEGV-SYKYHDLPY-ICPPTNT 94

Query: 84  EKQ-RESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLITNGFFQNW 142
           +K    SL  +  GD    S + ++   + +C +LC         +   ++I   +  NW
Sbjct: 95  KKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNW 154

Query: 143 LVDG-LPAARKTTDVRTKSEFYTPGFELGY 171
            +D  LPAA       T+ + Y  GF LG+
Sbjct: 155 FIDDYLPAATTYISSVTRKKKYFEGFSLGW 184

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 133/308 (43%), Gaps = 33/308 (10%)

Query: 237 YFANHFEIEVQYHDRGNGNYRVVGVIVNPYSI-KRESPDTCDKTG--ELLKLSET-EATE 292
           Y  NH  + ++Y+   +  + +VG  V P SI   + P      G  EL  L    E + 
Sbjct: 193 YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYELKDLENNDEFSL 252

Query: 293 VHFSYSVKFTPS-ETVWATRWDKY-------LHVYDPKIQ---------WFSLINFSLVV 335
           + FSYSV +    E  W TRW  +       L   D  +Q         W+S   ++ V+
Sbjct: 253 IPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISNLLHWYS--PYTTVI 310

Query: 336 VFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGS 395
           +F    ++  L   L  D++ +  + + +  +    W      + +T  ++++L++LV  
Sbjct: 311 IF---TILLFLVSLLVLDINSHKLVFMSNP-KTVIAWATTANKLNKT-WKNILLNILVSM 365

Query: 396 GAQ-LFL-MAACTIGFAXXXXXXXXXXXXXTTVMFILYALF-GSF-GSYTSMATYKFFGG 451
           G Q LF+ M    I  +               + +I  +L  GSF G++  M  ++    
Sbjct: 366 GCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTWLRMYMFQKKMT 425

Query: 452 PYWKVNM-LLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSV 510
           P +   M ++   ++PGL    +   N     +E   + PF  +  ++ ++F+FSIP+S+
Sbjct: 426 PNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFIFSIPMSL 485

Query: 511 AGSLIARK 518
            G  +A K
Sbjct: 486 IGGSLAVK 493

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 26/39 (66%)

Query: 645 TTIVLYVGYSLVMSLLSCLITGTVGFLSSLWFVRRIYSS 683
           T ++L +GYSL+ +LL  L  G + +++S+WF+   + S
Sbjct: 687 TLLLLSIGYSLLFNLLIGLAAGFISYMASVWFIVNRFKS 725

>SAKL0E06226g Chr5 complement(505827..508091) [2265 bp, 754 aa] {ON}
           similar to uniprot|P32567 Saccharomyces cerevisiae
           YMR165C SMP2 Protein involved in respiration and plasmid
           maintenance
          Length = 754

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 220 RKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPY 266
           + +V +T E++KQL    F N ++I     +  NGN R    IVNPY
Sbjct: 192 KNKVHDTDEMLKQLLQDEFGNDYDISTFVKEDQNGNIR----IVNPY 234

>NCAS0A13700 Chr1 (2692827..2693840) [1014 bp, 337 aa] {ON}
           Anc_7.279
          Length = 337

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 31/70 (44%)

Query: 264 NPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKYLHVYDPKI 323
           +P  +  + P   ++   +++ SET       S+  +  P ET   + WDK L   D + 
Sbjct: 210 DPLGLYSKGPSGKNQENGVMRQSETVKNGAPSSFKEELNPQETNSRSSWDKVLQKSDKQS 269

Query: 324 QWFSLINFSL 333
            W  + N +L
Sbjct: 270 SWDRVRNGTL 279

>NCAS0B07560 Chr2 complement(1426000..1427477,1427593..1427602)
           [1488 bp, 495 aa] {ON} Anc_1.303 YBR283C
          Length = 495

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 3/58 (5%)

Query: 520 CKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIF--PFGSIAVELYFIYSSLWFNK 575
           CK   H      I   +P  P  L T P SLI G+F  P   I   L+ + +S+WF K
Sbjct: 328 CKILGHYENVNNI-LAVPTFPLSLLTPPRSLIGGLFSQPLTFIVFTLFIVSTSVWFAK 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,668,662
Number of extensions: 2847634
Number of successful extensions: 8864
Number of sequences better than 10.0: 50
Number of HSP's gapped: 8895
Number of HSP's successfully gapped: 99
Length of query: 687
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 570
Effective length of database: 40,065,477
Effective search space: 22837321890
Effective search space used: 22837321890
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)