Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13860g8.255ON70870834280.0
Kwal_56.235838.255ON70069626480.0
SAKL0H17226g8.255ON71975218520.0
Suva_2.2688.255ON69573118280.0
YDR108W (TRS85)8.255ON69873418210.0
Skud_4.3698.255ON69871818200.0
TDEL0F038208.255ON68771717670.0
Smik_4.3548.255ON69873817650.0
Kpol_392.118.255ON67572517480.0
ZYRO0C01826g8.255ON69973917470.0
NCAS0B038808.255ON70672017270.0
NDAI0J014108.255ON71672817100.0
CAGL0B01705g8.255ON67271417040.0
KAFR0B055708.255ON66970316090.0
TPHA0B032608.255ON71461814610.0
KNAG0H032708.255ON64873113671e-180
TBLA0E043808.255ON88965513831e-180
Ecym_43168.255ON62369513401e-177
KLLA0F18953g8.255ON64769612971e-170
AGR096C8.255ON62346110721e-136
KNAG0C006101.55ON67349800.62
KLTH0F01716g1.55ON73335742.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13860g
         (708 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...  1325   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...  1024   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   717   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   708   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   706   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   705   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   685   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   684   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   677   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   677   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   669   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   663   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   660   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   624   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   567   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   531   e-180
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   537   e-180
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   520   e-177
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   504   e-170
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   417   e-136
KNAG0C00610 Chr3 (103834..105855) [2022 bp, 673 aa] {ON} Anc_1.5...    35   0.62 
KLTH0F01716g Chr6 (133903..136104) [2202 bp, 733 aa] {ON} simila...    33   2.7  

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score = 1325 bits (3428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 657/708 (92%), Positives = 657/708 (92%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           MPLSFGKYMNLAFHLDSALEPVPTEISRKI                LDEHIQESYGVDSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDV 120
           YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDV
Sbjct: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDV 120

Query: 121 RESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYE 180
           RESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYE
Sbjct: 121 RESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYE 180

Query: 181 SFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEED 240
           SFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEED
Sbjct: 181 SFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEED 240

Query: 241 SREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMK 300
           SREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMK
Sbjct: 241 SREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMK 300

Query: 301 ESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLIS 360
           ESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLIS
Sbjct: 301 ESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLIS 360

Query: 361 KTXXXXXXSDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQ 420
           KT      SDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQ
Sbjct: 361 KTPAPPPASDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQ 420

Query: 421 RPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXX 480
           RPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQL  
Sbjct: 421 RPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLKS 480

Query: 481 XXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLS 540
                         TLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLS
Sbjct: 481 SALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLS 540

Query: 541 DTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQN 600
           DTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQN
Sbjct: 541 DTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQN 600

Query: 601 EKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQA 660
           EKR             TQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQA
Sbjct: 601 EKRGEESEGSDESDDETQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQA 660

Query: 661 YWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHEPLPQKLNTSFIST 708
           YWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHEPLPQKLNTSFIST
Sbjct: 661 YWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHEPLPQKLNTSFIST 708

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score = 1024 bits (2648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/696 (71%), Positives = 561/696 (80%), Gaps = 2/696 (0%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           MPLS+ +YMNL  HLDSA EPVP+EISRKI                LD+HIQESYG+DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDV 120
           YMLLRYFGDC+SDRDQA++  E G E  K+R R+RS SLFQRQAS +LRFTRPL+D+I  
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVEPNKSRARSRSGSLFQRQASQFLRFTRPLSDIIGT 120

Query: 121 RESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYE 180
           RE+RDLLFDYHSLEVFL+KYL LV+  T+ DTPHTLLQHSIYHKFFTTAISSTAHLSPYE
Sbjct: 121 RETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQHSIYHKFFTTAISSTAHLSPYE 180

Query: 181 SFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEED 240
            FNHPV SLLALDIS+++GYE+ARDLL+ FKNMHN TPHFP+FINVNDILPVFLLCYEE 
Sbjct: 181 CFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTPHFPSFINVNDILPVFLLCYEEG 240

Query: 241 SREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMK 300
           SREQFE CQSL+K +KKQLFVESLLLPCW  N  A  +P+R+LHQPIMSSLEETM+SM+K
Sbjct: 241 SREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDTPTRVLHQPIMSSLEETMFSMLK 300

Query: 301 ESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLIS 360
           +S   LPL  I +IYDRLT L+DELMIPFMKRKISFW+ESILQPR+SIFPNSKFFRKLIS
Sbjct: 301 DSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWEESILQPRRSIFPNSKFFRKLIS 360

Query: 361 KTXXXXXXSDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQ 420
           K       +DSATHS+QG+AYFAATSNE +LRKLADWSFMLSDFK AYSTYELLSKDFEQ
Sbjct: 361 KAPTPSTNNDSATHSEQGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQ 420

Query: 421 RPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXX 480
            PEYLA CLEWCALSVLMGAQSIVTVKMIKNDIDPLI RALKSYEL A KAKE+N  L  
Sbjct: 421 HPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKS 480

Query: 481 XXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLS 540
                            S   D+      D  +SS PSQSAQSYETRCMLLAAELFLSLS
Sbjct: 481 KLQNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSLS 540

Query: 541 DTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSG-Q 599
           DTWTATPYAIKYLETILD+CT+G+LSEIV+WERLAYCYALRVDPRVK +L + + QS  Q
Sbjct: 541 DTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCYALRVDPRVKSRLTASEIQSSDQ 600

Query: 600 NEK-RXXXXXXXXXXXXXTQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWR 658
           NEK               +Q   HK+SQ+C+AS GL R+RK+TLFRLIATKKWTESKQWR
Sbjct: 601 NEKLDEESEGSDNDSGDESQVCQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWR 660

Query: 659 QAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEH 694
           QA W  +D+EV+YS L FANR+DLIL+KL K+I +H
Sbjct: 661 QACWSFQDLEVMYSHLVFANREDLILKKLEKRIAQH 696

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/752 (52%), Positives = 483/752 (64%), Gaps = 100/752 (13%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVP--TEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVD 58
           M LS+  YMNL +H+D + E V   +E+++KI                LD H+QE+YG+ 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLI 118
           S+YMLLR+FGDCV+DRDQ     E  TE+   + R RSNSLFQR++S ++RFTRPL DL+
Sbjct: 61  SMYMLLRFFGDCVTDRDQ-----ENETETN-FKGRPRSNSLFQRESSTFVRFTRPLIDLV 114

Query: 119 DVRES-RDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLS 177
           DVR S   +LFDYHSLE+FL+KYL LV+   +++TPH LL+HSIYHKFFT AISSTA+LS
Sbjct: 115 DVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHRLLKHSIYHKFFTAAISSTAYLS 174

Query: 178 PYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTT---PHFPAFINVNDILPVFL 234
           PYESFNHPV SLLALDIS+   YE ARDLLI FKNM++ T     FP FIN+NDILPVFL
Sbjct: 175 PYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPVFL 234

Query: 235 LCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGA-SPSRILHQPIMSSLEE 293
           LCY + S EQFE CQSL+K +KKQLFVES+LLP W  + +  A  P RILH PIMSSLEE
Sbjct: 235 LCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSLEE 294

Query: 294 TMYSMMKE----------------STITLPLSLINYIYDRLTNLIDELMIPFMKRKISFW 337
            +Y +  E                S+  LPL+L+  IYDRL  LI ELMIPFMKRKISFW
Sbjct: 295 MLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKISFW 354

Query: 338 DESILQPRKSIFPNSKFFRKLISKTXXXXXXSDSATHSQQGVA---YFAATSNEFILRKL 394
           +E+ILQPRKSIF N+KF R+ +SK+      +   + S   V    +F A+SNEF+LRKL
Sbjct: 355 EETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLRKL 414

Query: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454
           ADWSFMLSD++ AY+TY+ LSKD E   EYLA CLEWCA+SVLMGAQSIVTVKMIKNDID
Sbjct: 415 ADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKNDID 474

Query: 455 PLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVS 514
           PLI+++L+ YE  A K                        T P          E D  V 
Sbjct: 475 PLISKSLQCYEKCASK-----------------------LTSPHVA-------EADSPVD 504

Query: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574
           S P   AQSYETRCMLL+AELFLSLSDTWTATPYAIKYLETIL  C LG  S+++LWE+L
Sbjct: 505 SKP---AQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKL 561

Query: 575 AYCYALRVDPRV------------------------------KGKLPSLDGQSGQNEKRX 604
           AYCY LRVDPRV                              +    +   Q+G  E++ 
Sbjct: 562 AYCYELRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQS 621

Query: 605 XXXXXXXXXXXXTQKYDHKISQNCM-----ASLGLARRRKSTLFRLIATKKWTESKQWRQ 659
                        +++   ++ N +     A LGL RRRK+  FRLIA  KW E KQW+Q
Sbjct: 622 DTDSKDEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQ 681

Query: 660 AYWGLKDIEVVYSELDFANRDDLILEKLRKKI 691
           A W L+D++ VYS L F+ R  LILE+L  +I
Sbjct: 682 ASWLLRDVDTVYSGLVFSYRKGLILERLVGEI 713

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/731 (50%), Positives = 476/731 (65%), Gaps = 75/731 (10%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL FHLD + E VP EI+++I                 D+HIQE+Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRYFGDCVSDRDQAEAG----------PELGTESGKNRN-----------RARSNSL 99
           YMLLR+FG CVSDRDQA  G          P + + S KN+N           R+RSNSL
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIES-SSKNQNLGVPSALKRGSRSRSNSL 119

Query: 100 FQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLL 157
           FQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEVFL+ YL LV  NT    PH LL
Sbjct: 120 FQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLL 179

Query: 158 QHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTT 217
           + SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++ T
Sbjct: 180 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNT 239

Query: 218 PHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGA 277
             FP F+N N++LPVFLLCY ++S+E+FE CQ+L+K +KKQLFVES+LLP W  +     
Sbjct: 240 ESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVE 299

Query: 278 SPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFW 337
           + +  LHQP+MSSLEE ++ +   +   L L LIN IYD L  L+ +LMIPFMKRKISFW
Sbjct: 300 NSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFW 359

Query: 338 DESILQPRKSIFPNSKFFRKLISKT-XXXXXXSDSATHSQQGVAYFAATSNEFILRKLAD 396
           +E+ILQPRKS+F  +KFF+K ++K         +S T   QG  YFA++S+EF++RKLAD
Sbjct: 360 EETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLAD 419

Query: 397 WSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPL 456
           WS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQSIVTVKMIKNDI+PL
Sbjct: 420 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 479

Query: 457 INRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSA 516
           I RAL +YE  +R  +  + +L                                   SS 
Sbjct: 480 IERALATYENCSRMQRRNSKEL----------------------------------TSSG 505

Query: 517 PSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAY 576
             +  +SYETRCM+LA+ELFLSLSDTWT+TPYAI+YLETILDEC LG  S+I++WERL+ 
Sbjct: 506 VLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSD 565

Query: 577 CYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYD-HKISQNCMASLGLA 635
           CY LRVDPRVK K+  +       E                 +YD    ++  + S GL 
Sbjct: 566 CYNLRVDPRVKHKVGGMKKSVKNTED-----------LRNDDEYDTDHFTEEDILSEGLT 614

Query: 636 RRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHE 695
           RRRK+  FRL+A KKW E KQWRQ  W LKDIE  YS++DF + + LIL  L+ +++  +
Sbjct: 615 RRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLNSKD 674

Query: 696 ----PLPQKLN 702
               P P + N
Sbjct: 675 VDSAPTPTEKN 685

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/734 (50%), Positives = 481/734 (65%), Gaps = 78/734 (10%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL FHLD++ E VP EI+++I                 D+HIQE+Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRYFGDCVSDRDQAEAGP------ELGTESG------KNRN-----------RARSN 97
           YMLLR+FG CVSDRDQA          E+   S       KN+N           R+RSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 98  SLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHT 155
           SLFQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEVFL+ YL LV ANT    PH 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 156 LLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHN 215
           LL+ SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 216 TTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINA 275
            T +FP F+N N++LPVFLLCY +DS+E+FE CQ+L+K +KKQLFVES+LL  W  +   
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 276 GASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKIS 335
             +    LHQP+MSSLEE ++ +   +  TL L+LIN IYD L  L+ +LMIPFMKRK+S
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 336 FWDESILQPRKSIFPNSKFFRKLISKT-XXXXXXSDSATHSQQGVAYFAATSNEFILRKL 394
           FW+E+ILQPRKS+F  +KFF+K ++K         +S T   QG  YFA++S+EF++RKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454
           ADWS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQSIVTVKMIKNDI+
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 455 PLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVS 514
           PLI RAL +YE  +R  + K                               G+E +    
Sbjct: 481 PLIERALATYENCSRIQRGK-------------------------------GKESNSLDV 509

Query: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574
           + P    +SYETRCM+LA+ELFLSLS+TWT+TPYAI+YLETILDEC LG  S+I++WERL
Sbjct: 510 TEP---VRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMVWERL 566

Query: 575 AYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKY--DHKISQNCMASL 632
           + CY LRVDPR+K ++ ++   +   E                 KY  DH   ++ ++  
Sbjct: 567 SDCYNLRVDPRIKHRVGAMKKDAKDTED-----------LRGEHKYSTDHFTDEDILSE- 614

Query: 633 GLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH 692
           GL RRRK+  FRLIA KKW E KQWRQ  W LKDIE  YSE+ F + + LIL KL+ +++
Sbjct: 615 GLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674

Query: 693 ----EHEPLPQKLN 702
               +  P P + N
Sbjct: 675 LKDVDSAPRPSEKN 688

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/718 (51%), Positives = 481/718 (66%), Gaps = 70/718 (9%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL FHLD++ E VP EI+++I                 D+HIQE+Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRYFGDCVSDRDQA---EAGPE--------LGTES-GKNRN-----------RARSN 97
           YMLLR+FG CVSDRDQA   + GP         +  ES  KN+N           R+RSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 98  SLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHT 155
           SLFQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEV+L+ YL LV  NT    PH 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 156 LLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHN 215
           LL+ SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 216 TTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINA 275
            T +FP F+N N++LPVFL+CY ++S+E+FE CQ+L+K +KKQLFVES+ LP W ++   
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 276 GASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKIS 335
             + S  LHQP+MSSLEE ++ +   +  TL L LIN IYD L  L+ +LMIPFMKRK+S
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 336 FWDESILQPRKSIFPNSKFFRKLISKT-XXXXXXSDSATHSQQGVAYFAATSNEFILRKL 394
           FW+E+ILQPRKS+F  +KFF+K ++K         +S T  +QG  YF+++S+EF++RKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454
           ADWS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQSIVTVKMIKNDI+
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 455 PLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVS 514
           PLI RAL +YE        K +Q+                         H G+EL    S
Sbjct: 481 PLIERALATYE--------KCSQI-----------------------QRHKGKELS---S 506

Query: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574
           S+ ++  +SYETRCM+LA+ELFLSLSDTWT+TPYAI+YLETILDEC LG  S+I++WERL
Sbjct: 507 SSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDECKLGPCSQIMIWERL 566

Query: 575 AYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGL 634
           + CY LRVDPR+K ++  +     + E                   DH I ++ ++  GL
Sbjct: 567 SDCYNLRVDPRIKHRVGVMKKSFKETED---------LRNGDEHYTDHFIEEDILSE-GL 616

Query: 635 ARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH 692
            RRRK+  FRLIA KKW E K WRQ  W LKDIE  YSE+ F + +D IL KL+ +++
Sbjct: 617 TRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/717 (50%), Positives = 462/717 (64%), Gaps = 75/717 (10%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           + LS+  YMNL  HLD   + VP +I+++I                LD HIQE++ +DSL
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNR---------------NRARSNSLFQRQA- 104
           YMLLR+FGDCV DRDQA      G+ SG +R               +R RSNSLFQR A 
Sbjct: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121

Query: 105 -SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYH 163
            S Y+RFTRPL DL++  ++ D+LFDYH+LE FLE  L L+E +T   TPH LL+ S+YH
Sbjct: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKSLYH 181

Query: 164 KFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAF 223
           +FF+ AISSTA+LSPYE+FNHPV SL+ALDI   QGYEEARDLL  FKN+++TT +FP F
Sbjct: 182 RFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPVF 241

Query: 224 INVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRIL 283
           +N ND+LPVFLLCY  DS EQ+E+CQSL+K +KKQLFVE +LLP W  N         IL
Sbjct: 242 LNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQV--IL 299

Query: 284 HQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQ 343
           HQPIM+SL+E +Y + + S I L L LIN IYD L  LI+ LMIPFM+RKISFW+E+ILQ
Sbjct: 300 HQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETILQ 359

Query: 344 PRKSIFPNSKFFRKLISKTXXXXXXSDSATHSQ--QGVAYFAATSNEFILRKLADWSFML 401
           PR+S+F  SKF ++ +SKT         A+ ++   G  YF ++S EF++RKLADWS ML
Sbjct: 360 PRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMML 419

Query: 402 SDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRAL 461
           SD+K AYSTY+ LS D E  P+YLASCLEWC++SVLMGAQ+IVT KM+K DIDPLI RA+
Sbjct: 420 SDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAV 479

Query: 462 KSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSA 521
           ++YE  A      + QL                          SG +  +  S AP    
Sbjct: 480 ETYENCAL----YDTQL--------------------------SGSK--KSNSMAP---V 504

Query: 522 QSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALR 581
           +SYETRCM LA+ELFLSLSDTWT+TPYA++ LETIL EC LG  S+I++WERL+ CY  R
Sbjct: 505 RSYETRCMFLASELFLSLSDTWTSTPYALRNLETILAECRLGPCSQIMIWERLSNCYQQR 564

Query: 582 VDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASL---GLARRR 638
           +D R++ K+   DG     EK               +  D    ++  A +   GL R R
Sbjct: 565 IDHRIRHKVN--DGAMSNEEK--------------VENEDDSEKEHTHADIVTRGLTRMR 608

Query: 639 KSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHE 695
           K+  F+LIA  KW E KQWRQA W LKD E  Y+ ++F NR DL L KL++ +   E
Sbjct: 609 KAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETLKNVE 665

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/738 (48%), Positives = 476/738 (64%), Gaps = 74/738 (10%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL FHLD++ E VP EI+++I                 D+HIQE+Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRYFGDCVSDRDQA------EAGPELGTESG-----------------KNRNRARSN 97
           YMLLR+FG CVSDRDQA      +   ++G  +                  K  +R+RSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 98  SLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHT 155
           SLFQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEVFL+ YL LV  NT    PH 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 156 LLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHN 215
           LL+ SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 216 TTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINA 275
            T +FP F+N N++LPVFLLCY ++S+E+FE CQ+L+K +KKQLFVES+LL  W  +   
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 276 GASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKIS 335
             + +  LHQP+MSSLEE ++ +   +  +L L LIN IYD L  L+ +LMIPFMKRK+S
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 336 FWDESILQPRKSIFPNSKFFRKLISKT-XXXXXXSDSATHSQQGVAYFAATSNEFILRKL 394
           FW+E+ILQPRKS+F  +KFF+K ++K         +S T   QG  YFA++S+EF++RKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454
           ADWS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQ IVTVKMIKNDI+
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 455 PLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVS 514
           PLI +AL +YE  ++  + K+ +                    +TV              
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSS----------------NTV-------------- 510

Query: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574
               +  +SYETRCM+LA+ELFLSLSD WT+TPYAI+YLETILDEC LG   +I++WERL
Sbjct: 511 ----EPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERL 566

Query: 575 AYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGL 634
           + CY+LRVDPR+K ++ ++       E                   DH  + + + S GL
Sbjct: 567 SDCYSLRVDPRIKHRVGAMKKGIRDTED---------LRGGDGNSTDH-FTDDDILSEGL 616

Query: 635 ARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH-- 692
            R+RK+  FRLIA +KW E KQWRQ  W LKDIE +YS++ F N D LIL KL  +++  
Sbjct: 617 TRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLNLK 676

Query: 693 --EHEPLPQKLNTSFIST 708
                P P + N +  S 
Sbjct: 677 DLNSAPSPTEKNPTMTSV 694

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/725 (48%), Positives = 468/725 (64%), Gaps = 93/725 (12%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           +  S+  YMNL +HLD   EPVP +IS++I                LD+H+Q+SY +DSL
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 61  YMLLRYFGDCVSDRDQA-----EAGPELGTESGKN-------RN-------------RAR 95
           Y+L+RYFG C+SDRDQA     +A  E   + G N       RN             R+R
Sbjct: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123

Query: 96  SNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTP 153
           SNSLFQR +  SHY+RFT+P+ DLI+ R+S D+LFDYHSLEV+LEK LSL++ NT  +T 
Sbjct: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183

Query: 154 HTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNM 213
           H  L+ S++H+FF++AISST +LSPYESFNHP+ SL+ALDISK Q YE+ARDLLI FKN 
Sbjct: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243

Query: 214 HNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNI 273
           +N    FP F++ NDIL VFLLCY+ DS EQ E+CQ + K +KKQLF ESL+LP W ++ 
Sbjct: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303

Query: 274 NAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRK 333
           +        LHQP MSSL+E +Y   + S   LPL+LIN IYD +  L+ +LMIPFM+RK
Sbjct: 304 SEDVQVE--LHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRK 361

Query: 334 ISFWDESILQPRKSIFPNSKFFRKLISKTXXXXXXS-DSATHSQQGVAYFAATSNEFILR 392
           ISFW+E+ILQPRKS+F  +K FRK ++++        ++     +G  YF ++S EF+LR
Sbjct: 362 ISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLR 421

Query: 393 KLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKND 452
           KLADWS M+SDFK AYSTYE L  D E  P+YLASCLEWCA+S+LMGAQ+IVT KMIKND
Sbjct: 422 KLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKND 481

Query: 453 IDPLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEG 512
           ++PLI R+L +YE  +  A+                                +  E DE 
Sbjct: 482 VNPLIERSLDTYEQCSILAQ--------------------------------NSLENDEL 509

Query: 513 VSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWE 572
           +    S+  +SYETRCMLL +ELFLSL+DTWT+TPYA+  LETIL EC LG  S+I++WE
Sbjct: 510 L----SEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWE 565

Query: 573 RLAYCYALRVDPRVKGKLPSL----DGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNC 628
           RL+ CY +R DPR++ ++ ++    + + GQ                       ++  + 
Sbjct: 566 RLSDCYNMRTDPRIRHRVETVTKIENNEGGQ-----------------------QLQTDD 602

Query: 629 MASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLR 688
           + S GLAR+RK+  FRL+A KKW E KQWRQ  W L+D+E +Y +L F+ R +LI +KL+
Sbjct: 603 IVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLK 662

Query: 689 KKIHE 693
            +++E
Sbjct: 663 DELNE 667

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/739 (48%), Positives = 456/739 (61%), Gaps = 104/739 (14%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M LS+  YMNL FHLD   E VP +I+R+I                LD HI+++Y +DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRYFGDCVSDRDQA--------EAGPELGTESGKNRN-------------------- 92
           YM LR+FGDCVSDRDQA        +  PEL  E     +                    
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 93  --------------RARSNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVF 136
                         R RSNSLFQR    S Y+RFTRP+ DLI+  +S D+LFDYHSLEVF
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 137 LEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISK 196
           LE  L LVE  T  +TP  LL+ S+YHKFF+ AISST +LSPYE+FNHPV SL+A+DIS 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 197 DQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIK 256
            QGYEEARDLLI FKN+++T  +FP F++  DILPVFLLCY ++S ++   CQ L+  +K
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 257 KQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYD 316
           KQLFVESLLLP W ++ +        LHQPIMSSLEE +Y +   +   LPL LIN  Y+
Sbjct: 301 KQLFVESLLLPLWKRSYSDHGEVE--LHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358

Query: 317 RLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKTXXXXXXSD--SATH 374
            L  L+ +LM+PFMKRKISFW+E+ILQPRKS+F  + FF+KL+SK           S   
Sbjct: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGK 418

Query: 375 SQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCAL 434
            + G  YF A+S EF++RKLADWS MLSDFK AYSTYE L  D E  P+YLASC EWCA+
Sbjct: 419 DKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAV 478

Query: 435 SVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXX 494
           SVLMGAQ+IVTVKMIKNDIDPLI RAL++YE  A                          
Sbjct: 479 SVLMGAQNIVTVKMIKNDIDPLIQRALETYENCA-------------------------- 512

Query: 495 TLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLE 554
                  ++ +G+EL   V        +SYETRCM LA+ELFLSLSDTWT+TPYA+  LE
Sbjct: 513 -----ADEDSTGEELYVPV--------RSYETRCMFLASELFLSLSDTWTSTPYALNSLE 559

Query: 555 TILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXX 614
           TIL EC LG  SEI++WERL+ CY  R+DPR++ K  +   ++  +E             
Sbjct: 560 TILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGAKAMTDELAPDEE------- 612

Query: 615 XXTQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSEL 674
                     S   + + GL R+RK+  FRLIA  KW E KQW+QA+W LK+IE  Y+ L
Sbjct: 613 ----------SNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAGL 662

Query: 675 DFANRDDLILEKLRKKIHE 693
           DF NR+DLIL +L+++++E
Sbjct: 663 DFVNREDLILARLKRQMNE 681

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/720 (48%), Positives = 459/720 (63%), Gaps = 62/720 (8%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL FHLD   E VP+EI+++I                LD HI E+Y +DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRYFGDCVSDRDQAEAGPE-------------LGTESG----KNRNRARSNSLFQRQ 103
           YMLLR+F  CVSDRDQA    +             L T S     + R R+RSNSLFQR 
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQRD 120

Query: 104 A--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSI 161
           +  S Y+RFT+PL D+I  + + D+LFDYHSLE++L+ YL L++ NT  +TP+ LL+ SI
Sbjct: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYELLKKSI 180

Query: 162 YHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFP 221
           YH FF+ AISST  LSPYE FNHPV SL+A+DIS  Q Y++ RDLL+ FKN++++T +FP
Sbjct: 181 YHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTHNFP 240

Query: 222 AFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSR 281
            F+N ND+LPV LLCY++   EQFE CQ+L+K IKKQLFVE + LP W  +    + P  
Sbjct: 241 IFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY--PSDPQV 298

Query: 282 ILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESI 341
            LHQP+MSSLEE +Y + +   +TLP  LI  IY+ L +L+  LMIPFMKRKI+FWDE+I
Sbjct: 299 HLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWDETI 358

Query: 342 LQPRKSIFPNSKFFRKLISKTXXXXXXSDSATHSQQGVAYFAATSNEFILRKLADWSFML 401
           LQPRKS+F  +KF +K ++KT       +  T   QG  YF + S+EF++RKLADWS ML
Sbjct: 359 LQPRKSLFHGAKFLKKFMTKT-ALTHQENLLTKDAQGNEYFTSASSEFLMRKLADWSMML 417

Query: 402 SDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRAL 461
           SDFK AY+TYE L+ D E  P+Y ASCLEWCA+S+LMGAQ+IVTVKM+KNDI+PLI +AL
Sbjct: 418 SDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPLIEKAL 477

Query: 462 KSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSA 521
            +YE  A                              TV  E   +  DE +        
Sbjct: 478 STYENCA------------------------------TVLPETDKRNTDELIVVP----V 503

Query: 522 QSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALR 581
           +SYETRCM+LA+ELFLSLSDTWT+TPYAI YLETIL EC LG+ S+I++WERL+ CY LR
Sbjct: 504 RSYETRCMILASELFLSLSDTWTSTPYAISYLETILVECKLGACSQIMIWERLSDCYELR 563

Query: 582 VDPRVKGKLP------SLDGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGLA 635
           VDPR+K K        S   +S +++ +                  +  +   + S G  
Sbjct: 564 VDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFT 623

Query: 636 RRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHE 695
           R+RK+  FRL+A KKW E K+WRQ  W L+ I+  YS++  A+RDDLIL+K++ K+   E
Sbjct: 624 RKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKLKTAE 683

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/728 (49%), Positives = 461/728 (63%), Gaps = 70/728 (9%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL FHLD A E VP EI+++I                LD HIQE+Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRYFGDCVSDRDQAE----------------AGP--ELGTESGKN-------RNRAR 95
           YMLLRYFG CVSDRDQA                 + P   L   SG+        R R+R
Sbjct: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120

Query: 96  SNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTP 153
           SNSLFQR +  S Y+RFT+P+ D++ ++ S D+LFDYHSLE++LE+YL L+  NT + TP
Sbjct: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTP 180

Query: 154 HTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNM 213
           + LL++SIYH FF+ AISST  LSPYE+FNHP+ SL+A+DIS  Q Y++ RDLL+ FKN+
Sbjct: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240

Query: 214 HNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNI 273
           + TTP+FP F+N ND+LP+FLLCY+ + +EQFE+CQSL+K +KKQLFVESL+LP W +  
Sbjct: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300

Query: 274 NAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRK 333
                    LHQPIMSSLEE +Y +    +  L +SLIN IY+ L +LI +LM+PFMKRK
Sbjct: 301 EIDIKVD--LHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRK 358

Query: 334 ISFWDESILQPRKSIFPNSKFFRKLISKTXXXXXXSDSATHSQQGVAYFAATSNEFILRK 393
           + FW+E+ILQPR+S+F  +KF +K ++K        +  T   +G  YFA +S E ++RK
Sbjct: 359 LLFWEETILQPRRSLFHGAKFLKKFMTKN-NNGPQENILTKDSEGNEYFAFSSTELLMRK 417

Query: 394 LADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDI 453
           LADWS M+SDFK AYSTYE LS+D +  P+YLASCLEWCA S+LMGAQSIVTVKMIKNDI
Sbjct: 418 LADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDI 477

Query: 454 DPLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGV 513
           +PLI RAL++YE  A    +                        + V  E S + L    
Sbjct: 478 NPLIERALQTYENCAITLIQDTT---------------------NKVFAEQSVEPL---- 512

Query: 514 SSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWER 573
                   +SYETRCM+L +ELFLSLSDTWT+TPYAI YLETIL EC LG  S+I +WER
Sbjct: 513 --------RSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTECKLGPCSQIQIWER 564

Query: 574 LAYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXX--XTQKYDHKI-----SQ 626
           L+ CY LR+DPR++ K+      +                     T +++  +     S 
Sbjct: 565 LSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKVVATPSTDKPKTIQWESDLESKLGSG 624

Query: 627 NCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEK 686
             + S G  RRRKS  FRLIA KKW E KQWRQ  W LKD+E +Y   D   RDDLI+ K
Sbjct: 625 KNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAK 684

Query: 687 LRKKIHEH 694
           LR  + E+
Sbjct: 685 LRNLLDEN 692

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/714 (47%), Positives = 457/714 (64%), Gaps = 72/714 (10%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL +HLD A E VP++I++++                LD HI+E+YG+DSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRYFGDCVSDRDQAEAGPELGTES-------------GKN--------RNRARSNSL 99
           YMLLR+FG CVSDRDQA    +LGT+              G N        R R+ SNSL
Sbjct: 61  YMLLRFFGGCVSDRDQANE-VKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSL 119

Query: 100 FQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLL 157
           +QR A  S Y+RFT+PL DLI+ +++ D+LFDYHSLEV+L++YLS+V+   +   PH LL
Sbjct: 120 YQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLL 179

Query: 158 QHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTT 217
           + SIYH FF  AISST+ LSP+E FNHP+ SLLA+DI++++ YE A + L  FK+M+N  
Sbjct: 180 KTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNI 239

Query: 218 PHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGA 277
           P FP+FIN NDILPVFLLCY +D+  +FE CQ+L+  +KKQLFVES++LP W        
Sbjct: 240 PSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNL 299

Query: 278 SPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFW 337
             S  LHQP+MSS+EE M+ +       LPL L+N IYD++  ++ +LM PFMKRK++FW
Sbjct: 300 VVS--LHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFW 357

Query: 338 DESILQPRKSIFPNSKFFRKLISKTXXXXXXSDSATHSQQGVAYFAATSNEFILRKLADW 397
           +E+IL PRKS+F  +KFF+K ++K+       +S      G  Y ++TS EF++RKLADW
Sbjct: 358 EETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADW 417

Query: 398 SFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLI 457
           S M+SDFK AY+TYE L +DFE+ P+YLASC EWCA+S+LMGAQ+IVT KM+KN+I+P I
Sbjct: 418 SMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAI 477

Query: 458 NRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAP 517
            RAL +YEL    A E NA                                   G S   
Sbjct: 478 ERALGAYELC---ATESNAHRKF-------------------------------GDSDDL 503

Query: 518 SQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYC 577
           S   +SYETRCM LA+ELFLSLSDTWT+TP+AI YLETIL+EC LG LSEI++WERL+ C
Sbjct: 504 SAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDC 563

Query: 578 YALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGLARR 637
           Y +R+DPR+K ++ +L+    + E                 K     +   + S GL R 
Sbjct: 564 YGMRIDPRIKHRIGNLELLQKKEEN------------MDDPKNADVFTTEDILSKGLTRN 611

Query: 638 RKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKI 691
           RK+ LF+LIA +KW E KQWR+  W L D+E  YS+L   N+++L+  +LR ++
Sbjct: 612 RKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/703 (48%), Positives = 442/703 (62%), Gaps = 61/703 (8%)

Query: 3   LSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSLYM 62
            S+  YMNL FHL+ + E +P+EI+R+I                LD+HIQ++Y +DSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRYFGDCVSDRDQAEAGP-------ELGTESGKNRNRARSNSLFQRQA--SHYLRFTRP 113
           LLR+FG CVSDRDQA              T +   R R+RSNSLFQR +  S Y+RFTRP
Sbjct: 64  LLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTRARSRSNSLFQRDSTQSQYIRFTRP 123

Query: 114 LTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISST 173
           L DL++  +  D+LFD+HSLE +L +YL LVE  T   T H LL+ S+YH FF+ AISST
Sbjct: 124 LPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKSLYHNFFSLAISST 183

Query: 174 AHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVF 233
             LSP+ESFNHP+ SL+ALDI+  Q YE+A+ LLI FKN+HNT   FP +IN  D+LPVF
Sbjct: 184 TTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDMLPVF 243

Query: 234 LLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEE 293
           LLCY  DS E+ + C+ LS  IKKQLFVES+ LP W  +      P   LHQP+MSSL+E
Sbjct: 244 LLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQ--TEPFIKLHQPVMSSLDE 301

Query: 294 TMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSK 353
            +Y +  +   TLP+ L N  YD L  L+  L+IPFM+RKI+FW+E++LQP+KSIF  SK
Sbjct: 302 MIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGSK 361

Query: 354 FFRKLISKTXXXXXXSDSA-THSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYE 412
           F +KL+S+         +  T    G  YFA++S E +LRKLADWS MLSDFK  Y+TYE
Sbjct: 362 FLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYE 421

Query: 413 LLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAK 472
           +LS D E  P+YLASCLEW A+S+LMGAQ+IVTVKM+KNDI PLI+RAL +Y+  A    
Sbjct: 422 ILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTH 481

Query: 473 EKNAQLXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLA 532
             N ++                  P+           +E  S  P     SYETRC++L+
Sbjct: 482 LSNKKIG-----------------PT-----------NESTSLEP---VLSYETRCLILS 510

Query: 533 AELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPS 592
           +ELFLSLSDTWT+TPYAI YLE+IL+E  LG  S I++WERL+ CY LRVDPR+K K+  
Sbjct: 511 SELFLSLSDTWTSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQ 570

Query: 593 LDGQS-----GQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGLARRRKSTLFRLIA 647
           +  Q        NE R                    ++ + + S GL R+RK+  FRL+A
Sbjct: 571 VQKQDNLEEPADNEHRILNSQD-------------DLNPSNIVSQGLTRKRKAAFFRLLA 617

Query: 648 TKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKK 690
            K W E  QW+Q  W L +I  +YS +   NRDDLIL +LR++
Sbjct: 618 AKMWAEQGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE 660

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/618 (48%), Positives = 391/618 (63%), Gaps = 60/618 (9%)

Query: 83  LGTESGKNRNRARSNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKY 140
           L   S   RNR+RSNSLFQR +  S ++RFTRP+ DL+    + D+LFDYH+LE+FL   
Sbjct: 148 LPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSC 207

Query: 141 LSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGY 200
           L +VE  TT D  H  LQ S+YH+FF++AISST  LSPYESFNHP+ SL+A+DI+K Q Y
Sbjct: 208 LKMVEKYTTDDIDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQNY 267

Query: 201 EEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLF 260
           E ARDLLIAFKN + T  +FP F++ NDILPVF+LCY   S E+ E    LSK IKKQLF
Sbjct: 268 ELARDLLIAFKNQNTTINNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQLF 327

Query: 261 VESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTN 320
            E + +P W +  +   +    LHQP MSSL+E +Y      T  LPL+LIN IYD+L  
Sbjct: 328 AECIRMPLWDKRYSDDITVK--LHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEI 385

Query: 321 LIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKTXXXXXXSDS-ATHSQQGV 379
           L ++LMIPFM+RKI+FW+E+ILQP+KS+F  +K FRK + +        ++      QG 
Sbjct: 386 LTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMGRPSMTNGRQENIPIKDNQGN 445

Query: 380 AYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMG 439
            YFA+TSN F+LRKLADWS M+SDFK AY+T+E L +D E  P+YLASCLEWCA+ +LMG
Sbjct: 446 EYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMG 505

Query: 440 AQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPST 499
           AQ+IVT KMIKND++PLI R+L  Y          N  L                     
Sbjct: 506 AQNIVTTKMIKNDVNPLIERSLDVY---------GNCALLL------------------- 537

Query: 500 VSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDE 559
                    + E   S  ++  +SYETRCML+ +ELFLSLSDTWT+TPYA+  LETIL E
Sbjct: 538 -------NSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSE 590

Query: 560 CTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQK 619
           C LG+ S+I++WERL+ CY LR DPRVK KL S                        ++ 
Sbjct: 591 CKLGACSQIMIWERLSDCYNLRTDPRVKHKLRS-----------------NISTSSVSEV 633

Query: 620 YDHKISQNCMASL---GLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDF 676
            + +I +  ++S+   GL R+RK++ FRL+A KKW E  QWRQ  W L DI  +Y +  F
Sbjct: 634 SEEEIKKQDVSSIVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVF 693

Query: 677 ANRDDLILEKLRKKIHEH 694
             R+ LI +KL++ + E+
Sbjct: 694 GKRESLIYQKLKRNLLEN 711

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 45/77 (58%)

Query: 1  MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
          M  ++  YMNL FHLD   E VP +IS++I                LD HI E YG+DS 
Sbjct: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61 YMLLRYFGDCVSDRDQA 77
          Y LLRYFG C+SDRDQ+
Sbjct: 61 YTLLRYFGGCISDRDQS 77

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  531 bits (1367), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 301/731 (41%), Positives = 400/731 (54%), Gaps = 126/731 (17%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           M  S+  YMNL  HL+ A E VP +I+R+I                LD+HI ESY V S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQA--SHYLRFTRPLTDLI 118
           Y+L R FG C+SDRDQ      L   S   R R RSNSLFQR A  S ++RF +PL DL+
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120

Query: 119 DVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDT----------------------PHTL 156
                +  LFD  SLE +L  YLS ++  T +D                       PH L
Sbjct: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180

Query: 157 LQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNT 216
           L++++YH FF  A+SST  +SP+E+FN PV +L+A+D+S+ Q YE  RDL+  FKN++  
Sbjct: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240

Query: 217 TPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAG 276
              FP FINVNDILP+ +LCY+     Q   C+ L + IKK LFV+S+ L  W ++    
Sbjct: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDED---P 297

Query: 277 ASPSRILHQPIMSSLEETM--YSMMK-----------ESTITLPLSLINYIYDRLTNLID 323
            SP   LH+PIMSSL+E +  YS               S   LPL++I ++Y  L  L+D
Sbjct: 298 ESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVD 357

Query: 324 ELMIPFMKRKISFWDESILQPRKSIFPNS-KFFRKLISKTXXXXXXSDSATHSQQGVAYF 382
           E++IPFM RK  +W+E+ILQPRKSIF  S  FF+K I KT      SD+         +F
Sbjct: 358 EMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQRDPSDT--------QFF 409

Query: 383 AATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQS 442
            A+S E +LRKLADWS MLSDFK AY TY+ LS D +  P YLASCLEWCA+S+L+GAQ+
Sbjct: 410 PASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQN 469

Query: 443 IVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXXXXXXXXXXXXXXXXTLPSTVSD 502
           IVTVKMIK +I PLI RA+ +Y    R + E                             
Sbjct: 470 IVTVKMIKTEITPLIERAVATYRQQGRSSYE----------------------------- 500

Query: 503 EHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDEC-T 561
                                  TRCM+L+AELFL+L DTWT+TPYAI+YLETIL +C  
Sbjct: 501 -----------------------TRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQ 537

Query: 562 LGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYD 621
           LG+ S++++WERL+ CY  R DPRV   L S +   G  +                    
Sbjct: 538 LGACSQVMIWERLSDCYQSRTDPRVASAL-STNTSPGSAQP------------------- 577

Query: 622 HKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDD 681
                N + + G  R+RK+  FRLIA KKW E  QWRQ  W L DI+ +Y+     ++  
Sbjct: 578 ----GNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKG 633

Query: 682 LILEKLRKKIH 692
           L++++L  ++ 
Sbjct: 634 LLIDRLNTEVQ 644

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  537 bits (1383), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 297/655 (45%), Positives = 410/655 (62%), Gaps = 67/655 (10%)

Query: 89  KNRNRARSNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEA 146
           + + R RSNSLFQR +  S Y+RFT+P+ DL++ R+  D LFD+ SLE  L+ YL ++E 
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 147 NTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDL 206
           NTT D PH  L+ S+YH+FF+  ++ST +L P+ESF+HP+ SLL++D++ +Q Y+ A+++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 207 LIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLL 266
           LI FKN+H+ TP+FP ++N+NDILPVFLLCY+  S EQ ++ + +S  IKKQLF ES+LL
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 267 PCWGQNINAGASPSRILHQPIMSSLEETMY----SMMKESTIT---LPLSLINYIYDRLT 319
           P W   I       + LH+P+MSS++ET+Y     + K S +T   LPLSL+ YIY+ + 
Sbjct: 361 PLWNDKIYNNDKFVK-LHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419

Query: 320 NLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKTXXXXXXSDSA------- 372
           NL   L+IPFM+RKI FWDE+ILQPRKSIF N K F+  +++       + ++       
Sbjct: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNS 478

Query: 373 ---------THSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPE 423
                    T    G  YF+A S EF LRKLADWS M+SDFK AY+TYE LS+D E   +
Sbjct: 479 ISKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538

Query: 424 YLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXXXXX 483
           Y+ASCLEW A+S+LMGAQ+IVT KM+KND+DPLI  AL+SYE         N++L     
Sbjct: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPV--PNSRLPSNNI 596

Query: 484 XXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTW 543
                         + VS       L E      + + +SYE RCMLL +ELFLSLSDTW
Sbjct: 597 NSLNSRSSISSATKAEVS-------LIEN-----NHTIRSYEIRCMLLLSELFLSLSDTW 644

Query: 544 TATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQNEKR 603
           T+TPYA++YLETIL +  LG  S+ +LWERL++CY LRVDPR+K K P++     +  K 
Sbjct: 645 TSTPYALRYLETILSDYKLGPCSQTILWERLSFCYDLRVDPRIKRK-PTI-TNINKGTKA 702

Query: 604 XXXXXXXXXXXXXTQKYDHKISQ---------------------NC---MASLGLARRRK 639
                         +KY +   Q                     +C   + S G  R+RK
Sbjct: 703 TGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRK 762

Query: 640 STLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEH 694
           +  F+LIA KKW+E KQWRQ  W LKDIE VY E+ F++R DLIL KL+ +++++
Sbjct: 763 AAFFKLIAAKKWSEQKQWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLNKY 817

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (65%)

Query: 1  MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
          MP S+  YMNL FHLD   E +PT+I+++I                LD+H+Q+SY +DSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRYFGDCVSDRDQ 76
          YMLLRYFG C+SDRDQ
Sbjct: 61 YMLLRYFGGCISDRDQ 76

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  520 bits (1340), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 294/695 (42%), Positives = 405/695 (58%), Gaps = 81/695 (11%)

Query: 3   LSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSLYM 62
           LS+ KYMNL  + D   +PVP EISRK+                L++H++E + + SLY 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 63  LLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDVRE 122
           LLRYFGD + DRDQ +   ++  +   N  R R NSLFQR +S Y+RF  PLTD+I V +
Sbjct: 62  LLRYFGDYIQDRDQLDD--KISAKLQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISVGD 119

Query: 123 SRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESF 182
           +  +  +++ LE  L ++L  +E +T +D+P  LL+HSI+HKF T   S+T  LSPY SF
Sbjct: 120 NHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKHSIFHKFITMLSSTT--LSPYHSF 175

Query: 183 NHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSR 242
           NHP+ +LLALDI++ + YE AR+LL+ FKN+ NT   FPAFIN ND+LPVF+LC+++ S 
Sbjct: 176 NHPILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSP 235

Query: 243 EQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMKES 302
           +Q+E  QSL K IKKQLFVES+ LP +          S +LH PI +SL+E +Y      
Sbjct: 236 QQWETVQSLMKVIKKQLFVESVPLPIFTN----FRDRSIVLHPPITNSLQEQLYDSSHPV 291

Query: 303 TITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKT 362
           ++ L   L+  IYD + +++++LMIPFM RKISFWDE+ILQPRKSIF ++K  ++ ISK+
Sbjct: 292 SLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKS 351

Query: 363 XXXXXXSDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRP 422
                 S +A+       +F A+SNEF+LRKLADW FMLSD+K AYS YE+L +DFE  P
Sbjct: 352 SG----SPTASMPTSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYP 407

Query: 423 EYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLXXXX 482
            Y++SC E+ ALS+LMGA SIVT KMIKNDIDPLI +                       
Sbjct: 408 LYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKY---------------------- 445

Query: 483 XXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDT 542
                                     LD  V++  S      + RCM+   ELFLSLSDT
Sbjct: 446 --------------------------LDYAVNNIISLD----QIRCMIYMTELFLSLSDT 475

Query: 543 WTATPYAIKYLETIL--DECTLGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQN 600
           WT+ P+AIKYLE IL  +   LG +   ++WER+++ Y LR+DPR+     S        
Sbjct: 476 WTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHADDDSTSDCDHDL 535

Query: 601 EKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQA 660
           E+                   HK+    + + G  R RK  +F+L+A KKW +  Q RQ 
Sbjct: 536 EEELYLNP-------------HKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQG 582

Query: 661 YWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHE 695
            W LK    VY +L FAN +  +L +L   + + E
Sbjct: 583 AWSLKRCNRVYRDLPFANAEGTLLSRLADAVVDSE 617

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  504 bits (1297), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 283/696 (40%), Positives = 405/696 (58%), Gaps = 65/696 (9%)

Query: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSL 60
           +  S+ KYMNL  + +    P+P EIS+K+                LD H+++ Y +DS+
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDV 120
            ML RYFGD + DRDQ  +  +L      +  R RS+SLFQRQAS  +RFTR L DLI +
Sbjct: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLISI 122

Query: 121 RESRDLLFDYHSLEVFLEKYLSLVEANTTSD-TPHTLLQHSIYHKFFTTAISSTAHLSPY 179
            +S D +     ++ FL +YL  +E     + TP  LL+HSIYH+FF T   S+ +LS Y
Sbjct: 123 -DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITL--SSINLSRY 179

Query: 180 ESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEE 239
            SF+HPV +LL LDI+K QGYE AR++LI FKN++NT  +FP FIN+NDILPVF+LCY+E
Sbjct: 180 HSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDE 239

Query: 240 DSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMM 299
           +SREQ+E  Q+L+K++KKQLFVES+ +  +  + N     S  LH PI  SL E +++M 
Sbjct: 240 NSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQK---STTLHSPITVSLHEQVFNMS 296

Query: 300 KESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLI 359
             ++I +P  L+ +IYD ++ +++E+MIPFM RK+ FWDE++LQPRKSIF ++KFFR+ I
Sbjct: 297 HPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFI 356

Query: 360 S--KTXXXXXXSDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKD 417
           S           +      +G   F A+S EF+LRKLADWSFMLSDFK AYS Y+LL+KD
Sbjct: 357 SPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKD 416

Query: 418 FEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQ 477
           FE  P+YLA CLE+  +S+LMGAQ+I+T K IK ++DPL+ RA++ Y    +K  EK   
Sbjct: 417 FESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQY----KKQDEK--- 469

Query: 478 LXXXXXXXXXXXXXXXXTLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFL 537
                                     HS + +                  C+L  ++L L
Sbjct: 470 --------------------------HSLRVI-----------------HCILTFSDLLL 486

Query: 538 SLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGK-LPSLDGQ 596
           SLSDTW ++P A+ YL  I     LG  + +++ ER+AY Y + +D RV    LP  D +
Sbjct: 487 SLSDTWVSSPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEE 546

Query: 597 SGQNEKRXXXXXXXXXXXXXTQ-----KYDHKISQNCMASLGLARRRKSTLFRLIATKKW 651
           +  +E                      + ++K+ QN + S GL R RK +L++L+A KKW
Sbjct: 547 NKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKW 606

Query: 652 TESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKL 687
            E  +  QA W +      Y +L  + R D +  +L
Sbjct: 607 VELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRL 642

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  417 bits (1072), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 308/461 (66%), Gaps = 21/461 (4%)

Query: 3   LSFGKYMNLAFHLDSALEPVPTEISRKIXXXXXXXXXXXXXXXXLDEHIQESYGVDSLYM 62
           LS+  YMNL  + +   +PVP EISR++                L+ H+ E +   SLYM
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 63  LLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDVRE 122
           LLRYF D V +R     G E+G+ SG+ R      S++QRQ S Y+RF RPL ++I+  E
Sbjct: 62  LLRYFADYVRER-----GEEVGSVSGQRR----PGSVYQRQTSRYVRFQRPLEEVIETVE 112

Query: 123 SRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLLQHSIYHKFFTTAISSTAHLSPYESF 182
            + +  D+  LE  L ++L  +EA TT+++P  LL+HSI+HKF T  +SSTA LSPY + 
Sbjct: 113 QQAV--DFEDLEEALGQHLRDIEARTTNESPSELLKHSIFHKFITM-LSSTA-LSPYHTV 168

Query: 183 NHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEEDSR 242
           NHP+ +LLALD+++ + Y  AR+LL+ FKN+ + +  FP++IN ND+LPVF+LC++E S 
Sbjct: 169 NHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSSKFPSYINTNDVLPVFILCFDESSS 228

Query: 243 EQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMMKES 302
           EQ+E  Q+L K IKKQLFVES+ LP +    N  + P  +LH PI +SL+E +Y      
Sbjct: 229 EQWETVQALQKAIKKQLFVESVPLPIF---TNYESDPV-VLHPPITNSLQEQVYDGSHPP 284

Query: 303 TITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKT 362
            + L   L++ IY+ +  ++++LMIPFM RKISFWDE+ILQPRKSIF  +KF ++ ++KT
Sbjct: 285 LLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDETILQPRKSIFHGNKFLKRFMNKT 344

Query: 363 XXXXXXSDSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRP 422
                 S + T S     YF A+SNEF+LRKLADWSFMLSD+K AYS Y +L +DFE  P
Sbjct: 345 NS----SAAGTLSTSSDGYFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYP 400

Query: 423 EYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKS 463
           +YL+SC E+ ALS+LMGA SIVT KMIKNDIDPLI + + S
Sbjct: 401 QYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMDS 441

 Score =  124 bits (310), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 94/177 (53%), Gaps = 14/177 (7%)

Query: 527 RCMLLAAELFLSLSDTWTATPYAIKYLETIL--DECTLGSLSEIVLWERLAYCYALRVDP 584
           RC++  AELFLSLSDTWT+ P+AIKYLE IL  ++  LG LS  +LWER++Y Y LR+DP
Sbjct: 453 RCLVYMAELFLSLSDTWTSAPFAIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDP 512

Query: 585 RVKGKLPSLDGQSGQNEKRXXXXXXXXXXXXXTQKYDHKISQNCMASLGLARRRKSTLFR 644
           R+             +++                   +K+    + SLGL R RK  +FR
Sbjct: 513 RIH-----------TDDEYLSDNFMELTTEDDFCMNPNKLHHWRIHSLGLTRHRKEAVFR 561

Query: 645 LIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIHEHEPLPQKL 701
           L+A KKW E    RQ  W LK    VY  L FAN D  +L +L   +  HE   Q L
Sbjct: 562 LLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADGTLLSRLVDMV-VHEETVQSL 617

>KNAG0C00610 Chr3 (103834..105855) [2022 bp, 673 aa] {ON} Anc_1.55
           YDR505C
          Length = 673

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 314 IYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLISKT 362
           + D   NL   LM+ F+K+KI F  +S++  R+  +PN KF + L+  T
Sbjct: 420 VVDPSINLNLALMVNFLKKKIHF--DSLITNRRQHYPNEKFIKALMDST 466

>KLTH0F01716g Chr6 (133903..136104) [2202 bp, 733 aa] {ON} similar
           to Saccharomyces cerevisiae YLR177W Hypothetical ORF and
           weakly similar to YDR505C uniprot|P50896 Saccharomyces
           cerevisiae YDR505C PSP1 Asn and gln rich protein of
           unknown function; high-copy suppressor of POL1 (DNA
           polymerase alpha) and partial suppressor of CDC2
           (polymerase delta) and CDC6 (pre-RC loading factor)
           mutations; overexpression results in growth inhibition
          Length = 733

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 325 LMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLI 359
           L I F+K+KI F  +S++  R   FPNS+F R L+
Sbjct: 501 LFINFLKKKIHF--DSLITNRDQHFPNSQFIRALV 533

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,302,578
Number of extensions: 2779149
Number of successful extensions: 8223
Number of sequences better than 10.0: 29
Number of HSP's gapped: 8307
Number of HSP's successfully gapped: 53
Length of query: 708
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 591
Effective length of database: 40,065,477
Effective search space: 23678696907
Effective search space used: 23678696907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)