Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13816gna 1ON65565533950.0
Kwal_56.23599na 1ON64866316040.0
SAKL0H17182gna 1ON6856796962e-81
AGR094Wna 1ON1381344461e-51
Ecym_4314na 2ON9301524814e-50
KLLA0F18997gna 1ON4001403769e-39
AGR093Wna 2ON6131881601e-10
Kwal_23.55935.277ON350971526e-10
AER235C5.277ON324861509e-10
SAKL0G10912g5.277ON337861473e-09
Ecym_73645.277ON330861463e-09
KLTH0G06908g5.277ON3611561463e-09
NDAI0D015805.277ON299981382e-08
TDEL0E034905.277ON345871341e-07
NCAS0A066405.277ON2701371267e-07
KLLA0F21824g5.277ON2761101062e-04
KAFR0D050205.277ON257145890.023
Smik_12.1na 3ON32472770.82
Skud_12.4na 3ON32574742.3
Kwal_27.120448.543ON671308742.5
KNAG0L021405.702ON1608135743.2
KLLA0E02531g5.450ON47893706.8
Skud_12.1115.123ON88846717.0
Suva_10.1295.123ON88846707.7
YLR045C (STU2)5.123ON88846708.1
SAKL0C06446g1.216ON417362709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13816g
         (655 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...  1312   0.0  
Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...   622   0.0  
SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...   272   2e-81
AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No...   176   1e-51
Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   189   4e-50
KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]...   149   9e-39
AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; N...    66   1e-10
Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa] ...    63   6e-10
AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON} ...    62   9e-10
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    61   3e-09
Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON} ...    61   3e-09
KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conser...    61   3e-09
NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277      58   2e-08
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     56   1e-07
NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5....    53   7e-07
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    45   2e-04
KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277      39   0.023
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...    34   0.82 
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...    33   2.3  
Kwal_27.12044 s27 complement(1061635..1063650) [2016 bp, 671 aa]...    33   2.5  
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    33   3.2  
KLLA0E02531g Chr5 (229894..231330) [1437 bp, 478 aa] {ON} simila...    32   6.8  
Skud_12.111 Chr12 complement(219890..222556) [2667 bp, 888 aa] {...    32   7.0  
Suva_10.129 Chr10 complement(236449..239115) [2667 bp, 888 aa] {...    32   7.7  
YLR045C Chr12 complement(235037..237703) [2667 bp, 888 aa] {ON} ...    32   8.1  
SAKL0C06446g Chr3 (592873..605394) [12522 bp, 4173 aa] {ON} simi...    32   9.9  

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score = 1312 bits (3395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/655 (97%), Positives = 637/655 (97%)

Query: 1   MEEEPQTRRAAQRASPLVGALERGYTTSGAEGHPVTDPSGAPSGQSLSDSPGTRRSSQAA 60
           MEEEPQTRRAAQRASPLVGALERGYTTSGAEGHPVTDPSGAPSGQSLSDSPGTRRSSQAA
Sbjct: 1   MEEEPQTRRAAQRASPLVGALERGYTTSGAEGHPVTDPSGAPSGQSLSDSPGTRRSSQAA 60

Query: 61  ELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQSLVSVECIFKTLAN 120
           ELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQSLVSVECIFKTLAN
Sbjct: 61  ELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQSLVSVECIFKTLAN 120

Query: 121 YPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAAT 180
           YPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAAT
Sbjct: 121 YPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAAT 180

Query: 181 LYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDDSQLEVLISSVTKGDFR 240
           LYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDDSQLEVLISSVTKGDFR
Sbjct: 181 LYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDDSQLEVLISSVTKGDFR 240

Query: 241 IGASAPPQPEPTNAGMFEGSALSHAGQSXXXXXXXXXXXXXXXXXXFYGAAQQPPFGGLV 300
           IGASAPPQPEPTNAGMFEGSALSHAGQS                  FYGAAQQPPFGGLV
Sbjct: 241 IGASAPPQPEPTNAGMFEGSALSHAGQSPNPPAPFPVTQQPPQQAAFYGAAQQPPFGGLV 300

Query: 301 PMPQDPYAPLFSGHGNDNFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSL 360
           PMPQDPYAPLFSGHGNDNFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSL
Sbjct: 301 PMPQDPYAPLFSGHGNDNFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSL 360

Query: 361 NDLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNAIDTSDIAASVQ 420
           NDLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNAIDTSDIAASVQ
Sbjct: 361 NDLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNAIDTSDIAASVQ 420

Query: 421 KLDTDLCNSSATQTRSLISNYENMVPYGAAPGYIPDAELKSLERLKQEDALVSLSGTGGS 480
           KLDTDLCNSSATQTRSLISNYENMVPYGAAPGYIPDAELKSLERLKQEDALVSLSGTGGS
Sbjct: 421 KLDTDLCNSSATQTRSLISNYENMVPYGAAPGYIPDAELKSLERLKQEDALVSLSGTGGS 480

Query: 481 IVTPSSGIFLTTAELQSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLA 540
           IVTPSSGIFLTTAELQSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLA
Sbjct: 481 IVTPSSGIFLTTAELQSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLA 540

Query: 541 IVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERIS 600
           IVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERIS
Sbjct: 541 IVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERIS 600

Query: 601 QLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRYKPDLKDTALSDVE 655
           QLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRYKPDLKDTALSDVE
Sbjct: 601 QLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRYKPDLKDTALSDVE 655

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/663 (50%), Positives = 435/663 (65%), Gaps = 23/663 (3%)

Query: 1   MEEEPQTRRAAQRASPLVGALE---RGYTTSGAEGHPVTDPSGAPSGQSLSDSPGTRRSS 57
           MEE+ Q ++  Q  SPL   LE    G  +   E    T+  G P    L+     R+ +
Sbjct: 1   MEEDVQAKKIVQHISPLPMELEPDNEGLQSVVEEAARQTE--GGP----LAVPSSMRQHN 54

Query: 58  QAAELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQSLVSVECIFKT 117
           QA      V+STL +LQDVLWN+LVH R HGT ++ Y +AK R E HY S++SVECIFK 
Sbjct: 55  QA----QHVESTLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRCEGHYPSILSVECIFKV 110

Query: 118 LANYPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYN 177
           L +YPAE+LSA+Y+P+ILRFFKW  SV+Q   E K SR +ITTK+G+ FL+ N  E SYN
Sbjct: 111 LMDYPAELLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAFLVANFHEFSYN 170

Query: 178 AATLYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDDSQLEVLISSVTKG 237
           AATLYQA ++LKLLQSLE+AL PQKP L  D EDEEA DP W PL+  QLE LI S+TK 
Sbjct: 171 AATLYQASQSLKLLQSLEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQLESLIKSLTKD 230

Query: 238 DFRIG--ASAPPQPEPTNAGMFEGSALSHAGQSXXXXXXXXXXXXXXXXXXFYGAAQQPP 295
              +    SAP  PE   A + E    +   QS                   YG  Q P 
Sbjct: 231 ASTLPQVESAPVLPEIAPASISEFLPFTRPSQSPPMNMSYVTALQHQPT--VYGVQQVPI 288

Query: 296 FGGLVPMPQDPYAPLFSGHGNDNFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDS 355
                 +P +P+  L SGH N++  +Q+ + LFS T P+IFHR+NALE AN+ L+++ND+
Sbjct: 289 PSAFSDLP-EPFTTLPSGHSNESLSHQSSDKLFSQTFPNIFHRINALEVANERLTQDNDA 347

Query: 356 LSQSLNDLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNAIDTSDI 415
           L + +  LKS+LQ+ +++V+      Q +TSP+  H+ +PS    N+++ SS  ++TSD+
Sbjct: 348 LFKDMEKLKSQLQNLEKSVENTSLQRQNVTSPKVVHTGFPSSASANVVVPSSYPMETSDL 407

Query: 416 AASVQKLDTDLCNSSATQTRSLISNYENMVPYGAAPG---YIPDAELKSLERLKQEDALV 472
           A S  KL+ DL +    Q + L + YE+++P+   PG   +IPD  L+   +    + + 
Sbjct: 408 AISGVKLEGDLSSQPVNQAQQLATGYESLMPFN--PGTSEFIPDTRLRGAGQFIHGETMS 465

Query: 473 SLSGTGGSIVTPSSGIFLTTAELQSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYL 532
           ++S  G SI + S    L T++  SPAK+PK  +   EGAKL+KGETY PPQAP+GK YL
Sbjct: 466 TISSRGDSIASTSPVGLLATSDFHSPAKKPKPVSYNYEGAKLTKGETYHPPQAPDGKRYL 525

Query: 533 LDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAF 592
           LD EG+LAIVMA  QSSVYGVYNEYYQSLRPQVD+YA+D+GKKS+GHFRKKRTFQKKKAF
Sbjct: 526 LDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGHFRKKRTFQKKKAF 585

Query: 593 VQWVERISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRYKPDLKDTALS 652
           VQWVER+S LN +PPELVLD++D+VR++EKKSVVWACNNLG  R  L  Y P+LKD  LS
Sbjct: 586 VQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTALGHYNPELKDRGLS 645

Query: 653 DVE 655
           DVE
Sbjct: 646 DVE 648

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score =  272 bits (696), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 218/679 (32%), Positives = 336/679 (49%), Gaps = 84/679 (12%)

Query: 41  APSGQSLSDSPGTRRSSQAAELTNSVDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRR 100
           +PS   + +      S ++      VDS L LL+D+L +VL  IR        Y+ A+ +
Sbjct: 27  SPSSMGMRNGHAETSSEESNNGDGQVDSALWLLRDILQSVLTKIRNQKNLYQFYTTAREQ 86

Query: 101 YEAHYQS--LVSVE--CIFKTLANYPAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRF 156
             ++ QS   VSV+   IFK L  YP E+LSA+YIPV +RF  W ++  ++P +    R 
Sbjct: 87  CLSYSQSPGHVSVDPDSIFKNLMAYPTEVLSAIYIPVTIRFLDWANATHRIPAQCTSGRG 146

Query: 157 LITTKKGITFLMTNLSECSYNAATLYQAFRALKLLQSLEIALFPQKPALYHDPEDEEADD 216
           ++T+K+ + FL  + +  S+ + T  +    LKLLQ L++ +FP+KP  Y+DP D++A +
Sbjct: 147 IVTSKRCLGFLKDDSNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYNDPGDDQALN 206

Query: 217 PNWKPLDDSQLEVLISSVTKGDFRIGASAPPQPEPTNAGMFEGSALSHAGQSXXXXXXXX 276
             W+PL+  ++   + S++    R      P    +   M   S++S  G          
Sbjct: 207 SVWQPLESREVYEFLESLSS--HRNELEMSPTSPSSTTSMNPRSSISRRGNLYPQLAPSP 264

Query: 277 XXXXXXXXXXFYGAAQQPPFGGLVPMPQDPYAPLFSGHGND--NFMYQNPEM-------- 326
                        A   PP    VPMP   + PL      D  +    NP +        
Sbjct: 265 H------------ATSLPPN---VPMPSLAFEPLHPSSITDQRDADLLNPHVTFPSQQTL 309

Query: 327 -----------LFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKS---ELQSFKR 372
                      +F+  IP +  R++ L   N+ L  +N  L Q+++ L+S   +LQ+F  
Sbjct: 310 TNSDLDMKLAPIFNQIIPDMEQRLHYLALENKSLREQNMVLLQNVSSLESQIAQLQNFVS 369

Query: 373 NVDTAIPGVQILT----SPRATHSRY----PSPTPPNIILSSSNAIDTSDIAASVQK--- 421
            V +   G   L+     PR    +        T P  + ++ N    + I   V K   
Sbjct: 370 VVVSKPTGATSLSLQPQEPRQARKKIGKVKQQRTSPTQMSATPNQAPLAQIDQIVPKQPP 429

Query: 422 -LDTDLCNSSATQ----TRSLISNYENMVPYGAAPGYIPDAEL----KSLERLKQE---- 468
            L+T   N    Q    T   +S Y+ M+ +   P  +  +EL      L    QE    
Sbjct: 430 TLNTASSNLHNLQFSNSTDHRMSEYDTML-HSYDPLMVRSSELGRSSNGLTNSTQEPTFE 488

Query: 469 ----DALVSLSGTGGSIV---TPSSGIFLTTAELQ-----SPAKRPKHRNRRIEGAKLSK 516
               + L+   G    +    TP   +  T  + Q     S   RPK+++    G++LSK
Sbjct: 489 LHSANPLIIQEGQSRILSYQNTPDPQLRSTLQQQQLRYTESKKARPKYKD--TPGSQLSK 546

Query: 517 GETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKS 576
           G+TY PP +  GKNYL+D +GRLAIVM+ +Q S+Y +YNE+YQSL+PQV+S+  DFGK  
Sbjct: 547 GKTYHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSR 606

Query: 577 MGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFR 636
           +  F+KKRTFQKKKAFV   E+I+ + NMP E VL I+D++R +E+KSVVWACNNL   +
Sbjct: 607 LVQFKKKRTFQKKKAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNNLNLLK 666

Query: 637 LVLNRYKPDLKDTALSDVE 655
            +L +++PDL+DT  SD E
Sbjct: 667 DMLVKHRPDLRDTVFSDTE 685

>AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No
           homolog in Saccharomyces cerevisiae
          Length = 138

 Score =  176 bits (446), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 77/134 (57%), Positives = 101/134 (75%)

Query: 520 YQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGH 579
           YQPP   +GKNYL+D+EG+ +I+M+ +Q S+Y +YNE+YQSL+ QV+++  DFGK  +  
Sbjct: 3   YQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVQ 62

Query: 580 FRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVL 639
           FRKKRTFQKKKAFV  VE+I+    + PE VLDI D VRLKE+KSVVW CNNLG  +  L
Sbjct: 63  FRKKRTFQKKKAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCAL 122

Query: 640 NRYKPDLKDTALSD 653
            +Y+PDL D  +SD
Sbjct: 123 VKYRPDLHDIIMSD 136

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  189 bits (481), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 111/152 (73%)

Query: 500 KRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQ 559
           K+ + R +   G+KLSKG  YQPP    GK Y+L  +G+ +IVM+++Q S+Y +YNE+YQ
Sbjct: 775 KKLRSRYKESSGSKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQ 834

Query: 560 SLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRL 619
           SL+ QVDS+  D+GK  +  FRKKRTFQKKKAFV  VE+IS  + +PPE VLDIVD+VR+
Sbjct: 835 SLKLQVDSFVQDYGKSKLTQFRKKRTFQKKKAFVYLVEKISYFSKLPPEQVLDIVDDVRI 894

Query: 620 KEKKSVVWACNNLGRFRLVLNRYKPDLKDTAL 651
           KE KSVVW CNNLG  +  L +Y+P LKD  +
Sbjct: 895 KEGKSVVWVCNNLGSLKYALVKYRPKLKDIIM 926

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 82/152 (53%), Gaps = 5/152 (3%)

Query: 76  VLWNVLVHIRGHGTFESCYSLAKRRYEAHYQS----LVSVECIFKTLANYPAEILSAMYI 131
           +L N+L+ IR H      Y++ K +  ++ Q      + V+ +FK L +   E+L+ + +
Sbjct: 18  MLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPELLNLVSL 77

Query: 132 PVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAATLYQAFRALKLL 191
           P +LRF +W      +  + K +R +IT  + + FL  ++    +++ T      ALKLL
Sbjct: 78  PAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGILGALKLL 137

Query: 192 QSLEIALFPQKPALYHDPEDEEADDPNWKPLD 223
           Q L++ +F +KP L +D  D +++   WKPLD
Sbjct: 138 QKLQMIMFAEKPML-NDTNDPDSESVVWKPLD 168

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 61/131 (46%), Gaps = 4/131 (3%)

Query: 318 NFMYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKSELQSFKRNVDTA 377
           N+ Y +   LF   IP I  R++ L   N +L +++  L Q +N+L+  + S ++ V + 
Sbjct: 505 NYFY-DSVALFQQGIPEINQRLHHLTVQNNKLKQQDTILMQQINNLRQIVTSLQKTVTSI 563

Query: 378 IPGVQILTSPRATHSRYPSPTPP--NIILSSSNAIDTSDIAASVQKLDTDLCNSSATQ-T 434
                + T  + T  +  + T P  +     SN    + ++  +   +T++ N+   +  
Sbjct: 564 SLTNSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTSVSGHMNYSETNVSNTGDQELV 623

Query: 435 RSLISNYENMV 445
             L+ +YE+ +
Sbjct: 624 NPLLESYESFI 634

>KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]
           {ON} some similarities with uniprot|Q74ZV5 Ashbya
           gossypii AGR094W AGR094Wp
          Length = 400

 Score =  149 bits (376), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 97/140 (69%)

Query: 507 RRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVD 566
           ++I  A +SKG+ ++PP + +GKNYL+ ++G L+IVM  +  SVY +YNE+ QSL+PQ+D
Sbjct: 259 KKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQID 318

Query: 567 SYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRLKEKKSVV 626
           S+  D G+  +  F+KKRTFQK+KAF  +VE I    +   E +LDI+D +R +   SV+
Sbjct: 319 SFVQDHGRSKLAKFQKKRTFQKRKAFCSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVI 378

Query: 627 WACNNLGRFRLVLNRYKPDL 646
           W CNNL + ++ L + +PDL
Sbjct: 379 WVCNNLNQLKMDLLKQRPDL 398

>AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; No
           homolog in Saccharomyces cerevisiae
          Length = 613

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 91/188 (48%), Gaps = 11/188 (5%)

Query: 66  VDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQSL----VSVECIFKTLANY 121
           ++  L ++Q ++ ++LV +R        Y+  K +  +  Q      + V+ +F+ L   
Sbjct: 16  IEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPGGGIDVDSMFELLMMR 75

Query: 122 PAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAATL 181
             E+L  + +P ++RFF+W      +  E   +R +IT  +   FL  ++   ++ A  +
Sbjct: 76  TPELLGLVSLPAMVRFFEWAQRTETIAAE--TTRAVITPTRCYNFLKEDVGTFAHGAEVV 133

Query: 182 YQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDDSQ----LEVLISSVTKG 237
              F AL+LLQ L++ +F +KP L HD  D ++  P WKPLD       L  L+     G
Sbjct: 134 GGVFEALQLLQQLQMIVFREKPML-HDRNDPDSASPMWKPLDSPTTLQLLHSLVHDSATG 192

Query: 238 DFRIGASA 245
             ++G  A
Sbjct: 193 SGKLGGLA 200

>Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa]
           {ON} [contig 11] FULL
          Length = 350

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 53/97 (54%)

Query: 539 LAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVER 598
             + M+ + ++V+ +Y+E+  SL PQ+  Y   +GK       + RTFQ+++A V  +++
Sbjct: 249 FTLQMSNQPTTVFALYSEFETSLGPQMLEYEKRYGKGQSSRLPRIRTFQRRRALVSEIDK 308

Query: 599 ISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRF 635
            S+    P E  +   + +R + ++SV W  NNL R 
Sbjct: 309 FSRRTGRPIEEAIAYFELIRTRNRRSVAWLYNNLTRI 345

>AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON}
           NOHBY524; No homolog in Saccharomyces cerevisiae'
          Length = 324

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (56%)

Query: 550 VYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPEL 609
           V  +Y E+  SL+ Q+  +   +GK  +    K RT+Q+++A V  ++R ++  N   E 
Sbjct: 232 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 291

Query: 610 VLDIVDEVRLKEKKSVVWACNNLGRF 635
            +   D++R+++ K+V W  NNLG+ 
Sbjct: 292 AIQFFDDIRMEKNKTVAWLYNNLGKI 317

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 49/86 (56%)

Query: 549 SVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPE 608
           SV  +Y+E+  SL+ Q+  +   FGK  +    K RT+Q+++A V  +++ ++  N   E
Sbjct: 245 SVAELYDEFDNSLKLQILEFEKKFGKGQLSRIPKIRTYQRRRALVSEIDKYARFTNKSTE 304

Query: 609 LVLDIVDEVRLKEKKSVVWACNNLGR 634
             +   + +R ++ K+V W  NNLGR
Sbjct: 305 DAIHFFENIRNEKNKTVAWLYNNLGR 330

>Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AER235C
          Length = 330

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (55%)

Query: 550 VYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPEL 609
           V  +Y E+  SL+ Q+  +   +GK  +    K RT+Q+++A V  ++R ++  N   E 
Sbjct: 238 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 297

Query: 610 VLDIVDEVRLKEKKSVVWACNNLGRF 635
            +   D +R+++ K+V W  NNLG+ 
Sbjct: 298 AIQFFDTIRVEKNKTVAWLYNNLGKI 323

>KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conserved
           hypothetical protein
          Length = 361

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 76/156 (48%), Gaps = 14/156 (8%)

Query: 495 LQSPAKRPKHRN------RRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIV--MATE 546
           +++P+K P+ +       + +  + L  G+T   P +     Y  D +   A V  M+  
Sbjct: 211 VETPSKNPREKTHGKLQMKPLNSSLLKSGQT---PCSSRHLRYAKDAKDISAYVLKMSGN 267

Query: 547 QSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMP 606
             +V  +Y EY   LRPQ+  +   +GK  +    K RT+Q+++A +  +E+ ++     
Sbjct: 268 PKTVGDMYYEYEHQLRPQILEFEKRYGKGQISRLPKVRTYQRRRALINEIEKFARREGKS 327

Query: 607 PELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRY 642
            E  +   +E+R + KK+V W  NNL R   +L +Y
Sbjct: 328 IEEAVQYFEEIRTQNKKTVPWLYNNLNR---ILQKY 360

>NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277
          Length = 299

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 52/98 (53%)

Query: 538 RLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVE 597
           ++ + MA + +S+  ++ EY   L P+V      +GKK +      RT Q++KA V  ++
Sbjct: 193 KIQLAMAVKPNSITELFYEYENVLTPKVKDIQKKYGKKCLKQITNIRTLQRRKALVSEIK 252

Query: 598 RISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRF 635
           + ++ N    +  L++ + +RLK  +SV W  NN+   
Sbjct: 253 KFAKQNRKSIKETLEVAEYIRLKNNRSVPWLYNNISHL 290

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 50/87 (57%)

Query: 549 SVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPE 608
           SV  VY+EY  SL+ Q++ +   FGK  +    K RT+Q+++A V  +++ +   N    
Sbjct: 247 SVAEVYHEYENSLKSQIEEFERLFGKGQLSKLPKIRTYQRRRALVTEIDKYATSYNKTTH 306

Query: 609 LVLDIVDEVRLKEKKSVVWACNNLGRF 635
             ++  ++VR+ +K++V    NNLG+ 
Sbjct: 307 EAIEFFEKVRIAKKRTVPGLYNNLGKI 333

>NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5.277
          Length = 270

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 7/137 (5%)

Query: 495 LQSPAKRPKHRNRRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVY 554
           +Q+   +  H  R  E  + SK   +Q       KN   D   ++ I +    S++  + 
Sbjct: 128 VQTRPTKNFHGVRHTENNRRSKKYAFQ-------KNIACDQRDKIVIDLVEYPSTIKDLV 180

Query: 555 NEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIV 614
            ++   + PQ+       GKK++ +  K RT Q++K+ V+ +  IS L N+  E V++I 
Sbjct: 181 VDFETVVFPQLKYLQRSMGKKALRNIAKLRTVQRRKSLVRAIHDISTLYNLSLEEVINIF 240

Query: 615 DEVRLKEKKSVVWACNN 631
           + +R    KSV W  NN
Sbjct: 241 ETIRENGGKSVAWMYNN 257

>KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa]
           {ON} conserved hypothetical protein
          Length = 276

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 533 LDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKKRTFQKKKAF 592
           L+N     ++M     SV+ +Y+E+Y   + Q+  + +  G   +    K RT+Q++ A 
Sbjct: 166 LNNVENYHLIMTDCPKSVHDLYHEFYTDTKLQILHFEEKHGAGQLSKLPKLRTYQRRSAL 225

Query: 593 VQWVERISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVLNRY 642
           V  + + ++  N+  E  ++    +  +  K++ W  NNL +   +L +Y
Sbjct: 226 VNAINKYAKGKNITVEQSIEHFQGIVEENDKTIPWLYNNLAK---ILEQY 272

>KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277
          Length = 257

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/145 (20%), Positives = 70/145 (48%), Gaps = 29/145 (20%)

Query: 495 LQSPAKRPKHRNRRIEGAKLSK----GETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSV 550
           + + + R + R++ ++  K++     G+T++ P   N K                   +V
Sbjct: 113 IDTDSNRIETRDKLVKKQKVNCTKAFGDTFEIPMIENPK-------------------TV 153

Query: 551 YGVYNEYYQSLRPQVDSYADDFGKKSMGHFRKK---RTFQKKKAFVQWVERISQLNNMPP 607
           + +Y ++   ++  V    + +GK    +FRK    R++Q+++A V  ++++S+  ++  
Sbjct: 154 HELYYDFQNCVKETVRELKEKYGK---SYFRKATNIRSYQRRRALVSEIQKLSEEYDIDI 210

Query: 608 ELVLDIVDEVRLKEKKSVVWACNNL 632
           E  L   +E+R +  K+V W  +NL
Sbjct: 211 EEALQCFEELRKENYKTVPWLYSNL 235

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 531 YLLDNEGRLAIVMATEQSSVYGVYNE---YYQSLRPQVDSYADDFGKKSMGHFRKKRTFQ 587
           YL+ + G  A  +++E +  YG + E   YY+  RPQ+D++ ++     +G F     F 
Sbjct: 120 YLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIG-FETIPNFH 178

Query: 588 KKKAFVQWVERI 599
           + KA + W E I
Sbjct: 179 ELKAILSWGEDI 190

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 529 KNYLLDNEGRLAIVMATEQSSVYGVYNE---YYQSLRPQVDSYADDFGKKSMGHFRKKRT 585
           + YL+ + G  A  +++E +  YG + E   YY   +PQ+DS+ ++     +G F     
Sbjct: 118 ERYLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIG-FETVPN 176

Query: 586 FQKKKAFVQWVERI 599
           F + KA + W E I
Sbjct: 177 FHELKAILSWGEDI 190

>Kwal_27.12044 s27 complement(1061635..1063650) [2016 bp, 671 aa]
           {ON} YPL075W (GCR1) - trans-acting positive regulator of
           the enolase and glyceraldehyde-3-phosphate dehydrogenase
           gene families [contig 24] FULL
          Length = 671

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 123/308 (39%), Gaps = 56/308 (18%)

Query: 335 IFHRMNALEAANQELSR--------------ENDSLSQSLNDLKSELQSFKRNVDTAIPG 380
           I  R N  E ++Q LSR               N SLS  +  LKSEL S K+ V      
Sbjct: 290 ITSRTNKSEWSDQVLSRVEESYIELSKRFALHNQSLSDEVRSLKSELGSTKQLV------ 343

Query: 381 VQILTSPRATHSRYPSPTPPNIILSSSNA-IDTSDIAASVQKLDTDLCNSSATQTRSL-- 437
            +IL   R   S   S    +   S++NA + + D       L  +L +SS  Q +S   
Sbjct: 344 AEILNYQRQMASYSISNGALSANGSNNNAPVGSIDKGVLSSNLFNNLVHSSEDQPQSTPS 403

Query: 438 ---ISNYENM------------VPYGAAPGYIPDAELKSLERLKQEDALV------SLSG 476
              I+ + ++            +P   + G+ P      L+R K +D  +      S+S 
Sbjct: 404 LAPINMFHSLSSSAVPETQKRELPLPNSSGFSPAPIGSPLKRFKFDDPKLNQQRQNSMSA 463

Query: 477 TGGSIVTPSSGIFLTTAELQSPAKRPKHRNRRIEGAKL-SKGETYQPPQ-APNGKNYLLD 534
           T  S+++ ++G    T    +      H + R E +   SK    +PP  +P+G      
Sbjct: 464 TLDSLLSKATGSPRLTMPPMNSGPISSHLSPRFEPSDANSKLILKKPPNSSPSG------ 517

Query: 535 NEGR--LAIVMATEQSSVYGVYNEYYQSL--RPQVDSYADDFGKKSMGHFRKKRTFQKKK 590
           N G       ++ E  +++ +Y E+Y  L  +P + S  D FG +          F  ++
Sbjct: 518 NGGHEVFKYKLSRENKTIWDLYTEWYIGLNNQPSIKSLIDAFGWRRWKVSEDSHFFPTRR 577

Query: 591 AFVQWVER 598
             + ++ER
Sbjct: 578 IIIDYIER 585

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1608

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 19/135 (14%)

Query: 297 GGLVPM---PQDPYAPLFSGHGND--NFMYQNPEML--FSHTIPSIFHRMNALEAANQEL 349
           GG  P    P D +A   S H  +  N+  Q  E+L       PSI H    L      L
Sbjct: 239 GGETPAHAEPNDQFAKQSSQHEEEISNYKEQVEELLGILGQGAPSIAHLRKLL------L 292

Query: 350 SRENDSLSQSLNDLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNA 409
               +++S     LK +++SF   ++  +PG+QIL        +        +I  S   
Sbjct: 293 KERKENVS-----LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAK 347

Query: 410 IDTS-DIAASVQKLD 423
           I T  ++++S QK+D
Sbjct: 348 IRTQRELSSSRQKVD 362

>KLLA0E02531g Chr5 (229894..231330) [1437 bp, 478 aa] {ON} similar
           to uniprot|P48360 Saccharomyces cerevisiae YDR376W ARH1
           Oxidoreductase of the mitochondrial inner membrane
           involved in cytoplasmic and mitochondrial iron
           homeostasis and required for activity of Fe-S cluster-
           containing enzymes one of the few mitochondrial proteins
           essential for viability
          Length = 478

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 9/93 (9%)

Query: 362 DLKSELQSFKRNVDTAIPGVQILTSPRATHSRYPSPTPPNIILSSSNAIDTSDIAASVQK 421
           ++K +++SF+R VD     V+      A + + P PT  N I + +  +D       + K
Sbjct: 249 EMKEQVRSFRRCVDLCSEYVKPFELRSAKYKKLPQPT--NGIFTKNWELDYLKTPLEILK 306

Query: 422 LDT-------DLCNSSATQTRSLISNYENMVPY 447
            +T        LCN++ T+   +I + E  + Y
Sbjct: 307 DETTGYIKSLKLCNNTLTKANKVIPHEEETMSY 339

>Skud_12.111 Chr12 complement(219890..222556) [2667 bp, 888 aa] {ON}
           YLR045C (REAL)
          Length = 888

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 322 QNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKSEL 367
           QN EM+++    S+  +MN+ E    E+ +EN+ L + L + +S+L
Sbjct: 672 QNDEMIWTKERQSLLEKMNSSENYKIEMIKENEMLREQLKEAQSKL 717

>Suva_10.129 Chr10 complement(236449..239115) [2667 bp, 888 aa] {ON}
           YLR045C (REAL)
          Length = 888

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 322 QNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKSEL 367
           QN EM+++    S+  +MN  E    E+ +EN+ L + L + +S+L
Sbjct: 672 QNDEMIWTKERQSLLEKMNNTENYKIEMIKENEMLREQLKEAQSKL 717

>YLR045C Chr12 complement(235037..237703) [2667 bp, 888 aa] {ON}
           STU2Microtubule-associated protein (MAP) of the
           XMAP215/Dis1 family; regulates microtubule dynamics
           during spindle orientation and metaphase chromosome
           alignment; interacts with spindle pole body component
           Spc72p
          Length = 888

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 322 QNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKSEL 367
           QN EM+++    S+  +MN  E    E+ +EN+ L + L + +S+L
Sbjct: 672 QNDEMIWTKERQSLLEKMNNTENYKIEMIKENEMLREQLKEAQSKL 717

>SAKL0C06446g Chr3 (592873..605394) [12522 bp, 4173 aa] {ON} similar
           to uniprot|P36022 Saccharomyces cerevisiae YKR054C DYN1
           Cytoplasmic heavy chain dynein microtubule motor protein
           required for anaphase spindle elongation involved in
           spindle assembly chromosome movement and spindle
           orientation during cell division targeted to microtubule
           tips by Pac1p
          Length = 4173

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 320 MYQNPEMLFSHTIPSIFHRMNALEAANQELSRENDSLSQSLNDLKSELQSFKRNVDTAIP 379
           M+++P  L  H+I  +  +   L+   +EL+   + LSQ+  D  S  +S +R V + + 
Sbjct: 811 MFESPLALLEHSIADLVDKYQELQPVERELADAFEGLSQTQLDAASLSESIER-VQSVVD 869

Query: 380 GV 381
           GV
Sbjct: 870 GV 871

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,001,833
Number of extensions: 3006004
Number of successful extensions: 9953
Number of sequences better than 10.0: 63
Number of HSP's gapped: 10282
Number of HSP's successfully gapped: 65
Length of query: 655
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 539
Effective length of database: 40,180,143
Effective search space: 21657097077
Effective search space used: 21657097077
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)