Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13838g8.256ON1214121458560.0
Kwal_56.235898.256ON1213121728120.0
SAKL0H17204g8.256ON1211122321100.0
ZYRO0C01804g8.256ON1209122017590.0
Skud_12.1528.256ON1220123017190.0
Suva_10.1688.256ON1220123516970.0
Smik_12.1438.256ON1220122916810.0
NCAS0B049808.256ON1204121916480.0
KLLA0F18975g8.256ON1200123416420.0
YLR084C (RAX2)8.256ON1220123216350.0
TPHA0B032508.256ON1215122816270.0
NDAI0B023808.256ON1219123116260.0
TDEL0F038308.256ON1195120915940.0
Ecym_43158.256ON1212122415810.0
Kpol_392.108.256ON1226125215520.0
AGR095W8.256ON1201123515060.0
KAFR0B026908.256ON1210123314600.0
KNAG0G020008.256ON1202121413781e-169
TBLA0E043908.256ON1278116613731e-167
CAGL0L12144g8.256ON1156120412781e-155
Smik_4.5405.301ON1077100801.2
NCAS0F030505.383ON1456176737.4
TBLA0I029904.255ON54077727.8
Kpol_1033.248.295ON4915134738.1
CAGL0G09845g7.534ON50041728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13838g
         (1214 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...  2260   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...  1087   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   817   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   682   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   666   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   658   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   652   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   639   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   637   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   634   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   631   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   630   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   618   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   613   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   602   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   584   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   566   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   535   e-169
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   533   e-167
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   496   e-155
Smik_4.540 Chr4 (971274..974507) [3234 bp, 1077 aa] {ON} YDR291W...    35   1.2  
NCAS0F03050 Chr6 (607255..611625) [4371 bp, 1456 aa] {ON} Anc_5....    33   7.4  
TBLA0I02990 Chr9 (710633..712255) [1623 bp, 540 aa] {ON} Anc_4.2...    32   7.8  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    33   8.1  
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    32   8.3  

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score = 2260 bits (5856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1127/1214 (92%), Positives = 1127/1214 (92%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN
Sbjct: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60

Query: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSG 120
            ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIY            HIVPFKDDAFILSG
Sbjct: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSG 120

Query: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180
            AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS
Sbjct: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180

Query: 181  LLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXX 240
            LLVWDSIKDGVEVLPFGGFGKNSTV            FAGNFSAVDNTQQL         
Sbjct: 181  LLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTS 240

Query: 241  XXXXPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPS 300
                PELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPS
Sbjct: 241  NTSVPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPS 300

Query: 301  KLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISS 360
            KLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISS
Sbjct: 301  KLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISS 360

Query: 361  KSYPGDQVQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESA 420
            KSYPGDQVQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESA
Sbjct: 361  KSYPGDQVQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESA 420

Query: 421  YSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSETNPFVIFYPSI 480
            YSVYANNTLNAPNCAQG             WDSGSSEGNYLSTSVQDSETNPFVIFYPSI
Sbjct: 421  YSVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSETNPFVIFYPSI 480

Query: 481  IYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSG 540
            IYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSG
Sbjct: 481  IYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSG 540

Query: 541  FLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSN 600
            FLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSN
Sbjct: 541  FLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSN 600

Query: 601  TSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIE 660
            TSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIE
Sbjct: 601  TSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIE 660

Query: 661  EYTFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTL 720
            EYTFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTL
Sbjct: 661  EYTFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTL 720

Query: 721  GQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGS 780
            GQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGS
Sbjct: 721  GQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGS 780

Query: 781  FFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQ 840
            FFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQ
Sbjct: 781  FFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQ 840

Query: 841  LSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIF 900
            LSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIF
Sbjct: 841  LSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIF 900

Query: 901  FARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAG 960
            FARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAG
Sbjct: 901  FARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAG 960

Query: 961  SFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGK 1020
            SFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGK
Sbjct: 961  SFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGK 1020

Query: 1021 WQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSG 1080
            WQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSG
Sbjct: 1021 WQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSG 1080

Query: 1081 EWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXXXXXXXXXXXX 1140
            EWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTF                  
Sbjct: 1081 EWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSS 1140

Query: 1141 XXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKPRTDENE 1200
               LQRKKKKIDRGFIVLIS                IFSYFFGDSGDGYQLSKPRTDENE
Sbjct: 1141 PSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENE 1200

Query: 1201 MIDTVPPEKLMRFI 1214
            MIDTVPPEKLMRFI
Sbjct: 1201 MIDTVPPEKLMRFI 1214

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/1217 (47%), Positives = 798/1217 (65%), Gaps = 7/1217 (0%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            M   + LATS L +AK CSG+HL+ +ES LGV+ +++P+LDLS S N E+QLLGNF+++N
Sbjct: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60

Query: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSG 120
              +Y+GQ NFTG        +LIY+SN T LE+             H++P +DD+FILSG
Sbjct: 61   YYRYTGQDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSG 120

Query: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180
             G+ISG  L  Q++FNLS L +  IF Q L+ VN IT NG+K +FGGSF+++  +Q  H 
Sbjct: 121  TGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHG 180

Query: 181  LLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXX 240
            L+VWD +K+ VE LPFGG GK+S V            FAGNFS +D    L         
Sbjct: 181  LIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINST 240

Query: 241  XXXXPELGHQISLQSAAWVSDGTLDKSAIKCPSTEST-GWLKTGSTQGQFELYMPEETRP 299
                PEL H+I L++A W SDG+L K  + CPS  +T  WL TG+T GQFEL +    RP
Sbjct: 241  SDSAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWLGTGTT-GQFELSIAHTIRP 299

Query: 300  SKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDIS 359
            SKLR+ NAR  DE+VSLFR++TTPSNGIMNLTYLDP++GEL +CDAWCPLLS+QNLT   
Sbjct: 300  SKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTAAK 359

Query: 360  SKSYPGDQVQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYES 419
            SK+   DQV++  N+TT+QWSES+QDFAFVN+VPV+ +TF+ALDSYGSSVG+ G ELYE 
Sbjct: 360  SKAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYED 419

Query: 420  AYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSETNPFVIFYPS 479
             +SVYAN++ N P+C+               WD GSS+ +Y+ T V++S+  P V FYP 
Sbjct: 420  DFSVYANDSFNVPDCSS-TSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPSVTFYPQ 478

Query: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539
            I+Y G+YTI+VLTPGCL D SCQ+R ++NA++ D  N TLL SI IYQNNDYEK+D LYS
Sbjct: 479  IVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLYS 538

Query: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENN-TSGFINGLLHYST 598
            G+L++EVKV LE++GAI +    P+MVA +I VN ++FD SVF +   +G +NGLLHYS 
Sbjct: 539  GYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHYSL 598

Query: 599  SNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLS 658
            SN+SS+L    S ++TDLA YSVS   K+SN F + F++ ++LF + G++++L++     
Sbjct: 599  SNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEIDQQFD 658

Query: 659  IEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNL 718
            +   T E +G ++S +  +S GL ++GTF+GS++  A+ +NG+FF++   +S V TF+N 
Sbjct: 659  VRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTK-GAKFYNGSFFDIPLSHSNVTTFTNF 717

Query: 719  TLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLN 778
            TL   E++       +N TT     ++SK+TL   SAG N   +T+F G + +N+YT+LN
Sbjct: 718  TLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGSLTRNEYTDLN 777

Query: 779  GSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGST 838
            GSFFIS+NS+  S+      G++ YDA ++DNSTT YA+Y+P +T+ S+GVS+  D    
Sbjct: 778  GSFFISSNSQSSSR-LRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSYGVSIYKDMAKE 836

Query: 839  VQLS-AWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNS 897
              LS  W+  VG+M  SKN SLLA+G K++    QLL+TN ++GE  A+++W + +S+NS
Sbjct: 837  RDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLTTGEDTATFEWKTNVSINS 896

Query: 898  IIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLL 957
            +IFF +N SVLVGG F  + + CSGLCLF+Y+ K WSPF +N I G I+ M+IFN S+L+
Sbjct: 897  LIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSIHSMKIFNKSSLV 956

Query: 958  IAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLE 1017
            + G F +N+T  V+LAS+ L D S  ILH+G  T+  F+ +DG  +N+VA S   L +L 
Sbjct: 957  LGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNLVAVSANDLFRLT 1016

Query: 1018 SGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFY 1077
            +  W+ IS  F ++S F GL  FP++   + +KR+     LLITG L H  +G I+AA Y
Sbjct: 1017 NNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSLLITGDLLHKTYGKISAALY 1076

Query: 1078 DSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXXXXXXXXX 1137
            D  +W P+ S+  ATS+  L  S ++ N+D+S   +Y+G LQ +                
Sbjct: 1077 DFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSSRGGNSSSVPSGTSSPT 1136

Query: 1138 XXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKPRTD 1197
                  L  KK KI RGF+VLI                   ++FFG S D YQ  +PR D
Sbjct: 1137 SSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALTFFFGKSSDKYQSLEPRAD 1196

Query: 1198 ENEMIDTVPPEKLMRFI 1214
            E+EMIDTVPPEKLMRFI
Sbjct: 1197 ESEMIDTVPPEKLMRFI 1213

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  817 bits (2110), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1223 (37%), Positives = 706/1223 (57%), Gaps = 21/1223 (1%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            M A   + T+  AL +  +GS L +L+ KL ++   IP +DLS S N+E+ LLG+F+D+ 
Sbjct: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60

Query: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSG 120
              +Y+GQ+NFTG ++   E  LIYYSN TF+++             HI+PF DD+FILSG
Sbjct: 61   FYRYTGQENFTGSIT-ETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSG 119

Query: 121  AGSI-SGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIH 179
             G++  GH L +QLL+NLSSLE+  IF Q ++ VN I A+ + V+FGG F+Y + N T H
Sbjct: 120  TGTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGH 179

Query: 180  SLLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVD-NTQQLXXXXXXX 238
            S+++W+S  + +++LPF GFG +S V            FAG F+ +D NT          
Sbjct: 180  SVVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNS 239

Query: 239  XXXXXXPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETR 298
                   E    I L+ A W S G+L+ S++ CPS +S GW + G+  G F + +  + R
Sbjct: 240  SKNATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLR 299

Query: 299  PSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI 358
            PSKLR++NA DSD QVSLFRI+T+P+NGIMNLTYLDP TGEL+ CDAWCPLLS++ L   
Sbjct: 300  PSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQA 359

Query: 359  SSK-SYPGDQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIEL 416
             +  +   D V Y   N T ++W+ ++Q+FAFVN V V  LTF+ALDSYGSSVGL G E+
Sbjct: 360  EANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEM 419

Query: 417  YESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSETNPFVIF 476
            Y++ Y  +AN+TLN PNC                W  GS + +Y+ ++   +   P V F
Sbjct: 420  YQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNF 479

Query: 477  YPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDT 536
            YP+I Y G YT++++TPGC  D SC +RGI+N T+ D  N+T+L +  IYQNN+ EK+D 
Sbjct: 480  YPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDL 539

Query: 537  LYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNT-SGFINGLLH 595
            LYSG+L+S  K+TL+F  +IN+ +   +MVA ++ V I+  DQS     T +  +NGL  
Sbjct: 540  LYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQ 599

Query: 596  YSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLAN 655
            Y  SN ++  ++      T +  YS+  +P +S +FA  + + L++      +A L+L +
Sbjct: 600  YQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLND 659

Query: 656  NLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEP-AARGFNGTFFNLTEFNSTVRT 714
            +L+I        G     I+ YS GL+ +G FN SS+  +   +NGTF +     + +  
Sbjct: 660  DLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITR 719

Query: 715  FSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDY 774
            F+N+T+  +E+L+F+   I N ++ E I +TS   L + SAG N   D +  G V Q  Y
Sbjct: 720  FNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQY 779

Query: 775  TNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMND 834
            T LNG+ +I+  +   +    +  GK  Y A ++++S+TAYAY + +++++   ++  N 
Sbjct: 780  TELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARGNR 839

Query: 835  SGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTD-SQLLVTNSSSGESLASYKWDSEI 893
            S       +WS  V  M  +K+DSLLA+G     T+ + L + N S+ + +      ++ 
Sbjct: 840  SEDLP--VSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKS 897

Query: 894  SLNSIIFFARNNSVLVGGSFRV--NNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIF 951
            S+N+I+ F +N+S+LVGG F +  ++T CSGLCL+NY   KWS F NNSI G I  ++ F
Sbjct: 898  SVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFF 957

Query: 952  NNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDT 1011
            N + LLI+G+       G++LA + +  +   IL  G+  +  FV+ D +++ ++  SD 
Sbjct: 958  NGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDN 1017

Query: 1012 SLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGS 1071
             +    +G+W+ +++    +S + G  + PLK T+   KRD S++ LL+ G L+H+ +GS
Sbjct: 1018 EISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTS--SKRDVSNRALLVNGDLKHSTYGS 1075

Query: 1072 INAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXXX 1131
            ++A  YD  +W P+   +   +      S++F+N+DLS     +  LQG+          
Sbjct: 1076 VSAMLYDFEDWMPYFIVDGENAG---RASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSN 1132

Query: 1132 XXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQL 1191
                         +    KIDRGF+VLI                 I +YFF  +   Y+ 
Sbjct: 1133 MPSETSDKN----ESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEP 1188

Query: 1192 SKPRTDENEMIDTVPPEKLMRFI 1214
             KPR DE +MIDTVPPEKLM+F+
Sbjct: 1189 LKPRVDEGDMIDTVPPEKLMKFV 1211

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1220 (35%), Positives = 653/1220 (53%), Gaps = 41/1220 (3%)

Query: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73
            L    +GS L  L+  L      +P LDL+ S+N  ++LLG+F+D+   KY+GQ+NFT  
Sbjct: 12   LLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSP 71

Query: 74   V-SGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLSRQ 132
            + S    + LIYYSN+TFL++              IVP  +D+FILSG+G I G+ L RQ
Sbjct: 72   LNSSTDSHGLIYYSNDTFLQL---ANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQ 128

Query: 133  LLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVE 192
            L +NL+ L F+ IF + L +VN+I  +   V+FGG+F +   +QT HS+++W+S K+   
Sbjct: 129  LHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTS 188

Query: 193  VLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXXXXXXP-----EL 247
            +LPF GFG+NSTV            FAGNF  +D+ + L                   EL
Sbjct: 189  LLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVEL 248

Query: 248  GHQISLQSAAWVSDGT-LDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFN 306
            G  I LQ+A W S  +  D     CP  E   WL++G T G     +P+ET P K+R++N
Sbjct: 249  GLAIPLQNANWTSSSSQFDADDFICPDPERESWLQSG-TSGSLACSLPQETTPYKIRIYN 307

Query: 307  ARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGD 366
            +   D +VSLFRI+  P+ GI+NL+Y+DP  GEL  CDA+CPL + Q L + SS S   +
Sbjct: 308  SPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVE 367

Query: 367  QVQYFE--NRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVY 424
             +  F   N T ++W   FQ+FAFVNNVP+S + F+AL SYGS+VGL+  + ++S  S+Y
Sbjct: 368  NMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIY 427

Query: 425  ANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTS-VQDSETNPFVIFYPSIIYP 483
            ANN+LN P C +              W  G +   YLSTS V+D    P V F+P I YP
Sbjct: 428  ANNSLNQPACGK-MQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYP 486

Query: 484  GVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLD 543
            G Y+I + TPGCL D +C  R I+N T+ D  +N  L S  IY+NN+  K+D L+ G L 
Sbjct: 487  GNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLK 546

Query: 544  SEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGF-INGLLHYSTSNTS 602
            S  KVTLE+   I       V+VA  I +  + FD   FE +     +NG+  Y  SN +
Sbjct: 547  SSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDH--FEKHKKDITLNGIFQYQISNFT 604

Query: 603  SFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDD-LVLFTTDGEMARLKLANNLSIEE 661
              +++  S   T L  + +S    +S++FA+++E+D L+L  +  + A +KL  N S++ 
Sbjct: 605  KNITK-ESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLDKNWSVDS 663

Query: 662  YTFETIGKDISTISEYSGGLIIVGTFNGSS-EPAARGFNGTFFNLTEFNSTVRTFSNLTL 720
                 +   +  I  YS GLI+ G +N S  +P A  FNG+F +  + N +V  F+N+ L
Sbjct: 664  SKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFTNIDL 723

Query: 721  GQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGS 780
              TE+L+FD     N ++   + +T++ +L V SAG+N   D +F G V  NDY NL G 
Sbjct: 724  KGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYENLQGP 783

Query: 781  FFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQ 840
              +  N   VS N        PY  A+++++ TAYAY    + S+S  V    D G    
Sbjct: 784  VSLFQNGSAVSSNI--KDNINPYMGAYLNDTLTAYAY---KDGSDSRIVFSNGDEGPW-- 836

Query: 841  LSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIF 900
               W+  +  M     D+LLA+G     +  QL V N ++ E LA+   D    +NS+I 
Sbjct: 837  --RWTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMIL 894

Query: 901  FARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAG 960
            F +N+++L+GG+F  ++  C+GLCL+NY++K+WS F N+SI G + ++++ N+S LLIAG
Sbjct: 895  FGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAG 954

Query: 961  SFRLNETDGVSLASICLKDSSSEILHEG-NITLNGFVSMDGSSNNVVAFSDTSLLQLESG 1019
            S R+N T  V+L S+ +     + L  G    L  FV    S + +V ++DTSL+  ++ 
Sbjct: 955  SLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV---SEDRLVVWNDTSLMAYDNT 1011

Query: 1020 KWQQIST-NFTENSKFKGLDVFPLKDTTRKQKRDSSSK---VLLITGSLQHAKFGSINAA 1075
             W+ IST N T  +K + +    L+ +  K+   SS+     LL+ G+    +  S  A+
Sbjct: 1012 SWRHISTSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGN-DKTQGDSYQAS 1070

Query: 1076 FYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQG-TFXXXXXXXXXXXX 1134
             YD   WTP   +N  + +S+    ++F+N+D+SDF   +  L   T             
Sbjct: 1071 IYDYYSWTPLFIANSKSENSN-SGPNIFMNQDVSDFFISEQMLPNPTNHTSSRSSSSSSS 1129

Query: 1135 XXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKP 1194
                       R   K+DRG++VLI                 + +Y FG+   GY+   P
Sbjct: 1130 AVTSNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSP 1189

Query: 1195 RTDENEMIDTVPPEKLMRFI 1214
              +  +  +T PP K  +F+
Sbjct: 1190 PAEGTKAAETAPPAKSSKFL 1209

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1230 (34%), Positives = 660/1230 (53%), Gaps = 52/1230 (4%)

Query: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73
            LA+    S L  ++S L +E   +PNL++S+  +N VQ+LG    +++ +Y+GQ+NFT E
Sbjct: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKE 73

Query: 74   VS-GNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLSRQ 132
            +S G     L+YYSN T++++              I PF  D+FILSG+G+I+   +  Q
Sbjct: 74   ISPGTNSRGLVYYSNNTYIQV---EDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQ 130

Query: 133  LLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVE 192
            +L+NLS+L    IF Q L  V ++  NG  V+FGG+F Y   + T HS L+WDSI +  +
Sbjct: 131  ILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQ 190

Query: 193  VLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQL------XXXXXXXXXXXXXPE 246
            +LPFGGFG+NS V            FAG F  +D++  L                    E
Sbjct: 191  LLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNSTSLLNATKLE 250

Query: 247  LGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRV 304
            LG +I L+ A W   G  T + +++ CP+     W+   +T G     +P E  P+K+R+
Sbjct: 251  LGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYP-ATSGTLVCKLPYEVSPTKVRL 309

Query: 305  FNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SY 363
            +N++DSD ++S+F+I+T PSN IMNLTYLDP +G+L +CD +CPL S   L   S   S 
Sbjct: 310  YNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSS 369

Query: 364  PGDQVQYFENRTT-LQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYS 422
            P D + + +N  T ++WS  FQDFAF N +PV+ L F A++SYG SVGL+G+ELY+  +S
Sbjct: 370  PMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFS 429

Query: 423  VYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSV---QDSETNPFVIFYPS 479
             YANN+LN   C+               W +G    +Y++T     QD E  P V FYP+
Sbjct: 430  TYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQD-EPTPRVNFYPN 488

Query: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539
            I++PG Y I+  TPGC++D +C +RGI+N T+ + QN T++ +  IYQNND  K+D +YS
Sbjct: 489  IVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYS 548

Query: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTSGFI--NGLL 594
            G+LD   ++ LE+   I++     V+VA +   I V ++ F       NT  +I  NG+L
Sbjct: 549  GYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKEYIPLNGVL 608

Query: 595  HYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLA 654
             Y  SN +S  S       T L  ++V   P +S++FA+   D L+L  T+  ++ + L 
Sbjct: 609  QYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGLN 668

Query: 655  NNLSIEEYTFETIGKDISTISEYSGGLIIVG-TFNGSSEPAARGFNGTFFNLTEFNSTVR 713
            +NL +     + I  D+  +++ S GL+I G   + +++ +   FNG+F N+  ++ TV 
Sbjct: 669  DNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVFNYSRTVN 728

Query: 714  TFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQND 773
            +  N++L   ++++FD + I+N ++  +I +++  +L + SAG N  +D LF G V +  
Sbjct: 729  SAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRMQ 788

Query: 774  YTNLNGSF-FISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVM 832
            +  LNGS  F+   SE+  Q        +PY AA+++ STTAYAY    N  N    S  
Sbjct: 789  FGGLNGSARFL---SEDKVQALNLDNAVVPYLAAYLNESTTAYAY--ETNLLNKIYFSNN 843

Query: 833  NDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSE 892
             D         WS  +  M  + N SLL + G +  T ++L + N  +   +A+    S 
Sbjct: 844  VDPSWN-----WSTSITRMLYANNQSLLTV-GSESSTTAELSIFNLKNFTMIANETMGSN 897

Query: 893  ISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFN 952
              +N+++ F +N+S+LVGG+F+++   CSGLCL+NY+ K WS F NN+  G I ++    
Sbjct: 898  AKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSA 957

Query: 953  NSNLLIAGSFRLNETDGVSLASICLKDSSSEIL---HEGNITLNGFVSMDGSSNNVVAFS 1009
             S L+I+G F   E   V LAS  L +S+   L    EG I  N FV  + S   +VA++
Sbjct: 958  ASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKI--NSFVVTEES---IVAWN 1012

Query: 1010 DTSLLQLESGKWQQISTNFTENS----KFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQ 1065
            DTSLL     +W   S    ++S         +  P     R      +  +LL++G+  
Sbjct: 1013 DTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFS 1072

Query: 1066 HAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXX 1125
               +G++    +D   W+P+  S  + +S+   T  +F+NRD+S   + +  L       
Sbjct: 1073 IPDYGNLQGLLFDFETWSPYFVSESSNTSNRNPT--IFINRDVSTEFNSQIPLSNLNVTE 1130

Query: 1126 XXXXXXXXXXXXXXXXXXLQRK-KKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGD 1184
                              L+ K KK+IDRGF+VLI                 I +Y F D
Sbjct: 1131 TGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKD 1190

Query: 1185 SGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
                Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1191 PEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1235 (33%), Positives = 661/1235 (53%), Gaps = 50/1235 (4%)

Query: 7    LATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSG 66
            LA  +L L      S L ++++ L +E   +P+L++S+  +N +Q+LG    ++  +Y+G
Sbjct: 9    LALPLLTLGS--KASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTG 66

Query: 67   QKNFTGEV-SGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSIS 125
            Q+NFT E+ S      L+YYSN T++ +              I PF  D+FILSG+GSI+
Sbjct: 67   QQNFTKEIGSETNSRGLVYYSNNTYILL---EEADEDTRIDKITPFGADSFILSGSGSIN 123

Query: 126  GHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWD 185
            G  L  Q+L+NLS+L    IF Q L  V  +  N   V+FGG+F Y   + T H  LVWD
Sbjct: 124  GVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWD 183

Query: 186  SIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXXX---- 241
            S  +  ++LPFGGFG++S V            FAG F  +D++  L              
Sbjct: 184  STSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTL 243

Query: 242  -XXXPELGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETR 298
                 ELG +I L+ A+W S G  T + S + CP T    WL  G T G     +P E  
Sbjct: 244  NATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPG-TSGSLVCTLPYEVA 302

Query: 299  PSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI 358
            P+K+R++N+ +SD  +SLF+I+T PS  IMNLTYLDP +GEL SCD +CPL S   L   
Sbjct: 303  PTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSA 362

Query: 359  SSK-SYPGDQVQYFENRTT-LQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIEL 416
            S   S   D + + +N  T ++WS  FQDFAF N + V+ L F AL+SYG+ VGL+G+EL
Sbjct: 363  SQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLEL 422

Query: 417  YESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSETN--PFV 474
            Y+  +S YANN+LN   C+               W  G +  +Y++     ++T   P V
Sbjct: 423  YQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTV 482

Query: 475  IFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKF 534
             FYPSII+PG YTI+  TPGC++D++C +RGI+N T+ + QNNT++++  IYQNN+  K+
Sbjct: 483  TFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKY 542

Query: 535  DTLYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGF----- 589
            D +YSG+LD   ++ +++   I +     +MVA ++ +  +  D     + T+       
Sbjct: 543  DKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTP 602

Query: 590  INGLLHYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMA 649
            +NG+L Y  SN ++  S     + T L  +SV   PK+S++FA++++  L+L   D  ++
Sbjct: 603  LNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHIS 662

Query: 650  RLKLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGS-SEPAARGFNGTFFNLTEF 708
             +   +NL +     +TI  D+  +++ + GL+I G    S ++     FNG+F +++ +
Sbjct: 663  VIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNY 722

Query: 709  NSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGY 768
            +  V    N+TL   ++++F+ + I N ++  +I +++  +L + SAG N  +D LF G 
Sbjct: 723  SKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGA 782

Query: 769  VLQNDYTNLNGS--FFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNS 826
            V Q  +++L+GS  F   +  E ++ N     G +PY  A+++ ST AYAY      +NS
Sbjct: 783  VSQMQFSDLSGSARFLNESTVEALNLN----KGIVPYLGAYLNESTIAYAY-----KTNS 833

Query: 827  FGVSVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLAS 886
              +S +  S +      WS  +  M  + N +LL I G +  T ++L + N  +  ++A+
Sbjct: 834  --LSKIYFSNNVSPSWNWSNNITKMVYANNQTLLVI-GSESSTTAELSILNLRNFTTIAN 890

Query: 887  YKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVIN 946
                S   +N+ + F +N+S+LVGG F+++   C+GLC++NY+ K WS F NN+I G I 
Sbjct: 891  ETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEIT 950

Query: 947  RMEIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGN-ITLNGFVSMDGSSNNV 1005
            ++   N S L+I+G F   +   + L S  L +S+   L  G+   LN F   + S   +
Sbjct: 951  QLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEES---I 1007

Query: 1006 VAFSDTSLLQLESGKWQQIST--NFTENSKFKGLDVFPLKDTTRKQKRDSSSK--VLLIT 1061
            VA++DTSLL  +  KW   S   N +  S    +D        RK+    + K  +LL+ 
Sbjct: 1008 VAWNDTSLLIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLN 1067

Query: 1062 GSLQHAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGT 1121
            G+    ++G++    +DS  WTP+ +S    +SS   T  +F+NRD+S   + +  L  +
Sbjct: 1068 GNFSIPQYGNLQGLLFDSQNWTPYFTSETLEASSYNPT--IFINRDVSADFNSQIPLSNS 1125

Query: 1122 FXXXXXXXXXXXXXXXXXXXXXLQR--KKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFS 1179
                                    +  KKK +DRGF+VLI                 I +
Sbjct: 1126 NMTVTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILA 1185

Query: 1180 YFFGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
            Y F D    Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1186 YVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1229 (33%), Positives = 664/1229 (54%), Gaps = 46/1229 (3%)

Query: 12   LALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT 71
            L LA+    S L  ++S L +E   +PNL++S++ +N VQ+LG    I+  KY+GQ+NFT
Sbjct: 12   LFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFT 71

Query: 72   GEVS-GNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLS 130
              +S G   + L+YYSN T++++              I PF DD+FILSG+G+I+   + 
Sbjct: 72   KGISPGTNSHGLVYYSNNTYIQL---EDASDDTRIDKITPFGDDSFILSGSGTINNISVG 128

Query: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190
             Q+L+NLS+L    IF Q L  V T+  N   V+FGG+F Y   +   HS LVWD++ D 
Sbjct: 129  NQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDT 188

Query: 191  VEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXX-----XXXXXXXXXP 245
             ++LPFGGFG+NS V            FAG F  +D++  L                   
Sbjct: 189  AQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNSTFSLNATKL 248

Query: 246  ELGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLR 303
            ELG +ISL+ A+W S G  TL  +++ CP+     WL   +T G     +P E  P+K+R
Sbjct: 249  ELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYP-ATSGSLVCNLPYEVSPTKIR 307

Query: 304  VFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDIS-SKS 362
            ++N++D+  +++LF+I+T PS+ IMNLTYLDP +GEL +CD +CPL S   L   S + S
Sbjct: 308  LYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNAS 367

Query: 363  YPGDQVQYFE-NRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAY 421
               D + + + N T ++WS  FQDFAF N +PV+ L  IAL+SYG S+GL+G+ELY++ +
Sbjct: 368  SSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTF 427

Query: 422  SVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSV--QDSETNPFVIFYPS 479
            S YANN+LN   C+               W +G +  +Y++T+     +E  P V FYP+
Sbjct: 428  STYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIPRVKFYPN 487

Query: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539
            II+ G YTI+  TPGC++D++C +RGI+N T+ + QNNT++ +  IYQNND  K+D ++S
Sbjct: 488  IIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFS 547

Query: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTS--GFINGLL 594
            G+LD   ++ LE+   I S     V+VA +   I V+++ F+     NN      +NG+ 
Sbjct: 548  GYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIF 607

Query: 595  HYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLA 654
             Y  SN +   S       T L  + V+  PK++++   ++ D L++      ++ + L 
Sbjct: 608  QYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLN 667

Query: 655  NNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGS-SEPAARGFNGTFFNLTEFNSTVR 713
             N  I+     TI  D+  I++   GL+I G    S ++     FN +F  +  ++  V 
Sbjct: 668  ENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVN 727

Query: 714  TFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQND 773
            + +N+++   E+ +FD N I+N ++  +I +++  +L + +AG N   D LF G V   +
Sbjct: 728  SATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFSGTVSHME 787

Query: 774  YTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMN 833
            ++NLNGS   S  +E+  Q      G +PY  A+++ S +AYA Y  D  +  +  + +N
Sbjct: 788  FSNLNGS--ASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYA-YETDALNKIYFSNKVN 844

Query: 834  DSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEI 893
             S +      WS  +  M  + N ++L +  +   T + L + N  +  ++A+    S  
Sbjct: 845  PSWN------WSNTITRMLYANNQTMLVVSSESSST-ADLTIFNLRNMTTIANETLGSNA 897

Query: 894  SLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNN 953
             +++++ F +N+S+LVGG F++    CSGLCL+NY+ K WS F NN+I G + ++ + N+
Sbjct: 898  KVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANS 957

Query: 954  SNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNI-TLNGFVSMDGSSNNVVAFSDTS 1012
            S L+I+G F   E   + L S  L + +   L  G+   LN FV  D   N++VA++DTS
Sbjct: 958  SELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTD---NSLVAWNDTS 1014

Query: 1013 LLQLESGKWQQISTNFTENSKFKGLDVFPLK---DTTRKQKRDSS--SKVLLITGSLQHA 1067
            L    + KW  I++  +++S    +         DT  K+  +++    +LL+ G+    
Sbjct: 1015 LFIYGNQKW-NITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMP 1073

Query: 1068 KFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQ--GTFXXX 1125
            ++G++ +  +D   WTP+  S  + SS+   T   F+NRD+S   + +  L         
Sbjct: 1074 QYGNLQSLLFDFQAWTPYFISEISNSSNYNPT--FFINRDVSTEFNSQITLPNLNITVTN 1131

Query: 1126 XXXXXXXXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDS 1185
                               + +KKKIDRGF+VLI                 I +Y F D 
Sbjct: 1132 PQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDP 1191

Query: 1186 GDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
               Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1192 EGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1219 (34%), Positives = 662/1219 (54%), Gaps = 40/1219 (3%)

Query: 12   LALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT 71
            L L      S L +L+  L +   +IPNL+L+ + +N  +LLG    ++  +Y+GQ+NFT
Sbjct: 10   LLLIPQIYASQLSSLQENLNITHINIPNLNLT-TDDNSFELLGGIDSLSFYRYTGQQNFT 68

Query: 72   -GEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLS 130
             G +  +  N L YYSN TF+++Y             I+PF  D+FILSG GS+ G+ LS
Sbjct: 69   SGILPNSNSNGLTYYSNNTFIQLYEPSLDSRIE---RIIPFGSDSFILSGKGSLGGYSLS 125

Query: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190
             QLLFNLSS   ++IF Q L  VN+I  +G  V FGG+F    ++   HS+ +W+   + 
Sbjct: 126  NQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANS 185

Query: 191  VEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXXXXXXPELGHQ 250
              +LPF GFG+NS +            FAG F  +DN+  L               LG  
Sbjct: 186  TSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMRNISDI-NLGQL 244

Query: 251  ISLQSAAWVSDGT-LDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARD 309
            I L +A W S G+  D+    CP      W + G T G     +P +  P+K+R++N+ D
Sbjct: 245  IPLSAATWSSTGSFFDEETFVCPDPTIEAWFQNG-TSGTLNCNLPFDVAPTKIRIYNSPD 303

Query: 310  SDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-SYPGDQV 368
             D ++SLFRI + PS  IMNLTY+DP  G+L  CDA+CPL + Q L   S   +   + +
Sbjct: 304  PDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMI 363

Query: 369  QYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANN 427
            +   +N + ++WS+ FQ+FAFVN +  S L F+AL+SYG++VGL+  ++Y+ AY+++ANN
Sbjct: 364  ELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANN 423

Query: 428  TLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTS-VQDSETNPFVIFYPSIIYPGVY 486
            +LN P+C                W  G  + NY+ T+ +      P V F+P + Y G Y
Sbjct: 424  SLNEPSC-NSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQY 482

Query: 487  TIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEV 546
            +I++ TPGC +D++C +RGI+N T+ +  NN++L +  IYQNND  K+D LYSG+L+   
Sbjct: 483  SIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSP 542

Query: 547  KVTLEFDGAINSGTEVPVMVASK--IVVNIEDFDQSVFENNTSGFINGLLHYSTSN--TS 602
            K+T+ +   I SGT    +V  +  I++N  D    +  +  S  +NGL  Y  SN  TS
Sbjct: 543  KITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTS 602

Query: 603  SFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEY 662
            S  S +   + T +   +++    + ++ A+++ D L++   D  ++  +L  +L+I+  
Sbjct: 603  SKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSS 662

Query: 663  TFETIGKDISTISEYSGGLIIVGTFNGSSEPA-ARGFNGTFFNLTEFNSTVRTFSNLTLG 721
            + + I   I+ +  YS G+++ G FN S E +    FNG+F ++    S +  F+N+T+ 
Sbjct: 663  SQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITID 722

Query: 722  QTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSF 781
             +E+L+FD N+I N ++  +I +TS  +L + S+G N   DTLF G + Q  +TNL+GS 
Sbjct: 723  DSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSV 782

Query: 782  FISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQL 841
             I+ N    S    ++G   PY A F+++S T Y   N  +TS      ++   GS    
Sbjct: 783  SIANNLSATS--LRSIGS--PYAAIFLNDSVTGYVLKNDSSTS-----EMIFSDGSKAPW 833

Query: 842  SAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFF 901
              W+G V +M    N S+LA+G      + +L + N  S + LA+   +   S+ +++ F
Sbjct: 834  -RWTGYVDSMLYLTNQSMLAVGSS-SSVNGELSILNLDSFKVLANETLNQNSSVKTMVHF 891

Query: 902  ARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGS 961
             RN+S+LVGG+F ++NT+C GLCL+NY   +W  FLN +I G I +++IFN+S L+IAG 
Sbjct: 892  ERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAGV 951

Query: 962  FRLNETDGVSLASICLKDSSSEILHEG-NITLNGFVSMDGSSNNVVAFSDTSLLQLESGK 1020
            F       V+LA + L D+   ++  G    +  F+++D   +N+ A+++TSL +  S  
Sbjct: 952  FDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFAWNETSLFEYTSNS 1008

Query: 1021 WQQISTNFTENSKFKGLDVFPLKDTTRK--QKRD---SSSKVLLITGSLQHAKFGSINAA 1075
            W  I  + + +S    +D      TT    +KRD   +S+ VL++ G +    +G I A 
Sbjct: 1009 WVDIPISNSNSS--TTIDSIGWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAM 1066

Query: 1076 FYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXXXXXXX 1135
             Y+  EW P+LS N   SS++ + + +F++RD+S   D +  LQ +              
Sbjct: 1067 IYNFEEWIPYLSINSLVSSAN-QPAELFIDRDVSKLFDSQLALQVSNTTASITASSSTPT 1125

Query: 1136 XXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKPR 1195
                    L + KKKIDRGF+VLI                 I +Y F D    Y +  PR
Sbjct: 1126 PTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPR 1185

Query: 1196 TDENEMIDTVPPEKLMRFI 1214
             +E+EM+ TVPPEKLM FI
Sbjct: 1186 VNEDEMLKTVPPEKLMEFI 1204

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1234 (32%), Positives = 644/1234 (52%), Gaps = 54/1234 (4%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            M +   L   +L LA    GS L  +E  L +  Y+ PN D     + ++  + NF+++ 
Sbjct: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55

Query: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSG 120
            ++ Y+GQ+NFT + +   E++L+YYSN+TF++++             IVP  +D+FILSG
Sbjct: 56   VISYTGQQNFTVQAN---ESSLLYYSNDTFVKLFETSPETTVTM---IVPLFEDSFILSG 109

Query: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180
             G I+G  L +Q+L NL+SL    IF   +  V  I    + V F G+F   +SN+T H 
Sbjct: 110  TGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHG 169

Query: 181  LLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNT---QQLXXXXXX 237
             ++WD + +  E+ PF GFG+NS V            FAG+F  + N    Q+       
Sbjct: 170  AVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNS 229

Query: 238  XXXXXXXPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEET 297
                    +    + L+ ++ ++   +    + CPS    GW  + + Q   +  +  E 
Sbjct: 230  SHEDLTSLQFDQSVPLKLSS-ITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEI 288

Query: 298  RPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTD 357
             PSK+R++N+ + + ++SLFRI+T PSNGIMNLTYLDP +GEL  CDAWCPLLS ++LT 
Sbjct: 289  HPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQ 348

Query: 358  ISSKSYPGDQ-VQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIEL 416
            IS  S    + V    N T L+WSES+Q+FAFVN++PV+ L F+AL SYGS+  L  IE+
Sbjct: 349  ISQNSTAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEI 408

Query: 417  YESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSETNPFVIF 476
            +E+ + VYANN+ N PNC +              W +      Y+ST++ D+   P+V F
Sbjct: 409  FETEFMVYANNSYNEPNC-ESVTEYSKAELSSDNWYTTDESDTYISTNIDDNI--PYVTF 465

Query: 477  YPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDT 536
            +P+I YPG YT ++ TPGCL+D+SC  RGI+N T+ D   N +L S+ IYQ N+ +KFD 
Sbjct: 466  HPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDP 525

Query: 537  LYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQ-SVFENNTSGFINGLLH 595
            LY+G L S  ++ + +D AI  G    VMV  ++ V  E  D  S+  N+T+  +NGL  
Sbjct: 526  LYTGSLGSAPEIIVTWDKAI--GESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQ 583

Query: 596  YSTSNTSSFLSELGSYSATD-LAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLA 654
            Y+T+N ++ +     +S  D    Y++   P  +N++A    +D+++      +A+++L 
Sbjct: 584  YNTANVTASI-----FSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELN 638

Query: 655  NNLSIEEYTFETIGKDISTISEYSGGLIIVGTFN--GSSEPAARGFNGTFFN-LTEFNST 711
            +   I            + I EYS GL++ GT+     S      ++G  FN   + +  
Sbjct: 639  DEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEP 698

Query: 712  VRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQ 771
            +    N T+   E+L+FD   I N +    + ++S   +   SAG N  ND+L  G  L+
Sbjct: 699  IDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLK 758

Query: 772  NDYTNLNGSFFISTNSEEVSQNFWALGGKL-PYDAAFVDNSTTAYAYY--NPDNTSNSFG 828
                 LNG   +S++ +  S     L   + PY AA++++++ AYA    + DN  +   
Sbjct: 759  RSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVL 818

Query: 829  VSVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHT----DSQLLVTNSSSGESL 884
            ++  N S   +Q+  WS  + A       ++LAIG    ++    D Q  + N +  E++
Sbjct: 819  ITNTNSSSHMLQIQ-WSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENV 877

Query: 885  ASYKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGV 944
            A   + +   +NS++ F+ NNS+LVGGS+ ++N  C+ LCL+NYQ K+W+ FLN+SI G 
Sbjct: 878  ARVNFSTNERVNSMVSFSSNNSILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITGD 935

Query: 945  INRMEIFNN-SNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSN 1003
            I +M+  +    LL+ G  + N    + L S+ +  +    +  G   L  FV +D S++
Sbjct: 936  IRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTD 995

Query: 1004 NVVAFSDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGS 1063
            N++A  ++ +L+LESG W         +S   G  V      T  +KRD  S ++L+ G+
Sbjct: 996  NIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVL---SGTESKKRDEGSHIVLLEGT 1052

Query: 1064 LQHAKFGSINAAFYD--SGEWTPFLSSNQATSSSDLETSHVFLN-RDLSDFLDYKGYLQG 1120
            L  +++G++ +  YD  + +W P+   +       L +S  F N  DL     Y    Q 
Sbjct: 1053 LNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDL-----YLSSSQT 1107

Query: 1121 TFXXXXXXXXXXXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSY 1180
                                      K KKIDRGFIVLI                 +  Y
Sbjct: 1108 VLQSNNSDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICY 1167

Query: 1181 FFGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
            FF ++ +GY+  KPR +++EM+DTVPPEKLM+FI
Sbjct: 1168 FFINN-NGYESLKPRINQDEMLDTVPPEKLMKFI 1200

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/1232 (33%), Positives = 662/1232 (53%), Gaps = 56/1232 (4%)

Query: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73
            L +    S L+ ++S L +E   +PNL++S++ +N VQ+LG    ++  +Y+GQ+NFT E
Sbjct: 14   LVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKE 73

Query: 74   VSGNPE---NALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLS 130
            +   PE   + L+YYSN T++++              I PF  D+FILSG+G+I+   + 
Sbjct: 74   IG--PETSSHGLVYYSNNTYIQL---EDASDDTRIDKITPFGVDSFILSGSGTINNISVG 128

Query: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190
             Q+L+NLS+L    IF Q L  V  + A+   ++FGG+F Y   + T +S L+WDSI + 
Sbjct: 129  NQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNT 188

Query: 191  VEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXX-----XXXXXXXXXP 245
             ++LPFGGFG+NS+V            FAG F  +D+   L                   
Sbjct: 189  TQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTL 248

Query: 246  ELGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLR 303
            ELG +I L+ A+W S G  T    ++ CP+T    WL    T G     +P E  P+K+R
Sbjct: 249  ELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYP-DTSGSLVCNLPYEVSPTKIR 307

Query: 304  VFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSK-S 362
            ++N++ SD ++S+F+I+T PS+ IMNLTYLDP +GEL +C  +CPL S   L   S   S
Sbjct: 308  LYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVS 367

Query: 363  YPGDQVQYFE-NRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAY 421
               D + + + N+T ++W+  FQDFAFVN +PVS L F+AL+SYG SVGL+G+ELY+  +
Sbjct: 368  SSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTF 427

Query: 422  SVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTS-VQD-SETNPFVIFYPS 479
            S YAN++LN   C+               W +G +  +Y++   V D +E  P V FYP+
Sbjct: 428  STYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPN 487

Query: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539
            II+PG YTI++ TPGCL+D++C  RGI+N T+ + QNNT++ +  IYQNND  K+D +YS
Sbjct: 488  IIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYS 547

Query: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTSG--FINGLL 594
            G+LD   ++ LE+   I +     V+VA +   I V+++ F+     +N      +NG+L
Sbjct: 548  GYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGIL 607

Query: 595  HYSTSN-TSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKL 653
             Y  SN TS+ L+E      T L  + V   PK+S+++A+++++ LV+      ++ + L
Sbjct: 608  QYQKSNFTSTRLNET-KVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDL 666

Query: 654  ANNLSIEEYTFETIGKDISTISEYSGGLIIVG-TFNGSSEPAARGFNGTFFNLTEFNSTV 712
             ++  +     +TI  D+  I++ + GL+I G   + +++ A   FNG+F N+   + TV
Sbjct: 667  NDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVFNQSRTV 726

Query: 713  RTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQN 772
             +  N++L   + ++ D + ++N ++   I ++S  +L + +AG N   D LF G V   
Sbjct: 727  NSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHM 786

Query: 773  DYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVM 832
             Y NLNGS      +E    N    GG +PY  A+++ S TAYAY           V  +
Sbjct: 787  QYGNLNGSVRFLNENEIEPLNLE--GGIVPYLGAYLNESATAYAY----------EVDSL 834

Query: 833  ND---SGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKW 889
            N    S        WS  +  M  + N +LLA+      T ++L + +  +   +A+   
Sbjct: 835  NKIYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAG-SSTTAELSIFDLRNLTMIANETL 893

Query: 890  DSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRME 949
             S   +N+++ F +N S+LVGG F++    C+GLCL+NY+ K WS FLNN+I G I ++ 
Sbjct: 894  GSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLS 953

Query: 950  IFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNI-TLNGFVSMDGSSNNVVAF 1008
              N+S L+I+G F   E   + L S  L +S+   L  G+   LN F   + S   +VA+
Sbjct: 954  FTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDS---IVAW 1010

Query: 1009 SDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRD----SSSKVLLITGSL 1064
            +DTSL    + +W   S     +S      ++   ++    KR     ++  +LL+ G+ 
Sbjct: 1011 NDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNF 1070

Query: 1065 QHAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGT--F 1122
              +++G + +  +D  +WTP+  S + T++S+     +F+NRD+S   + +  L      
Sbjct: 1071 NISQYGYLQSLLFDFQKWTPYFIS-ETTNTSNYN-PIIFINRDVSTEFNSQSPLANVNIT 1128

Query: 1123 XXXXXXXXXXXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFF 1182
                                  + KKKKI RGF+VLI                 I +Y F
Sbjct: 1129 VTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVF 1188

Query: 1183 GDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
             D    Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1189 KDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1228 (32%), Positives = 647/1228 (52%), Gaps = 49/1228 (3%)

Query: 11   VLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNF 70
            + +LA   + S L  +   L ++ +++PNL+ + + N  +QLLG+ +++    Y GQ+NF
Sbjct: 13   LFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSN-SIQLLGDVENLQFYHYEGQQNF 71

Query: 71   T--GEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQ 128
            T  G    +  N LIYYS++  +++              I+P  DD+F+LSG+G ++G+ 
Sbjct: 72   TDDGNSGISSTNNLIYYSDDVLIQL---EVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYA 128

Query: 129  LSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIK 188
            L RQLL+NL++L  + IF QDL  + +I  + + V+FGG F Y+  +Q   S++ W+   
Sbjct: 129  LGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTS 188

Query: 189  DGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXX-------XXXX 241
            D V  LPF GFG +S V            F G F  + N+  L                 
Sbjct: 189  DEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTEN 248

Query: 242  XXXPELGHQISLQSAAW-VSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPS 300
                +L  QISL+ A W       D++   C +  S  W+  G + G  +L  P    PS
Sbjct: 249  SSTIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRS-GNLQLNFPNTVSPS 307

Query: 301  KLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISS 360
            K+R++NA  +++ VSLFRIVT+PSNGIMNLTY+DP TG+L  CDA+CPLL+S  L   SS
Sbjct: 308  KIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASS 367

Query: 361  KSYPGDQVQYF--ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYE 418
             S    + + F   N T++ WSES+Q+FAF+NN+ VS LT IA DSYGS   L+GIEL++
Sbjct: 368  NSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQ 427

Query: 419  SAYSVYANNTLNAPNC-AQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQ-DSETNPFVIF 476
             +++ YANNTLN P C  +              W  G    +Y++ + Q DS   P V F
Sbjct: 428  DSHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQF 487

Query: 477  YPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDT 536
            YP+I   G ++I + TPGCL D +C++R I+N T+ D  + T+L +  IYQNN+  K+D 
Sbjct: 488  YPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDE 547

Query: 537  LYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKI-----VVNIEDFDQSVFENNTSGFIN 591
            +++G L    ++TL F   I    +  ++VA ++      +N++D        +TS  +N
Sbjct: 548  IFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLN 607

Query: 592  GLLHYSTSN-TSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMAR 650
            GL  Y  SN TS   +++G+ S   LA   +S+ P   ++  N F + + L  +   + +
Sbjct: 608  GLFQYQLSNFTSDTKTKVGNNSIHQLA---LSQFPSSVSLIGNTFNNSIFLAGSTSNIVQ 664

Query: 651  LKLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEPAAR--GFNGTFFNLTEF 708
            L+L ++L +        G + + I  YS GL+  G +N SS        FNGTF + ++ 
Sbjct: 665  LQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSFSQL 724

Query: 709  NSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGY 768
               V TF+N T   +E+L F+ + + N ++   IY+ +  T  V + G N  NDTL  G 
Sbjct: 725  GDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGN 784

Query: 769  VLQNDYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFG 828
            +++++Y+N N    +  NS   S  F +    +PY A F++++   YAY + +N+   +G
Sbjct: 785  IVRSEYSNFNEPLKLYGNSSLESLTFSS--SIVPYAAVFLNDTANLYAYKDGENSKIIYG 842

Query: 829  VSVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYK 888
                N+  +++    +SG +  ++ S N SLL       +  S L+++N S G SLAS  
Sbjct: 843  ----NNMTTSLD---FSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASEN 895

Query: 889  WDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRM 948
             ++   + S+I F  NN++LV G+F +++  C G+CL+NY  KKWS F N++I+G I  M
Sbjct: 896  LNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEM 955

Query: 949  EIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILH-EGNITLNGFVSMDGSSNNVVA 1007
            +++N+  +LI+G F       ++LAS+ +K  +  +L  +  I ++ F+  DG S  +  
Sbjct: 956  QLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIH-DGQS--ITV 1012

Query: 1008 FSDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHA 1067
            +S+ ++++ +S KW +IS   T +   + ++   +     +    + SK+L   G     
Sbjct: 1013 WSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSID---LQNSTSNVSKILFAYGEFNST 1069

Query: 1068 KFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXX 1127
             +G +NA  + +G+W P+ S N    + D   + +F NRDLS   + K  L         
Sbjct: 1070 LYGRLNAMLFRAGDWKPYFSINNFQVNEDPAIT-LFENRDLSSLFNSKNSLPANITSAET 1128

Query: 1128 XXXXXXXXXXXXXXX-XLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSG 1186
                             ++ K  KIDRGF+VLI+                  +Y F D  
Sbjct: 1129 SSRSTVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRDE- 1187

Query: 1187 DGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
              Y+  KPR D  EM+DTVPPEKLM+FI
Sbjct: 1188 QKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1231 (32%), Positives = 652/1231 (52%), Gaps = 49/1231 (3%)

Query: 12   LALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT 71
            L L      S L  +++ L V   +IP L+L+ S ++  QLLG+   ++  +Y GQ+NFT
Sbjct: 10   LLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFT 69

Query: 72   -GEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLS 130
             G + G+  N LIYYSN T +++              I PF  D+FILSG GS+SG+ L+
Sbjct: 70   TGIIPGSNSNGLIYYSNNTLIQL---EEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLT 126

Query: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190
             QLL+NL++L    IF   + +V TI  +   V+FGG+F        IHSL++WDS    
Sbjct: 127  NQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSS 186

Query: 191  VEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQ---QLXXXXXXXXXXXXXPEL 247
             E L FGGFG+NS +            FAG F  +D      Q               ++
Sbjct: 187  TEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDI 246

Query: 248  GHQISLQSAAW-VSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFN 306
            G  + L ++ W   + T D     CP T    W+++G+T G     +P E  P+K+R++N
Sbjct: 247  GQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTT-GSLTCKLPFEVAPTKIRIYN 305

Query: 307  ARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI-SSKSYPG 365
            + + D QVSLFRI+T  + GIMNLTY+DP + EL  CDA+CPL S   L+   ++ + P 
Sbjct: 306  SPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPS 365

Query: 366  DQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVY 424
            D +    +N T ++W++ FQ+FAF+N + VS + F+ALDSYG++V L+  +LY++AY+V+
Sbjct: 366  DTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVF 425

Query: 425  ANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTS-VQDSETNPFVIFYPSIIYP 483
            AN+TLN PNC                W+ G +   Y+ST+   + +  P+V F P I YP
Sbjct: 426  ANDTLNEPNC-NSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYP 484

Query: 484  GVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLD 543
            G Y+I++ TPGC +D +C +R I+N T+ D    ++L +  IYQNN   K+D LYSG+L 
Sbjct: 485  GQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLS 544

Query: 544  SEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFD----QSVFENNTSGF-INGLLHYST 598
            S  +VT+E+   + +   V  +VA ++ V I+  +     S   NNT    +NGLL Y  
Sbjct: 545  SSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQI 604

Query: 599  SNTSSFLSELGSYSATD--LAHYSVSKLPKHSNIFANMFEDD-LVLFTTDGEMARLKLAN 655
            SN S+  SE      T+  L   S+ +  K+++++A++++D+ L+L  ++G +  +KL  
Sbjct: 605  SNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNE 664

Query: 656  NLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEPA-ARGFNGTFFNLTEF--NSTV 712
            N+ IE     ++  + +  S YSGG++  G +N SS+      +NGTF  +  F  NS++
Sbjct: 665  NMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSI 724

Query: 713  RTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQN 772
                NLT+  TE+L+ D   I N ++   I ++S L L + S+G N   DT+F G +   
Sbjct: 725  TNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALL 784

Query: 773  DYTNLNGSFFISTN--SEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVS 830
            DYT+LNGS  I  N     ++ N  +      Y   F+++S + YA     + ++S+   
Sbjct: 785  DYTDLNGSIAIGNNFTVTNITNNVSSTNSL--YTGLFLNDSLSIYA-----SKTDSYS-E 836

Query: 831  VMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWD 890
            ++  +G +   S + G +  M  S + ++LA+   D + +S+L + N ++ E++A+   +
Sbjct: 837  LLFSNGYSAPWSFFEG-INYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLN 895

Query: 891  SEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEI 950
                +N +I F  N++++VGG+F +  + CSGLCL+NY   +W  F N+SI G I +ME+
Sbjct: 896  VNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMEL 955

Query: 951  FNNSNLLIAGSFRLNETDGVSLASICLKD--SSSEILHEGNITLNGFVSMDGSSNNVVAF 1008
             N + LL++G F       V+LA + L     SS  + + NI L  F ++    + ++ +
Sbjct: 956  INGTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANI-LQSFATI---GDKIITW 1011

Query: 1009 SDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAK 1068
            +   L   E+G W  I +NF  ++  + ++      T +K+    S+   +I G++   +
Sbjct: 1012 NGIMLESYENGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFIINGNIYDTE 1071

Query: 1069 FGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQG-----TFX 1123
            +G+I A  Y+  EW P+      +S++      +F+NRD S   + +  LQ         
Sbjct: 1072 YGTIQAMIYNFKEWRPYY---IISSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTT 1128

Query: 1124 XXXXXXXXXXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFG 1183
                                 Q  +KKIDRGF+VLI                 + +Y F 
Sbjct: 1129 PSSTSSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFK 1188

Query: 1184 DSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
            D    +    PRT+E+EM++TVPPEKLM+F+
Sbjct: 1189 DGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/1209 (33%), Positives = 637/1209 (52%), Gaps = 44/1209 (3%)

Query: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNPE 79
             S L+ L++K G+     P LD        +QL G F  +   +Y GQ+NFTG ++ N +
Sbjct: 17   ASQLENLKNKHGIVNIGTPRLDF---PGEALQLFGGFNALTFPQYEGQENFTGTINNNTD 73

Query: 80   N-ALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLSRQLLFNLS 138
            +  ++YYSN+TF+++              IVPF  ++FIL G+GS+ G++L RQLL+NLS
Sbjct: 74   SRGIVYYSNDTFIKL---INGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLS 130

Query: 139  SLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGG 198
             L  R IF   L  V  I  +    +FGG+F ++  +   HS+  W+S  +   +LPFGG
Sbjct: 131  DLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGG 190

Query: 199  FGKNSTVXXXXXXXXXXXXFAGNFSAVDN-TQQLXXXXXXXXXXXXXPELGHQISLQSAA 257
            FG+ S V            F G F  +D+ T  +              E+   + L++A 
Sbjct: 191  FGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINELLPLRAAT 250

Query: 258  W--VSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVS 315
            W   SD + D SA  CP+++   W    ST G  E  +P E+ P K+R++N+ +    VS
Sbjct: 251  WNTDSDSSFDSSAFICPNSQKEAW-SVPSTSGSLEASLPYESYPKKVRIYNSPEEHNAVS 309

Query: 316  LFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYFENRT 375
            LFRI+T PSNGIMNLTY+DP +GEL +CDA+CPL+   +L    +       V+   N T
Sbjct: 310  LFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVRLDNNLT 369

Query: 376  TLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCA 435
             +QWS  +QDFAFVN + V+DL F+AL SYG +VGL+  +LY+   + YANN+LN   C 
Sbjct: 370  DIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSLNEVGC- 428

Query: 436  QGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQD-SETNPFVIFYPSIIYPGVYTIDVLTPG 494
            +              W  G    +YL    +   ET P V FYP+I Y G YT+++ TPG
Sbjct: 429  ESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMNLYTPG 488

Query: 495  CLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDG 554
            C  D +C +R I+N T+      ++L SI ++QNN+  K+D +YSG L++   +TLE+  
Sbjct: 489  CSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLTLEYYS 548

Query: 555  AINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFI--NGLLHYSTSNTSSFLSELGSYS 612
             I+      V+VA ++ V +E  D  + +N T   I  NG+  Y  SN ++      S +
Sbjct: 549  PISPNNPSNVVVADRLEVIVESVD--ILKNQTDETIPLNGMFQYQLSNFTNSTDSKPSIA 606

Query: 613  ATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDIS 672
             T L  Y+V   PK++++F++M+ + L +  +   +A ++L  +L +        G  + 
Sbjct: 607  NTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTAKYATGGTVE 666

Query: 673  TISEYSGGLIIVGTFNGSSEPAAR-GFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKN 731
             IS YS G+I+ GTFN SS+P +   FNG F +     +T+RT++N++  Q E+L+F+  
Sbjct: 667  GISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDELLVFNNE 726

Query: 732  IILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVS 791
             + N ++   I ++S   L + SAGRN ++DTLF G V +N +  L GS  I +NS    
Sbjct: 727  YVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYSNSSVA- 785

Query: 792  QNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAM 851
             +F    G  PY A  +++S TAYAY     +   F      D+G     + W G + +M
Sbjct: 786  -HFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYF------DNGKEGPWT-WFGTINSM 837

Query: 852  ASSKNDSLLAIGGKDQHTDSQLL-VTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVG 910
              SKN ++LAI G D  TD  +L + N +S + LA+       +++S++FF RN+S+LVG
Sbjct: 838  RYSKNSTILAI-GTDGSTDEPILSLFNLTSFDVLANTTISENGTISSMVFFDRNSSLLVG 896

Query: 911  GSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGV 970
            G + +++  CSGLCL+NY  K+W+ F NNSI G I  M++  + +LLI+G+  +     V
Sbjct: 897  GDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMNVANKTSV 956

Query: 971  SLASICLKD-SSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFT 1029
            +L S  + +   + ++ + N  +  F++ D   N+++ +++TSL     G WQ +   F 
Sbjct: 957  NLLSFNMSNYEVNPLVWDSNGPIKSFIAED---NDIITWNETSLSGYSDGDWQNLE--FD 1011

Query: 1030 ENSKFKGLDVFPLKDTTRKQKRDSSSK---VLLITGSLQHAKFGSINAAFYDSGEWTPFL 1086
             +S    +DV  +K      KR + S     +L+ G   +A++    A+ Y+   W P+ 
Sbjct: 1012 NSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYP--QASIYNFQRWLPYY 1068

Query: 1087 SSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXXXXXXXXXXXXXX-XLQ 1145
             +N+A    D   +  F N+D S   D +  L                          L 
Sbjct: 1069 VANKA-DDEDPSRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSSQTSPSKGSLV 1127

Query: 1146 RKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKPRTDENEMIDTV 1205
            RK  KI+RGF+VLI                 + +  F +   GY+   PR DE+EMIDTV
Sbjct: 1128 RKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVF-NGHSGYEQVDPRADESEMIDTV 1186

Query: 1206 PPEKLMRFI 1214
            PPEKL++F+
Sbjct: 1187 PPEKLLKFL 1195

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1224 (33%), Positives = 642/1224 (52%), Gaps = 48/1224 (3%)

Query: 14   LAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGE 73
            +A    GS ++ + +   +  Y  P+LDLS  +N+++ +  +F+  +   Y GQ+ FTG 
Sbjct: 14   VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTG- 72

Query: 74   VSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLSRQL 133
            ++   +N+LIYYSN T++++              IVP+ DD+FILSG G   GH+L  QL
Sbjct: 73   LADERKNSLIYYSNNTYVQL---AELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQL 129

Query: 134  LFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEV 193
            ++NLSS E  EI  + L  VN I  +G+ V+FGG F Y   N + HS++ WD+      +
Sbjct: 130  IYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSL 189

Query: 194  LPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXXXXXXP--ELGHQI 251
            LPF GFG+ S V            F G FS +DNT  L                E     
Sbjct: 190  LPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALA 249

Query: 252  SLQSAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSD 311
            SL+ ++ V DGTL+ SA  CP   +  W    ST G+  + +  +  PSK+R++N++DS+
Sbjct: 250  SLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYNSKDSN 309

Query: 312  EQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYF 371
             QV+LFRIVT+PS  IMN+TY+DP TG LA CDAWCPL     L++++  S       + 
Sbjct: 310  NQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSVMAAFP 369

Query: 372  ENRTTL-QWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLN 430
             N   L +W+ ++Q+FAFVN VP+ +LTFIA+DS+G +VGL GIEL+++ Y  Y NNTLN
Sbjct: 370  NNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYVNNTLN 429

Query: 431  APNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSETNPFVIFYPSIIYPGVYTIDV 490
             PNC                W  G  + +Y++TS   +   P V   PSI YPG+YT+++
Sbjct: 430  QPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSF--TAGKPSVTLTPSIPYPGIYTLNL 487

Query: 491  LTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTL 550
            +TPGCL D++C  RGI+N TIR  QN T L +  IYQNN+  K+D L+ G+LD    V L
Sbjct: 488  VTPGCLTDNTCAFRGIVNVTIR-AQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSPNVVL 546

Query: 551  EFDGAINSGTEVPVMVASKIVVNIEDFDQSVFENNT--SGFINGLLHYSTSN-TSSFLSE 607
            E+ G I+      VMVA ++   I+  +    +N T  S  +NGL  Y+ SN T++ LS 
Sbjct: 547  EWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAASNFTNTNLST 606

Query: 608  LGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVL--FTTDG--EMARLKLA-NNLSIEEY 662
            L    +T++  Y V  +P  S++F  ++ D L +   + DG  +++R K   N++ ++  
Sbjct: 607  L--VGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVDPQ 664

Query: 663  TFETIGKDISTISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTLGQ 722
              +T G  ++ I  YS GL +    N ++  ++  FNG+   +   N+   +  NLT+  
Sbjct: 665  LIDTEGP-VTGIFPYSNGLALTVHSNQTNMASSLSFNGSISTIFRSNAPSLSILNLTIDG 723

Query: 723  TEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFF 782
            +E+L+FD   + N ++   I ++  L L + SAG N  +D +  G V    +   NG+  
Sbjct: 724  SEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPNGAIA 783

Query: 783  ISTNSEE-VSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQL 841
            I  +S E V+    ++   + Y   F+++S++AYAYY+    S+  G+ V  +      L
Sbjct: 784  IDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHEPEY-L 842

Query: 842  SAWSGKVGAMASSKNDSLLAI--GGKDQHTDSQLLVTNSSSGESLASYKWDSEIS--LNS 897
            S     V  M   K+ +LLA+   G  Q   S L + + S+    A  K   EI   +N+
Sbjct: 843  STDDSTVNDMLYIKDSNLLAVVTSGTSQGLAS-LYIHDLSA--DFAPIKETFEIGEVINT 899

Query: 898  IIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLL 957
            ++ F RN ++LVGG+F  N   C  LCL+NY    W+ F++ +I G I +++  + + L+
Sbjct: 900  MVLFGRNYTLLVGGTFTRNG--CRDLCLYNYATNNWTRFMDGNITGDIRQLQFLDGNTLM 957

Query: 958  IAGSFRLNETDGVSLASICLKDSS--SEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQ 1015
            +AG    +++  + L  I L +    S++      T    +++  SS+ ++A     +  
Sbjct: 958  VAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDGNQVFH 1017

Query: 1016 LESGKWQQISTNFTENSKFKGLDVFPLKDTTRK--QKRDS-SSKVLLITGSLQHAKFGSI 1072
               G+W+ IS + +  ++  GL +     + R    KRD   +++++I G+     +G I
Sbjct: 1018 FVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSPDYGDI 1077

Query: 1073 NAAFYDSGEWTPFLSSNQATSSSD--LETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXX 1130
            NA +YD   W P+  S    S+SD  +    +FLN+D+S     + YL            
Sbjct: 1078 NAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSN--------DN 1129

Query: 1131 XXXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQ 1190
                          ++  KK+ + F+VLI+                +F+Y FGD  + Y+
Sbjct: 1130 DNDDTPAASEPATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDH-NAYE 1188

Query: 1191 LSKPRTDENEMIDTVPPEKLMRFI 1214
              KPR +E EM+ TVPPEKLM+FI
Sbjct: 1189 PLKPRINEAEMLKTVPPEKLMKFI 1212

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1252 (33%), Positives = 643/1252 (51%), Gaps = 64/1252 (5%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            M AT     S L +      S L  ++  LG+   +IP ++   + NNE+Q+L N + + 
Sbjct: 1    MLATIVRLIS-LGIIGVSQASQLTNVKDSLGINTVNIPQINFGNT-NNEIQILSNIEGLT 58

Query: 61   ILKYSGQKNFTGEVSGNPE-NALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILS 119
              +Y GQ+NFTG +  N   + LIYYSN+T +++              IVP  +DAFILS
Sbjct: 59   FYQYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKL---LEGSDNTKIDQIVPLDEDAFILS 115

Query: 120  GAGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIH 179
            G+G++ G QL  QLL+NLS L    +F   L  + +I  + D V+FGG+F Y  +N+T +
Sbjct: 116  GSGTLGGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTAN 175

Query: 180  SLLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXX 239
            S++ W+ +   V++LPF GFGKNSTV            F G+FS +D+   L        
Sbjct: 176  SIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYT 235

Query: 240  XXXXXP--------ELGHQISLQSAAWVSDGTLDKSA-IKCPSTESTGWLKTGSTQGQFE 290
                          EL  QISL+ A+W S G L  S    CP+ ++  W   G+T G+  
Sbjct: 236  QQNSTSSSSTETNLELEQQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTT-GEIT 294

Query: 291  LYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLL 350
              +  E   SK+R+FN+    +Q++ FRIVT PSNGIMNLTYLDP T E+  CDA+CPL 
Sbjct: 295  CNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLY 354

Query: 351  SSQNLTDISSKSYPGDQVQYF--ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSS 408
            SS  L   S  +        F   N+T + WS  +Q+FAFVN VPV+ L  IAL SYG +
Sbjct: 355  SSNALQASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDN 414

Query: 409  VGLAGIELYESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTS-VQD 467
            VGL+G +LY+++YS++ANN+LN P C                W  G +  +Y++T     
Sbjct: 415  VGLSGFQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG 474

Query: 468  SETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQ 527
             + +P V FYPSI   G YT+++ TPGC  D +C  RGI+N T+ D   N L+ +  IYQ
Sbjct: 475  DDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQ 534

Query: 528  NNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFEN 584
            NN+  K+D L+ GFLD   KVTLE+   IN      V+VA     + +NIE  D+++  N
Sbjct: 535  NNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIE-LDETI-GN 592

Query: 585  NTSGF------INGLLHYSTSNTSSFLSELG-SYSATDLAHYSVSKLPKHSNIFANMFED 637
             TS        +NG+  Y  SN +S  +        T L  + VS+     +++   + +
Sbjct: 593  VTSSTEELKVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNE 652

Query: 638  DLVLFTTDGEMARLKLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSE-PAAR 696
             L+L  +   +  L L+N  +I        G +++    Y+GG+++ G FN S+   ++ 
Sbjct: 653  TLLLGGSIAGVYALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSL 712

Query: 697  GFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAG 756
             +NGTF +    NS + TFSNLT G++E+L F+     N +T   I++TS L+L + SAG
Sbjct: 713  SYNGTFDSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAG 772

Query: 757  RNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYA 816
             N + DTLF G + +N++ NLN S  ++ N    +Q+     G  PY   ++++S TAY 
Sbjct: 773  SNDFGDTLFSGLITRNEFPNLNNSAVLTGNG--TAQSLQLRNGIQPYLGVYLNDSLTAYL 830

Query: 817  YYNPDNTSNSFGVSVMNDSGSTVQLSAWS--GKVGAMASSKNDSLLAIGGKDQHTDS--Q 872
            Y   D++SNS   +++  +G       W+    V +   S N+++  +G    + DS  +
Sbjct: 831  Y---DSSSNS---NILFSNGLQ---GNWNLPRSVSSAYYSDNETMF-VGSSLSNGDSGAE 880

Query: 873  LLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKK 932
            L V N ++ + L +  +D   S+NSI+ F RN+S+LVGG F   NT CS LCL N  + +
Sbjct: 881  LFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQ 940

Query: 933  WSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNITL 992
            WS F +N   G I  +E  N+S LLI+GS+R     G+SL  I L +   + L   +  +
Sbjct: 941  WSSF-SNKFDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKV 999

Query: 993  NGFVSMDGSSNNVVAFSDTSLLQLESGKW--QQISTNFTENSKFKGLDVFP---LKDTTR 1047
            N F   +G+   +VA+  +++       W   QI  N   ++  K + +        +T 
Sbjct: 1000 NSFNYNNGT---IVAWDSSTIYSYRGDSWSNHQIP-NTNSSTSIKNVQIVSKLNNSLSTN 1055

Query: 1048 KQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRD 1107
                + + +++L+ G L    +G + A FYD   W P+  + Q  SS +   + +F+N+D
Sbjct: 1056 NTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWIPYYIT-QPYSSLNTSKNSLFMNKD 1114

Query: 1108 LSDFLDYKGYLQGTFXXXXXXXXXXXXXXXXXXXXXLQRKKK-----KIDRGFIVLISXX 1162
            +S   + +  LQ                            K      KI RG++VLI   
Sbjct: 1115 ISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLA 1174

Query: 1163 XXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
                            +Y F D    Y   KPR DE+EM+DTVPPEKLM+FI
Sbjct: 1175 LAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1235 (30%), Positives = 612/1235 (49%), Gaps = 55/1235 (4%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            MR    L  ++  L     GSHL+++     ++ +  P LDLS ++N  + +  +F+   
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSG 120
               Y GQ+ FTG+   +  ++LIYYS  T++++              IVPF  D+FILSG
Sbjct: 61   YYNYKGQQLFTGQ-EQHQGSSLIYYSEGTYVQL---AKLDDDTVVRRIVPFGSDSFILSG 116

Query: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180
             G +   +L  QL++NLS+LE  EI  Q L  VN I  +GD V+FGG F Y   N++ HS
Sbjct: 117  TGKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHS 176

Query: 181  LLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVD-----NTQQLXXXX 235
             + W++      +LPFGGFG+ S+V            F G FS ++      T  +    
Sbjct: 177  AVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLAST 236

Query: 236  XXXXXXXXXPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKT----GSTQGQFEL 291
                      E     SL+ +   SDG LDK    CP++    W       G  +G+  +
Sbjct: 237  EKPQLNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296

Query: 292  YMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLS 351
             +     PSK+R++N++ +  ++ LFRIVT+PS  IMN+TY+DP TGELA+CDAWCPL+ 
Sbjct: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356

Query: 352  SQNLTDISSKSYPGDQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVG 410
              NLT  +++S P D  +   + +  ++W+  +Q+FAF+N + + ++ FIALDSYG++VG
Sbjct: 357  RSNLTSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVG 416

Query: 411  LAGIELYESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLSTSVQDSET 470
            L G+EL+++ Y  Y N+TLN PNC  G             W  G+++ +YLS +V   E+
Sbjct: 417  LVGVELFQTEYDAYVNSTLNQPNC--GEQQLSPFSTTANIWHQGATDASYLSANV--VES 472

Query: 471  NPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNND 530
            NP V   P I + G YT+++ TPGC +D +C  RGI+N T+    N T L +  IYQNN 
Sbjct: 473  NPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNY 531

Query: 531  YEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQ-SVFENNTSGF 589
              K+D LY+G LD    V +E+   INS     +MVA ++   I+  D      +     
Sbjct: 532  RLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS 591

Query: 590  INGLLHYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVL-FTTDGEM 648
            +NGL  Y+ +  SS  + +  Y   D      + +P+  ++   +++  L+L   + G +
Sbjct: 592  LNGLFQYTPAG-SSLDNGIQKYINKD----PQTDMPEGVSLVGQVYDGKLILGVKSTGHI 646

Query: 649  ARL-KLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEP-AARGFNGTFFNLT 706
            A +     + +  + T + +   ++ IS YS GL+  G FN SS P +A  ++G F +  
Sbjct: 647  AVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFF 706

Query: 707  EFNSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQ 766
            + NS   +  N+T+  +E+L+F+   I N +T + +  +S   L   SA  N  ND LF 
Sbjct: 707  DLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQLSALSAAANSNNDLLFT 765

Query: 767  GYVLQNDYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYN-PDNTSN 825
            G +    + + +G+  +       +    ++ G   +   +++++ TAYAYY+   N+S 
Sbjct: 766  GSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSV 825

Query: 826  SFGVSVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKD-QHTDSQLLVTNSSSGESL 884
            + G  V+   G+   LS     V  M   K  + L I   + + T   L++ +  + + +
Sbjct: 826  ATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEV 885

Query: 885  ASYKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGV 944
            A  K +    +NSI+ F  +N++LVGGSF  +   C  LCL+N+  + WS F +  I G 
Sbjct: 886  AREKLNPGERINSIVLFGEDNTLLVGGSFEKDG--CHDLCLYNFVKRSWSAFASGLISGE 943

Query: 945  INRMEIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHE--GNITLNGFVSMDGSS 1002
            I +++  NN NL+  GS  +     +   +  L  S     HE       N  +++  S 
Sbjct: 944  IKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSG 1003

Query: 1003 NNVVAFSDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDS-SSKVLLIT 1061
            +  VA     +      +W+ ++       +  G+ +  L +   + KR+   +++++I 
Sbjct: 1004 DEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIH 1063

Query: 1062 GSLQHAKFGSINAAFYDSGEWTP--FLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQ 1119
            G +  +++G INA  Y+   W P  F   + A    ++    +FLN+D+S          
Sbjct: 1064 GQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDIS---------- 1113

Query: 1120 GTFXXXXXXXXXXXXXXXXXXXXXLQRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFS 1179
                                        K+K+ +G++VLI+                I +
Sbjct: 1114 ------RQTTTSLPLEVVVSDSPPTAEPKRKLAKGYVVLIALGLALATIALLGIIGVILA 1167

Query: 1180 YFFGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
            Y FGD  + YQ  KPR +E+EM+ TVPPEKLM+FI
Sbjct: 1168 YAFGDH-NAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1233 (32%), Positives = 635/1233 (51%), Gaps = 42/1233 (3%)

Query: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60
            MR    L  S+         S L  LE+ LG++ +  P L  S + ++ +QLLG++  ++
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   ILKYSGQKNFTGEVSGNP-ENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILS 119
            +  Y+GQ+NF+ +++ +   N L+YYSN T +++             +IVP   D+FILS
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQL---NQGLDDTRINNIVPIGSDSFILS 117

Query: 120  GAGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIH 179
            G+GS++ + L  QL +NLSSL    IF   L QV +I  + D V+FGG+F +       H
Sbjct: 118  GSGSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGH 177

Query: 180  SLLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXX 239
            S+ VW+   +   +LPF GFG+NS++            FAG F  +D+   L        
Sbjct: 178  SVAVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNAT 237

Query: 240  XXXXXPELGHQISLQSAAWVSD-GTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETR 298
                  EL   + L  A W SD    D S+  C + +S  W  +G+T G     +P ++ 
Sbjct: 238  TNIYDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDAWFVSGTT-GTLACSLPYDSA 296

Query: 299  PSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI 358
             +K+R++N+ DS  Q+S FR+++ PS  IMN+TY+DP TG L  CD++CPLLS   L+  
Sbjct: 297  LTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSSA 356

Query: 359  SSKSYPGDQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELY 417
            S  +   +  +   +N T ++WS  +Q+F FVN V  + L F+AL+SYGS+V LAG  LY
Sbjct: 357  SDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLY 416

Query: 418  ESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGSSEGNYLST-SVQDSETNPFVIF 476
            +  Y+V+ANN+LN  +C                W  G+S   Y++T   +  +  P V F
Sbjct: 417  QDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTF 476

Query: 477  YPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDT 536
              ++ Y G Y I++ TPGC +D +C TRG++N T+ D  ++++L ++EIYQNN+  K+D 
Sbjct: 477  NANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDE 536

Query: 537  LYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFD----QSVFENNTSGFING 592
            L+SG+L + V++ LE+   I+S +    +VA +  + +   D     S  +N ++  +NG
Sbjct: 537  LFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVALNG 596

Query: 593  LLHYS-TSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARL 651
            L  Y  ++ +S+F S       T L  Y +     +S++FA+ +++ L++   +  +  L
Sbjct: 597  LFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYAL 656

Query: 652  KLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFN--GSSEPAARGFNGTFFNLTEF- 708
            + +N+L+        +      +  +S G+ + G FN  G +E A   +NG+F   T++ 
Sbjct: 657  ESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVT-YNGSFNPFTQYG 715

Query: 709  NSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGY 768
            NS++ TF N+T G +E+L+F+   + N ++   + ++S L+L + SAG N   D LF G 
Sbjct: 716  NSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGA 775

Query: 769  VLQNDYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFG 828
              Q  Y+  N S  I  N+     NF       PY   +++ S  AY Y + DNT     
Sbjct: 776  SSQMSYSFNNESINIGANNIVQGLNFNE--SIDPYLGLYMNTSHGAYFYQDDDNTR---- 829

Query: 829  VSVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLL-VTNSSSGESLAS- 886
            V   N S  + Q   W   V A   S N SLL  G       S  L V N+++ + +A+ 
Sbjct: 830  VYFTNGSQPSWQ---WPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANE 886

Query: 887  YKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVIN 946
                 +  ++ I+ FA N + ++GG+F + N  C GLCLFNY +  WS F + SI G ++
Sbjct: 887  SLSSQQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVD 946

Query: 947  RMEIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVV 1006
             M++FN S L+++G F       +++AS+ LK++    L  G    N F S   +   +V
Sbjct: 947  HMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGES--NTFKSFTVADQKIV 1004

Query: 1007 AFSDTSLLQLESGKW--QQISTNFTENSKFKGLDVFPLKDTTRKQKRD-SSSKVLLITGS 1063
            A+++T+L   E   W  ++IS N   +S    L+   L   +   KRD SSS  +L++G 
Sbjct: 1005 AWNNTALSIYEDNVWTVERIS-NINSSSVVDNLNYVTLA--SALSKRDTSSSDAILVSGQ 1061

Query: 1064 LQHAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQGTFX 1123
            L    +G I A  YD   W P+L  N  + SS     + F++RD+S F + +  L     
Sbjct: 1062 LYDNSYGHIQAMVYDFSSWVPYLLINSESDSS----INAFIDRDMSSFTNTQVALLTNSG 1117

Query: 1124 XXXXXXXXXXXXXXXXXXXXLQRK--KKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYF 1181
                                +  K  K+KIDRGF+VL+                 I +Y 
Sbjct: 1118 TVSNSSSSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYV 1177

Query: 1182 FGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214
            F D    Y+   PR DENEMI+TVPPEKLM++I
Sbjct: 1178 FRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  535 bits (1378), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 366/1214 (30%), Positives = 601/1214 (49%), Gaps = 56/1214 (4%)

Query: 20   GSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNPE 79
             S+L+ +   L      +P  D+   KNN+ Q+L +   I+  +Y GQ+NFT + +    
Sbjct: 18   ASNLENVRRILNATEVTVPTFDVGN-KNNQFQILDDINGISFYEYLGQQNFTTDANVTDV 76

Query: 80   NALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGAGSISGHQLSRQLLFNLSS 139
              LIYYSNETF+ +              I+P  DD+FILSG G I+   L+ QL+FN++ 
Sbjct: 77   QRLIYYSNETFMSL--SDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMTD 134

Query: 140  LEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGGF 199
            L   +IF   L  +  +T +G  V+F G+F +  +   I    +WDS    + +LPF GF
Sbjct: 135  LSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNTGAI----MWDSRDRSINLLPFHGF 190

Query: 200  GKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLXXXXXXXXXXXXXPEL--GHQISLQSAA 257
            G  + +            FAG+FS V N+  L               L     + LQ + 
Sbjct: 191  GPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNPSVPLQYSQ 250

Query: 258  WVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLF 317
            W ++G LD S + CP      W    +T G F   +P +  PSK+R++N+ D D QVSLF
Sbjct: 251  WKTNGELDSSQLICPDPSKDSW-SVSATTGDFTCELPFQITPSKIRIYNSPDKDSQVSLF 309

Query: 318  RIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDISSKSYPGDQVQYFENRTT- 376
            R +T P+  IMNLTYLDP +G + SCDA+CPL S   L      +   + V    N +T 
Sbjct: 310  RFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTVAIINNNSTN 369

Query: 377  LQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQ 436
            +QW+ ++Q+FA V+ V  + L F AL SYG+++GLAG ++Y++++S + NN+ N PNC  
Sbjct: 370  IQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNSFNTPNCNN 429

Query: 437  GXXXXXXX-XXXXXXWDSGSSEGNYLSTSVQDSETN-PFVIFYPSIIYPGVYTIDVLTPG 494
                            ++ +S G YL+     +E   P V +   I + G Y+I+V TPG
Sbjct: 430  NDKDSNNTFTSSSLSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHSGEYSINVFTPG 489

Query: 495  CLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDG 554
            C  D++C TRGI+N T+ D   N +L +  IYQNND  K+DTLYSG L+S  ++T+ +  
Sbjct: 490  CSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLNSSCEITMTYYS 549

Query: 555  AINSGTEVPVMVASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSNTSSFLSELGSYSAT 614
             + +   V  +VA ++ +NI   D S     +   +NGL  Y  SN ++    +   + T
Sbjct: 550  GLYASNTVTTIVADRVDLNIISMDLSHRTEVSKLALNGLFQYQISNFTNDSIPM-KIANT 608

Query: 615  DLAHYSVSKLPKHSNIFANMFEDDLVLFT-TDGEMARLKLANNLSIEEYTFETIGKDIST 673
             L  ++++      ++ A    +  +L + T+G M  + L  +LS++  T     ++ +T
Sbjct: 609  SLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNSTRLISTENFTT 668

Query: 674  ISEYSGGLIIVGTFNGSSEPAARGFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKNII 733
               YS GL+++   +G    +    N    N T   S     +N+TL   E+L+F+   I
Sbjct: 669  FQPYSNGLVML---DGQGNVSLFKDNFKNLNTTMDGSLATDVANITLNGDELLVFNNGYI 725

Query: 734  LNGTTGEKIYDTSKL-TLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQ 792
             N T+ ++    S +  L V+SAG N  NDT+F G V+Q  Y   N S  ++ +  +  +
Sbjct: 726  YNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQYAIANQSAQVNADFNDGIE 785

Query: 793  NFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAMA 852
                    +P    F+++ +T Y +Y   N S  +    + +S ST  L  W G+   + 
Sbjct: 786  QMSLPSNTVPSRGIFLNDDSTGY-FYKESNKSKLY----ITNSNSTSGLE-WYGEPETVV 839

Query: 853  SSKNDSLLAIGGKDQHT-DSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVGG 911
              KND+LL +G  + +T  S L +TN +S + +     +   S++S+++FA+N+++LV G
Sbjct: 840  YDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENLNVGSSISSLLYFAKNDTLLVAG 899

Query: 912  SFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVS 971
             F  +N  CS LCL+NY+  +W    NNS+ G +  ++++ N  +L+ G+  L + + V+
Sbjct: 900  DFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQLYQNDTILVLGNLTLPQANDVN 959

Query: 972  LASICLKDSSSEILHEGNITLN-----GFVSMDGSSNNVVAFSDTSLLQLESGKWQQIST 1026
            +A + L ++     H G++ +         SM  S++ +VA++DT L   +   W ++S 
Sbjct: 960  MAFVNLSNN-----HVGSLIMKKDAPVNLHSMIVSNSRIVAWNDTVLFSFDGNSWTRVSV 1014

Query: 1027 NFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFL 1086
              T++S            + +    + +   LL+ G  +H++FG I +  Y+  +W P+L
Sbjct: 1015 PGTDSSATS-------ISSVQFISMEGTDDALLLLGEFRHSEFGDIKSIVYNFRDWIPYL 1067

Query: 1087 SSNQATSSSDLETSHVFLNRDLS-------DFLDYKGYLQGTFXXXXXXXXXXXXXXXXX 1139
                        T H+F+NRD+S         L+    L                     
Sbjct: 1068 LYVDGPRQG---TGHLFMNRDISLHNIAQIPLLNSTRVLTNQSFASSTSSSVSSTSTTLP 1124

Query: 1140 XXXXLQRK--KKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDS-GDGYQLSKPRT 1196
                   K  ++ +DRGF+VLI                 + +Y F D+ GD YQ   PR 
Sbjct: 1125 KVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRM 1184

Query: 1197 DENEMIDTVPPEKL 1210
            DEN M++T+PPEKL
Sbjct: 1185 DENAMVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  533 bits (1373), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 365/1166 (31%), Positives = 606/1166 (51%), Gaps = 85/1166 (7%)

Query: 5    TCLATSVLALAKF-CSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLL--GNFKDINI 61
            T L   +L++A      + L+ L+  L +E    P  +L  S N  +QLL    F  +N 
Sbjct: 7    TILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNF 66

Query: 62   LKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXXXXXXXXXHIVPFKDDAFILSGA 121
            + Y+GQ+NFT  +  + +N LIYYSN+T++ +             HI+P+  DAFILSG 
Sbjct: 67   VHYNGQQNFTQPIISSSQNHLIYYSNDTYIRL---LDIPYSTRIQHIIPYGQDAFILSGT 123

Query: 122  GSISGHQLSRQLLFNLSSLEFREIFGQDLA-QVNTITANGDK--VFFGGSFEYEMSNQTI 178
            GS++G +LS QL++NL+ L    IF   L  +V TI  + D   V+FGG+F Y + +  I
Sbjct: 124  GSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNI 183

Query: 179  -HSLLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFAGNFSAVDNTQQLX----- 232
             + L++WDS  +      FGGFG NS +            F+G F  +D+   L      
Sbjct: 184  SNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNI 243

Query: 233  -----XXXXXXXXXXXXPELGHQISLQSAAWVSDGT---LDKSAIKCPSTESTGWLKTGS 284
                              EL  +I L    + +  T   ++K+ + CP++E   W  + S
Sbjct: 244  TFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAW-ASDS 302

Query: 285  TQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCD 344
              G  ++ +P   RPSK+R+FN+ D D++V+ FRI     N IM+L YLDP  G+L  C 
Sbjct: 303  KAGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCS 362

Query: 345  AWCPLLSSQNLTDISSK-SYPGDQVQYFENRTT-LQWSESFQDFAFVNNVPVSDLTFIAL 402
             +CPL +   L   +S  +     +   +N TT ++WS ++Q+FAFVN   ++ L F AL
Sbjct: 363  EFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQAL 422

Query: 403  DSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXX------------ 450
             SYGS VGL+G+ L++S  +V+AN + N P+C                            
Sbjct: 423  SSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILS 482

Query: 451  ---WDSGSSEGNYLS-TSVQDSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGI 506
               W +     +YL+ T +  S+  P V FYP+++Y G YT+D++TPGC  D+SC +RGI
Sbjct: 483  DNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGI 542

Query: 507  INATIRDVQNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVMV 566
            +N T+ +  ++++L +  IYQ N+  KFD +++G+LD  VK+T+ F   + S T    +V
Sbjct: 543  VNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIV 602

Query: 567  ASKI--VVNIEDFDQSVFENNTSGF---INGLLHYSTSNTSSFLSELGSYSATDLAHYSV 621
            A +I  ++N  DF  +   N    +   +NGL  Y   N+ + L+E  +Y+ + +  Y+ 
Sbjct: 603  ADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNE--NYTNSTINQYAY 660

Query: 622  SKLPKHSNIFANMFEDDLVLFTTDGEMARL------KLANNLSIEEYTFETIGKDISTIS 675
            S  P + ++ A  ++ D +L    G + +L      K   N+S++  TF+ +   ++ I 
Sbjct: 661  SNYPANVSLIAAAYDKDTLL--VGGSINKLQEFQIEKNGQNISLQN-TFKDLNS-VTGIV 716

Query: 676  EYSGGLIIVGTFNGSS--EPAARGFNGTFFNLTEFNSTVRTFSNLTLGQT-EMLIFDKNI 732
             YS GLI  G    SS    A    N  F  L  F   +++FSN++L  + E+L F+   
Sbjct: 717  PYSDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKY 776

Query: 733  ILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQ 792
              N +  E   +TS   L + SAG+N  ND +F G V +N+  NL G   I+ N +    
Sbjct: 777  FYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKEL 836

Query: 793  NFWALGGKL-PYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGSTVQLSAWSGKVGAM 851
            N   LG  + PY A F+++S+T YAY  P+   N     +++ +G  +  S W  K+ +M
Sbjct: 837  N---LGNNIYPYSAVFLNDSSTIYAYMEPNTRLNR----LIHSNGEQISWS-WKNKISSM 888

Query: 852  ASSKNDSLLAIGG-KDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVG 910
            A   N+SLL++G   D+       + N +S + +A+   +    ++S+++F +N+SVLVG
Sbjct: 889  AFFPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVG 948

Query: 911  GSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGV 970
            G+F  ++ QCSGLCLFNY+ K WS F+NN++ G ++++E+ NNSN+LI+G+   N++  +
Sbjct: 949  GNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANI 1008

Query: 971  SLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQI-STNFT 1029
             LA + L   +  IL +         S + + N + A++ ++L Q  +  W QI   N T
Sbjct: 1009 DLALLNLNTYNVSILLQN----TNLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGT 1064

Query: 1030 ENSKFKGLDVFPLKDTT------RKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWT 1083
            E+ K   + +F + +        ++  RD++  +++ TG       G++ A +Y S  W 
Sbjct: 1065 ESLKLDSISIFDITNKNSSSILEKRALRDTN--IMVATGQFYSKGLGTVQALYYTSDTWI 1122

Query: 1084 PFLSSNQATSSSDLETSHVFLNRDLS 1109
            P+   N   +     + ++F N+D+S
Sbjct: 1123 PYFYGNLTNNMDTSNSINIFPNKDIS 1148

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 38/70 (54%)

Query: 1145 QRKKKKIDRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDGYQLSKPRTDENEMIDT 1204
            Q KK KI RGF+VLI                 + S+ F DS   Y+  KPRT E+EM D 
Sbjct: 1208 QNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDA 1267

Query: 1205 VPPEKLMRFI 1214
            VPPEKLM F+
Sbjct: 1268 VPPEKLMPFV 1277

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  496 bits (1278), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 358/1204 (29%), Positives = 590/1204 (49%), Gaps = 78/1204 (6%)

Query: 40   LDLSKSKNNEVQLLGNFKDINILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYXXXXX 99
            L+ S S+NNE+QLLG+ +  N   Y GQ+NFT   S   E  LIYYSN T L +      
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRL---DAV 58

Query: 100  XXXXXXXHIVPFKDDAFILSGAGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITAN 159
                   HI+PF DD FILSG G+ISG +LSRQ+L NL+ L ++ IF ++L  V +I  +
Sbjct: 59   PTDVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVD 118

Query: 160  GDKVFFGGSFEYEMSNQTIHSLLVWDSIKDGVEVLPFGGFGKNSTVXXXXXXXXXXXXFA 219
             + V+FGG   Y  +  +  S++ W+S  +   +LPFGGFG NSTV            F 
Sbjct: 119  NEVVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFT 178

Query: 220  GNFSAVDNTQQLXXXXXXX--XXXXXXPELGHQISLQSAAWVSDGTLDKSAIKCPSTEST 277
            G F+ ++N   +                E+G QISL+ A W ++  LD  A  CP+++  
Sbjct: 179  GQFAKLENNSFVSKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQ 238

Query: 278  GWLKTGSTQGQFELYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTT 337
             W   GS  G      P     SK+R++N   +D Q+SLFR++  P NGI+NLTYLDP +
Sbjct: 239  AWYSEGS-YGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPIS 297

Query: 338  GELASCDAWCPLLSSQNLTD-ISSKSYPGDQVQYFENRTT-LQWSESFQDFAFVNNVPVS 395
             ++  C   CPL + + L + + + +   D +++  N +T ++W+E +Q+FAFVN +P++
Sbjct: 298  HDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPIT 357

Query: 396  DLTFIALDSYGSSVGLAGIELYESAYSVYANNTLNAPNCAQGXXXXXXXXXXXXXWDSGS 455
             L F+A +SY  +VGL+G ++Y+ ++ ++ NN+ N PNC                W + +
Sbjct: 358  SLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVA 417

Query: 456  SEGNYLSTS-VQDSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDV 514
            ++ +YL+ S + +  T P + ++  I  PG Y ++++TPGC +D++C TRGI+N T  D 
Sbjct: 418  NDNSYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDN 477

Query: 515  QNNTLLDSIEIYQNNDYEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVM--------- 565
             N  +L S  IYQNN+  K+D +++G L++ + V +E+   IN+ T    +         
Sbjct: 478  SNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVR 537

Query: 566  --VASKIVVNIEDFDQSVFENNTSGFINGLLHYSTSN---TSSFLSELGSYSATDLAHYS 620
              ++S+ + +  D D+S+        +NG+  YS SN    + +L+  G    T L  + 
Sbjct: 538  VSISSEFISDQIDGDRSL-------HLNGIFEYSPSNFTFDNGYLT--GKIDYTILDDFG 588

Query: 621  VSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDISTISEYSGG 680
            VS   K ++IFA     +L L +T+G +  L   N  S+   T   +   I+ +     G
Sbjct: 589  VSNFNKGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPS-TENNLSGLINGMYSVEEG 647

Query: 681  LIIVGTF-NGSSEPAARGFNGTFFNL-TEFNSTVRTFSNLTLGQTEMLIFDKNIILNGTT 738
            L+I G+  +   E  A   N +   L    N +++   N TL  + +L+FD + I N T+
Sbjct: 648  LVIFGSIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTS 707

Query: 739  GEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQNFWALG 798
                 +TS   L++ +AG+N  +D L  G ++       N S  IS+N           G
Sbjct: 708  FMVFENTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSN-----------G 756

Query: 799  GKLPYDAAFVDNSTTAYAYYNPDNTS----NSFGVSVMNDSGSTVQLSAWSGKVGAMASS 854
               P+  +  DN T   A Y  D  +    +S  V+    S        W   V  +  S
Sbjct: 757  TYSPF--SLSDNDTIEGAIYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYS 814

Query: 855  KNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVGGSFR 914
                LL    ++    SQ+++ +  S + +      +   +N+I+ FA N + LVGG F 
Sbjct: 815  NGQQLLG-AIQENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFS 873

Query: 915  VNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVSLAS 974
            ++N  C GLCL+NY +  WS FLNNSI G I++++ FN++ +L++G   +N+T  ++L S
Sbjct: 874  LSNPACVGLCLYNYNNSNWSSFLNNSITGNISQIK-FNDTQMLLSGKLEVNKTADINLLS 932

Query: 975  ICLKDSSSEI-LHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQISTNFTE--N 1031
            I L  +  +I L+  ++ L+ F+ +    N VV ++ T +      +W  ++  F +  N
Sbjct: 933  INLTSNKQDILLYNNSVVLDDFILV---RNLVVGWNSTDIFIRNVTQWSNLNI-FDDGTN 988

Query: 1032 SKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFLSSNQA 1091
            +    ++ F             S+  L+I G     K+G+INA  YD   W P+   +  
Sbjct: 989  ATINRIENFGAD----------SNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVV 1038

Query: 1092 TSSSDLETSHVFLNRDLSDFLDYKGYLQGTFXXXXXXXXXXXXXXXXXXXXXLQRKKKKI 1151
            + ++   T   F +RD S + + +  +                            K  KI
Sbjct: 1039 SQTA---TPLFFADRDQSSYGNTRHVVPDHIIVSSSHSSSAPSSSSSHKT---NEKPYKI 1092

Query: 1152 DRGFIVLISXXXXXXXXXXXXXXXXIFSYFFGDSGDG-YQLSKPRTDENEMIDTVPPEKL 1210
             RGF+VLI                 + +  F  S +G Y + K    +N     + PEKL
Sbjct: 1093 RRGFVVLIGLALALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKL 1152

Query: 1211 MRFI 1214
            +R +
Sbjct: 1153 IRVL 1156

>Smik_4.540 Chr4 (971274..974507) [3234 bp, 1077 aa] {ON} YDR291W
            (REAL)
          Length = 1077

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 19/100 (19%)

Query: 1008 FSDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLL---ITGSL 1064
            +++T +    +G +QQ      EN      D+F LKDT+ + +   S++VL+   + G++
Sbjct: 92   YTETKIFDFNNGGFQQ-----KEN------DIFELKDTSDQNQGQKSTQVLIFEFVDGTM 140

Query: 1065 QHA-----KFGSINAAFYDSGEWTPFLSSNQATSSSDLET 1099
            Q +     KF  +    Y + E    +S  +A   S L T
Sbjct: 141  QRSWSASDKFSQVKMPIYTTDEMKKMISKREALFKSRLRT 180

>NCAS0F03050 Chr6 (607255..611625) [4371 bp, 1456 aa] {ON} Anc_5.383
          Length = 1456

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 81/176 (46%), Gaps = 13/176 (7%)

Query: 861  AIGGKDQHTDSQLLVTNSSSGESLASYKW----DSEISLNSIIFFARNNSVLVGGSFRVN 916
            AI    + T S+ L +N +  ++ A YK+      E ++ S+ FF   N++         
Sbjct: 1022 AISCLQKQTKSEELHSNFNFQDASAFYKYFNREKIEQAIESLEFFKYINTLRADTKPIYG 1081

Query: 917  NTQCSGLCLFNYQDKKWSPFLNNSIRGVINRM----EIFNNSNLLIAGSFRLNE---TDG 969
            +     L +++ +D+  S  L+N I  +  R     +I     ++  G+  L+    T G
Sbjct: 1082 SNLIKLLNIYDTKDETKSQLLDNFITPLQTRFLLGKDIIEKYAVITPGAVTLDMRYLTLG 1141

Query: 970  VSLASICLKDSSSEILHEGNITLNGFVSMDGSSNNVVAFSDTSLLQLESGKWQQIS 1025
            ++  S+  + + S ++ E +   N F  +   +   +AF D SLLQ + GK Q+++
Sbjct: 1142 LNDDSLLDQAAKSTLIQELHEVDNPFHQL--QTKLTIAFPDKSLLQYDCGKLQKLA 1195

>TBLA0I02990 Chr9 (710633..712255) [1623 bp, 540 aa] {ON} Anc_4.255
           YLR394W
          Length = 540

 Score = 32.3 bits (72), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 546 VKVTLEFDGAINSGTEVPVMVASKI-VVNIEDFDQSVFENNTSGFINGLLHYSTSNTSSF 604
           V V L  D  INS   +P      I   NI +  +  F+ N++ F+N    +S S TS+ 
Sbjct: 245 VTVDLTMDDDINSTRNIPKQQRRNIQTCNINETFREKFKKNSNKFLNSSNTHSASETSNH 304

Query: 605 LSELGSYSATDLAHYSV 621
               GS   TD  +Y +
Sbjct: 305 SIRSGSSRTTDSNNYRI 321

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
           4915 aa] {ON} complement(49973..58081,58083..64721)
           [14748 nt, 4916 aa]
          Length = 4915

 Score = 32.7 bits (73), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 64/134 (47%), Gaps = 18/134 (13%)

Query: 778 NGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMNDSGS 837
           N S+F+ +N E++S+N  ++ G L  +   + +     A   P+    +  ++ + +  +
Sbjct: 246 NHSYFLISN-EDLSENVVSVCGVLVSNTDSIPDDKNCEA---PNFVPTTKSITTLRELAT 301

Query: 838 TVQLSAWSGKVGAMASSK-------------NDSLLAIGGKDQHTDSQLLVTNSSSGESL 884
           +++ S     VG   S K              DS++ I   +Q TD++LL+   +SGE  
Sbjct: 302 SIRASKPVMLVGRTGSGKTFLVNELSKYAKCKDSIIKIHLGEQ-TDAKLLIGTYTSGEKP 360

Query: 885 ASYKWDSEISLNSI 898
            +++W + +  N++
Sbjct: 361 GTFEWRAGVLTNAV 374

>CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178w PRP4
           U4/U6 snRNP
          Length = 500

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 4/41 (9%)

Query: 846 GKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLAS 886
           GKVG +A + NDS+L  GG+D      + V+N S GE + S
Sbjct: 255 GKVGGIAWTSNDSVLITGGEDH----LITVSNRSDGEFITS 291

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,088,024
Number of extensions: 5678588
Number of successful extensions: 14222
Number of sequences better than 10.0: 71
Number of HSP's gapped: 14362
Number of HSP's successfully gapped: 78
Length of query: 1214
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1093
Effective length of database: 39,606,813
Effective search space: 43290246609
Effective search space used: 43290246609
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)