Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13794g8.257ON72570236730.0
Kwal_56.236078.257ON72570233650.0
SAKL0H17160g8.257ON73970427110.0
KLLA0F19041g8.257ON76375425320.0
TDEL0F038408.257ON72670525300.0
ZYRO0C01782g8.257ON73070024140.0
Suva_2.2698.257ON72570222540.0
YDR109C8.257ON71568822060.0
Smik_4.3558.257ON70469621730.0
Skud_4.3708.257ON71469921550.0
NDAI0J014008.257ON58853118720.0
Kpol_392.98.257ON59452318400.0
Ecym_43138.257ON59753117880.0
KAFR0B055608.257ON60552117800.0
NCAS0B038708.257ON59651817750.0
TBLA0E044008.257ON58953117640.0
KNAG0H032608.257ON58052016960.0
CAGL0B01727g8.257ON57752016830.0
AGR092W8.257ON59654016560.0
TPHA0B032408.257ON58551915890.0
Suva_14.931.111ON5435345346e-59
Skud_14.891.111ON5695305147e-56
Smik_14.861.111ON5435364837e-52
YNL249C (MPA43)1.111ON5425514829e-52
TDEL0C059001.111ON5435474601e-48
KLTH0F03080g1.111ON5335324361e-45
SAKL0C03432g1.111ON5475264274e-44
ZYRO0F16016g1.111ON5424664177e-43
KNAG0F006601.111ON5355284132e-42
Kwal_33.135301.111ON5345254132e-42
KLLA0C02937g1.111ON5164973184e-30
NCAS0A007801.111ON5495251734e-12
NCAS0C059004.9ON703122800.65
KLLA0E00595g4.9ON661158709.6
Kwal_47.175064.113ON92452709.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13794g
         (725 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...  1419   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...  1300   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...  1048   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   979   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   979   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   934   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   872   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   854   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   841   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   834   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   725   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   713   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   693   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   690   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    688   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   684   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   657   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   652   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   642   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   616   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   210   6e-59
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   202   7e-56
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   190   7e-52
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   190   9e-52
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   181   1e-48
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   172   1e-45
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   169   4e-44
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   165   7e-43
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   163   2e-42
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   163   2e-42
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   127   4e-30
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    71   4e-12
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    35   0.65 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    32   9.6  
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    32   9.9  

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score = 1419 bits (3673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/702 (97%), Positives = 683/702 (97%)

Query: 24  GLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQ 83
           GLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQ
Sbjct: 24  GLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQ 83

Query: 84  AVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMD 143
           AVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMD
Sbjct: 84  AVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMD 143

Query: 144 HRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTF 203
           HRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTF
Sbjct: 144 HRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTF 203

Query: 204 KASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSD 263
           KASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSD
Sbjct: 204 KASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSD 263

Query: 264 KGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKT 323
           KGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKT
Sbjct: 264 KGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKT 323

Query: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383
           DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG
Sbjct: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383

Query: 384 ALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDY 443
           ALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDY
Sbjct: 384 ALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDY 443

Query: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAI 503
           HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAI
Sbjct: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAI 503

Query: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSV 563
           FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSV
Sbjct: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSV 563

Query: 564 SRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPTPE 623
           SRKSSIAGEPANAGQPKKSAVSKFGQLGGDDL                   IGFPFPTPE
Sbjct: 564 SRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFPTPE 623

Query: 624 DAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683
           DAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK
Sbjct: 624 DAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683

Query: 684 VVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVRN 725
           VVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVRN
Sbjct: 684 VVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVRN 725

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score = 1300 bits (3365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/702 (88%), Positives = 646/702 (92%)

Query: 24  GLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQ 83
           GLSLEQQKMLYY+GVDVGTGSARACIIDSMGNILSLAERPIQREQLK NFITQSSQEIWQ
Sbjct: 24  GLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQ 83

Query: 84  AVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMD 143
           AVCHCVKSVVRDSGVP+EKIHGIGFDATCSLVVVEE +NKEVAVGPDF NT+QNIILWMD
Sbjct: 84  AVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMD 143

Query: 144 HRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTF 203
           HRAIEET+ INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLP NKF+ECKFFDLADYLTF
Sbjct: 144 HRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTF 203

Query: 204 KASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSD 263
           KASGKETRSFCSTVCKQGLLPVGVEGS EGWSREFLTEIGLE+ IEDDFR+IGGSVKNSD
Sbjct: 204 KASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSD 263

Query: 264 KGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKT 323
           KGKNFLSAGEF+GAID  VAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK 
Sbjct: 264 KGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKI 323

Query: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383
           DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG
Sbjct: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383

Query: 384 ALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDY 443
           ALLAHV+TTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQK+RSVVHLA+HLFFYGDY
Sbjct: 384 ALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDY 443

Query: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAI 503
           HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIV+KM TSGHD++AI
Sbjct: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAI 503

Query: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSV 563
           FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGT S LSV
Sbjct: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSV 563

Query: 564 SRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPTPE 623
           SRKSSIAG P +  QPKKSAVSK GQ G DDL                   +GFPFPTP+
Sbjct: 564 SRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTVGFPFPTPD 623

Query: 624 DAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683
           D YA+ E  E + D   S+ELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK
Sbjct: 624 DPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGK 683

Query: 684 VVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVRN 725
           VVQP  E+N DR LL+ KYKIFLDMAETQRKYR +V++  ++
Sbjct: 684 VVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score = 1048 bits (2711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/704 (73%), Positives = 584/704 (82%), Gaps = 11/704 (1%)

Query: 25  LSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQA 84
           LS+EQ KM YYVGVDVGTGSARACIID+MGNILSLAERPIQR++LK ++ITQSSQEIW A
Sbjct: 25  LSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLA 84

Query: 85  VCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDH 144
           +C+CVKSVV+DSGV  EKIHGIGFDATCSLVVVE+ ++KEVAVGPDF NT+QNIILWMDH
Sbjct: 85  ICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDH 144

Query: 145 RAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFK 204
           RAI+ET+ INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP  KF +CKFFDLADYLTFK
Sbjct: 145 RAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFK 204

Query: 205 ASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVK-NSD 263
           A+G ETRS+CSTVCKQGLLPVGVE S +GWS+EFLT IGLE+L +DDFR++GGS+K +  
Sbjct: 205 ATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGS 264

Query: 264 KGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKT 323
            G  FLSAGE IG++D + AEELGL  HCVVGSGVIDAYAGWVGTVAARTDV IP LV+ 
Sbjct: 265 GGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEA 324

Query: 324 DQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTG 383
           D EK G+D ATGRLAAVAGTSTCHIAMS+DPIFVDGVWGPYRD +A  FWCAEGGQSCTG
Sbjct: 325 DNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTG 384

Query: 384 ALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDY 443
           ALLAHVLT HPAYTELS L+DAASVSKFDYLNSRLE L QQ+ ARSVV LAKHLFFYGDY
Sbjct: 385 ALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDY 444

Query: 444 HGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAI 503
           HGNRSPIADPSMRAA+IGQSMDNSIDDLA+MYLGACEFIAQQTRQIV+KM  SGH ++AI
Sbjct: 445 HGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAI 504

Query: 504 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSV 563
           FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+L+    +LS 
Sbjct: 505 FMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSGSLSR 564

Query: 564 SRKSSIAGEPANAGQ----PKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXI-GFP 618
            RKSS++G+          PKK+ +SK G     DL                   + GFP
Sbjct: 565 RRKSSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTAPSATASTSQIASTVGGFP 624

Query: 619 FP-TPEDAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRS-SDNGDAMWNVMY 676
           FP T +D+ AI   +E++  E  +  L+F +     ++     K +S S  GDA+W+VMY
Sbjct: 625 FPVTSDDSVAI---IEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALWDVMY 681

Query: 677 NMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           NMTGGGKVVQP+++++ DRVLL+AKYKIFLDMAETQR+YR  VD
Sbjct: 682 NMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVD 725

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  979 bits (2532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/754 (66%), Positives = 567/754 (75%), Gaps = 73/754 (9%)

Query: 24  GLSLE-QQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIW 82
           GLSL+ ++KM+YYVGVDVGTGSARAC+ID++GNILSLAERPIQR +LK N+ITQSSQEIW
Sbjct: 25  GLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIW 84

Query: 83  QAVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWM 142
            A+C+CVK+VVRDSGV    IHGIGFDATCSLVVV+   N++V VGPDF++  QNIILWM
Sbjct: 85  NAICYCVKNVVRDSGVDPRTIHGIGFDATCSLVVVD-NNNEDVGVGPDFTDNLQNIILWM 143

Query: 143 DHRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLT 202
           DHRAIEET+ INATGDKCLKYVGGQMSVEMEIPKIKWLKN++PE KF +CKFFDLADYLT
Sbjct: 144 DHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLT 203

Query: 203 FKASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNS 262
           FKA+G E RS+CSTVCKQGLLP+GVEGS  GWS+EFL EIGLEELI DDF ++GGSV  +
Sbjct: 204 FKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET 263

Query: 263 DKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK 322
                FLSAGE IG +    A ELGLS HCVVGSGVIDAYAGWVGTVAARTDV IPALVK
Sbjct: 264 ----TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVK 319

Query: 323 TDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCT 382
           +D+ K G+DRATGRLAAVAGTSTCHIAMS+DPIFV GVWGPYRD +A  FW AEGGQSCT
Sbjct: 320 SDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCT 379

Query: 383 GALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGD 442
           GALLAHVLTTHPAY ELSQL+DAA+VSKFDYLNSRLE LAQQ+KA SVV LAKHLFFYGD
Sbjct: 380 GALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGD 439

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSA 502
           YHGNRSPIADPSMRAAIIGQSMDNSIDDL++MYLGACEFIAQQTRQIV++MC SGH+L+A
Sbjct: 440 YHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAA 499

Query: 503 IFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD--------- 553
           IFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+         
Sbjct: 500 IFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETA 559

Query: 554 ---LSGTHSALSVSRKSSIAGEPA-----------------------NAGQPKKS---AV 584
               + ++  +S+ RKSS++ + A                       N  +P  S   A 
Sbjct: 560 SDPATTSNKDVSIRRKSSLSRKDAGIIGDGSRSRSGSAASGLGHGGGNTLKPLTSFAKAQ 619

Query: 585 SKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFP---TPEDA--------------YA 627
            K   L   D+                    G+PFP   + E+A                
Sbjct: 620 KKTNDLKFADMPSPYTAPSATSSTAQISTTGGYPFPVMASNEEAIIDEMEEENEDESLLT 679

Query: 628 IDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKVVQP 687
            D   E+ K+   S      A+    K + D  K       D +W VMYNMTGGGKVV P
Sbjct: 680 FDAKTEKSKEAATSA-----ANHNNAKVLRDVTK-------DKLWEVMYNMTGGGKVVWP 727

Query: 688 AAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721
             E+  DR+LLNAKYKIFLDMA TQ+KYR +VD+
Sbjct: 728 TEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDE 761

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/705 (68%), Positives = 562/705 (79%), Gaps = 21/705 (2%)

Query: 25  LSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQA 84
           +SLEQ  M+YYVGVDVGTGSARACIID+ GNILSLAE+PIQRE+LK N+ITQSSQEIWQ+
Sbjct: 26  ISLEQ-AMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQS 84

Query: 85  VCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDH 144
           +CHCVKSVVRDSGVP E+IHGIGFDATCSLVVV+++ +KEV VGP F+N DQNI+LWMDH
Sbjct: 85  ICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVDDE-DKEVGVGPVFANNDQNIVLWMDH 143

Query: 145 RAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFK 204
           RAI ET  INAT DKCLKYVGGQMSVEMEIPKIKWLKN+LP+ +F++CKFFDLADYLTFK
Sbjct: 144 RAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFK 203

Query: 205 ASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDF---RRIGGSVKN 261
           A+ K+TRSFCSTVCKQGL+P+GVEGS EGWS++FL  I L EL+E+ F   R    +   
Sbjct: 204 ATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAA 263

Query: 262 SDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALV 321
                +FLSAGE++GA+D   AEELGL  HCVVGSGVIDAYAGWVGTVAA+TDV +P L 
Sbjct: 264 DGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLA 323

Query: 322 KTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSC 381
           + D+ K G+DRATGRLAAVAGTSTCHIA+SRDP+FV+GVWGPYRD +A  FW AEGGQSC
Sbjct: 324 EADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSC 383

Query: 382 TGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYG 441
           TGALLAHV++THPA+TELS L+DAA++SKFDYLNSRLETL QQ+  RSVV LAKHL+FYG
Sbjct: 384 TGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYG 443

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLS 501
           DYHGNRSPIADPSMRAAIIGQSMDNSIDDLA+MYLGACEFIAQQTRQIV+KMC +GH +S
Sbjct: 444 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQIS 503

Query: 502 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSAL 561
            IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASESF+     S +
Sbjct: 504 TIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEI 563

Query: 562 SVSRKSSI-----AGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIG 616
           +  RKSS+     +  P+ +G   K  +S+ G++  D                       
Sbjct: 564 TRRRKSSLTNLDPSSLPSASG---KGPLSQLGKMKPDLPSPYTAPHATSSTSQIAATSGS 620

Query: 617 FPFPTP-EDAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVM 675
           FPFP   E + AI E  E    EG  +    +A S+     E        +NGDA+W+VM
Sbjct: 621 FPFPVVGESSEAITE--EANDSEGPVSFKPTRATSQ-----EGLATRNPPNNGDALWDVM 673

Query: 676 YNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           Y MTGGGKVV+P+ E++ DRVLLNAKYKIFLDMA++QR+YR  +D
Sbjct: 674 YQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAID 718

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/700 (65%), Positives = 541/700 (77%), Gaps = 8/700 (1%)

Query: 24  GLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQ 83
           GLSLEQ +M+YY+GVDVGTGSARAC+IDSMGNI+SLAE+PIQRE+LK  +ITQSS+EIW 
Sbjct: 24  GLSLEQ-RMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWS 82

Query: 84  AVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMD 143
           A+C+CVK+VVRDSGV  E+IHGIGFDATCSLV V  +   +V VGPDF N DQNIILWMD
Sbjct: 83  AICYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMD 142

Query: 144 HRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTF 203
           HRA++ET  IN+T    LKYVGGQMS+EMEIPKIKWLKNH+P  KFN+  FFDLAD+LT+
Sbjct: 143 HRAVQETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTY 202

Query: 204 KASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVK--N 261
           KA+G  TRSF S+VCKQGLLP+GVEGS  GWS EFL  I L EL+ +DF ++GGSVK   
Sbjct: 203 KATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKG 262

Query: 262 SDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALV 321
            D   NFLSAG+++GA+    A +LGL++HCVVGSGVIDAYAGWVGTVAA+TD  IP L 
Sbjct: 263 DDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELA 322

Query: 322 KTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSC 381
           K ++ K+G+D+ATGRLAAVAGTSTCH+A+SRDPIFV GVWGPYRD +A  FWCAEGGQSC
Sbjct: 323 KCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSC 382

Query: 382 TGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYG 441
           TGALLAHVL+THPAYT+L  L+++A +SKFDYLNSRLE L   +K RSVV LAKHLFFYG
Sbjct: 383 TGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYG 442

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLS 501
           DYHGNRSPIAD +MRAAIIGQSMDNS+DDLAL YLGACEFIAQQTRQIV+ MC SGH++S
Sbjct: 443 DYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNIS 502

Query: 502 AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSAL 561
           +IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES++   T + L
Sbjct: 503 SIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDL 562

Query: 562 SVSRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPT 621
              R SS+  +        K  +SK  +L  D                       FP   
Sbjct: 563 RKRRASSLGSKDQAIAGLGKGGLSKLSELQTDQPSPYTAPHATSSSHMGGGSY--FPIVG 620

Query: 622 PEDAYAIDEHVEQEKDEGESTELNFKA-HSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTG 680
            + A  +       + E E   + FK+  S  ++++ ++    S  NG+ +W VMY+MTG
Sbjct: 621 SDAAANLSPGEAIAETEDEEEPVTFKSVKSTTQENLAEKTDTNS--NGEELWKVMYDMTG 678

Query: 681 GGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           GGKVV+P  + N DRVLLNAKYKIFLDMA TQR+YR+ +D
Sbjct: 679 GGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAID 718

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/702 (60%), Positives = 518/702 (73%), Gaps = 29/702 (4%)

Query: 26  SLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAV 85
           SL+  +  ++VGVDVGTGS RACIID  G ILSLAE+PI+RE++++NFITQSS+EIW AV
Sbjct: 35  SLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAV 94

Query: 86  CHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHR 145
           CHCVK+V+++S V  +K+HGIGFDATCSLVVV     K +AVGPDFSN DQNIILWMDHR
Sbjct: 95  CHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHR 154

Query: 146 AIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKA 205
           A++ET+ IN+TGDKCLKYVGGQMSVEM+IPKIKWLKN+L    F +CKFF+L DYLTFKA
Sbjct: 155 AMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKA 214

Query: 206 SGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKG 265
           +GKE RSF S VCKQG LP GVE S  GWS EFL  IGL EL  +DF R+GGS+++    
Sbjct: 215 TGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK--- 271

Query: 266 KNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQ 325
           KNFLSAGE +G +D   A ELGL+ HC+VGSG+IDAYAGWVGTVAA+   +IP L + + 
Sbjct: 272 KNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEH 331

Query: 326 EKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGAL 385
           EK  ++ A GRLAAVAGTSTCHI +S+DPIFV GVWGPYRD LA NFW AEGGQSCTGAL
Sbjct: 332 EKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGAL 391

Query: 386 LAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHG 445
           LAHV+ THPA+TELSQLADAAS+S F+YLNS LETL Q++  RSVV LAKH FFYGDYHG
Sbjct: 392 LAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHG 451

Query: 446 NRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFM 505
           NRSPIADP+MRA IIGQSMDNS++DLA+ YLGACEFI+QQTRQI++ M  +GH + AIFM
Sbjct: 452 NRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFM 511

Query: 506 SGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSR 565
           SGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGA ASE+ DL+   + +  +R
Sbjct: 512 SGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANEKT-ICQTR 570

Query: 566 KSSIAGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPTPEDA 625
           +SS++ +      P K        L G+D                    +  P  TP   
Sbjct: 571 RSSLSQKEKVVNDPYKP----IQNLSGED--------------QNLAFDVSPPNSTPSYI 612

Query: 626 YAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDR-------MKGRSSDNGDAMWNVMYNM 678
             I   +          +L+    ++ + D +         ++    ++GD +W VM  +
Sbjct: 613 KNIPATLNSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKVMQEL 672

Query: 679 TGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           TG  KVV P  + + DR+LL+ KY+IFLDMAE QRKYR +VD
Sbjct: 673 TGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVD 714

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/688 (60%), Positives = 507/688 (73%), Gaps = 20/688 (2%)

Query: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93
           +YVGVDVGTGSARAC+ID  GN+LSLAE+PI+REQL +NFITQSS+EIW AVC+CV++VV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153
            +SGV  E++ GIGFDATCSLVVV     +E+AVGPDF+N DQNIILWMDHRA++ET+ I
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213
           N++GDKCLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DYLTFKA+GKE RSF
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273
           CS VCKQG LPVGVEGS  GWS+EFL  IGL EL ++DF R+GGS++   + KNFL+AGE
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLR---EKKNFLTAGE 275

Query: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333
            I  +D   A +LGL+ HCVV SG+IDAYAGWVGTVAA+ + ++  L +T+  K   + A
Sbjct: 276 CISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGA 335

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393
            GRLAAVAGTSTCHI +S++PIFV GVWGPYRD LA  FW AEGGQSCTG LL H++TTH
Sbjct: 336 IGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTH 395

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453
           PA+TELS +A+ A VSKF+YLN  LETL +++K RSV+ LAKHLFFYGDYHGNRSPIADP
Sbjct: 396 PAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADP 455

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513
           +MRA IIGQSMDNSI+DLA+MYL ACEFI+QQTRQI++ M  SGH+++AIFMSGGQCRN 
Sbjct: 456 NMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNS 515

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSRKSSIAGEP 573
           LLMRLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE FD +     L   + S    E 
Sbjct: 516 LLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQTKTER 575

Query: 574 ANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPTPEDAYAIDEHVE 633
            N       + S   +L  +D                         P   + Y++    +
Sbjct: 576 FN------DSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPSA-----PAKINNYSLPICTQ 624

Query: 634 QEKDEGESTELNFKAHSKWKKDM-EDRMKGRSSDNGDAMWNVMYNMTGGGKVVQPAAEEN 692
           Q  D+         + +  ++ + E R  G S      +W VM  +TG  ++V P  + +
Sbjct: 625 QPLDKTSEESSKDASLTVGQESLGEGRYNGTS-----FLWKVMQELTGNARIVNPNEKTH 679

Query: 693 ADRVLLNAKYKIFLDMAETQRKYRTIVD 720
            DR+LL+ KY+IFLDM ETQRKYR +VD
Sbjct: 680 PDRILLDTKYQIFLDMIETQRKYRRMVD 707

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/696 (59%), Positives = 505/696 (72%), Gaps = 20/696 (2%)

Query: 25  LSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQA 84
           +S  + +  +YVGVDVGTGS RACIID  GNILSLAE+PI+RE+L +NFITQSS+EIW A
Sbjct: 21  ISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNA 80

Query: 85  VCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDH 144
           VC+CV+ V++++GV   +IHGIGFDATCSLVVV     KE+AVGPDF+N DQNIILWMDH
Sbjct: 81  VCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDH 140

Query: 145 RAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFK 204
           RA++ET+ IN +G+ CLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DYLTF+
Sbjct: 141 RAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFR 200

Query: 205 ASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDK 264
           A+GKE RSF S VCKQG LP GVEGS  GWS++FL  IGL EL ++DF ++GGS++N   
Sbjct: 201 ATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-- 258

Query: 265 GKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTD 324
            KNFLSAGE IG +D   A +LGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L + +
Sbjct: 259 -KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENE 317

Query: 325 QEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGA 384
             K   + A GRLAAVAGTSTCHI +S+  IFV G+WGPYRD LA  FW AEGGQSCTG 
Sbjct: 318 DYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGV 377

Query: 385 LLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYH 444
           LL HV+TTHPA+++LSQLADAA+VSKF+YLNS LE L +++K RSV+ LAKHLFFYGDY 
Sbjct: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYR 437

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIF 504
           GNRSPIADP+MRA IIGQSMDNSIDDLA++YLGACEFI+QQTRQI++ M  SGH ++A+F
Sbjct: 438 GNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVF 497

Query: 505 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVS 564
           MSGGQCRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ FDL+     +   
Sbjct: 498 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIKSK 557

Query: 565 RKSSIAGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPTPED 624
           + S +  E      P              +L                   +  P  T  D
Sbjct: 558 KSSLVQTEFLEGLYPSIQ-----------NLPLENHSTNVVASYKLACSNLNAPARTSSD 606

Query: 625 AYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKV 684
            + I +  EQ  D          +  K ++++E+    R  D  + +W VM  +TG  KV
Sbjct: 607 LFPISK--EQPADMISDKSSKGISLDKGRENLEEE---RDIDK-NILWKVMQELTGNAKV 660

Query: 685 VQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           + P  + + DR+LL+ KY+IFLDM ETQR YR +VD
Sbjct: 661 ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/699 (59%), Positives = 502/699 (71%), Gaps = 23/699 (3%)

Query: 25  LSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQA 84
           + L+  ++ +YVGVDVGTGSARACIID  GN+LSLAE+PI+RE+L+ NFITQSS+EIW A
Sbjct: 30  IPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDA 89

Query: 85  VCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDH 144
           VCHCVK+V+++S V  +++HG+GFDATCSLVVV     K VAVGPDF+  DQNIILWMDH
Sbjct: 90  VCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDH 149

Query: 145 RAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFK 204
           RA++ET+ IN++ DKCLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DYLTFK
Sbjct: 150 RAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFK 209

Query: 205 ASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDK 264
           A+GKE RSF S VCKQG LP GVEGS  GWS EFL  IGL ELIE DF ++GGS+++   
Sbjct: 210 ATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHK-- 267

Query: 265 GKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTD 324
            KNFLSAGE IG++D   A ELGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L + +
Sbjct: 268 -KNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENE 326

Query: 325 QEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGA 384
                 + A GRLAAVAGTSTCHI +S+DPIFV G+WGPYRD LA  FW AEGGQSCTG 
Sbjct: 327 DNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGV 386

Query: 385 LLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYH 444
           LL HV+  HPAYTELSQL +AA VSKF+YLNS LET+ +++  RSV+ LA+HLFFYGDYH
Sbjct: 387 LLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYH 446

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIF 504
           GNRSPIAD +MRA IIGQSMDNS++DLA+ YL ACEFI+QQTRQIV+ M  SGH + AIF
Sbjct: 447 GNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIF 506

Query: 505 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVS 564
           MSGGQCRN LL RLLADC+GLPIVIPRYID AVVFGSALLGA ASE+FDL+     L+  
Sbjct: 507 MSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDLAKGRRTLTTK 566

Query: 565 RKSSIAGEPANAGQPKKSAVSKFGQLGGDDLXXXXXXXXXXXXXXXXXXXIGFPFPTPED 624
           + SS      N+    +++  +   L  D                        P      
Sbjct: 567 KSSSAQEFFINSYPSPQNSAMRHQNLASDVTCSYNLPNSISSA----------PDTMNRH 616

Query: 625 AYAIDEHVEQEKDEGESTE--LNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGG 682
           +  I +    +    ES++  LN  A    +   E R +G        +W VM  +TG  
Sbjct: 617 SSTISKQSRGDMSSEESSKGTLNTVALRSLE---EKRYRGTG-----ILWKVMQELTGDA 668

Query: 683 KVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721
           K V P    + DR+LL+ KY+IFLDMAETQ++YR +VD+
Sbjct: 669 KAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDN 707

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/531 (62%), Positives = 428/531 (80%), Gaps = 7/531 (1%)

Query: 29  QQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHC 88
           ++ + YY+GVDVGTGS RACIID +G I S AE  I R++LK + ITQSSQEIW+AVC C
Sbjct: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61

Query: 89  VKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIE 148
           VK VV + G   +++ GIGFDATCSLVVV++ TN+ VAVGPDF++++Q+IILWMDHRA++
Sbjct: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121

Query: 149 ETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGK 208
           ET+ IN+T D+CLKYVGGQMS+EME+PKIKWLK H+ ++ F  C+F+DLADYLTFKA+G+
Sbjct: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181

Query: 209 ETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNF 268
           +TRSFCS VCKQG++P+GVEGS  GWS++FL  I LEEL  +D+ ++GGSV  S  G+NF
Sbjct: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGS-HGRNF 240

Query: 269 LSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKV 328
           L+AGE+I  ++    EEL LS  C+VGSG+IDAYAGW+GTV + T V +  L +     V
Sbjct: 241 LTAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFR-----V 294

Query: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388
           GM  A GRLAAVAGTSTCHI +S+DPIFV GVWGPY+D +   +WC EGGQSCTGALL H
Sbjct: 295 GMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQH 354

Query: 389 VLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRS 448
           VL THP+Y EL ++++   ++KFDYLN+RL  +A++   RSV+ LAKH+FFYGD HGNRS
Sbjct: 355 VLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRS 414

Query: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGG 508
           P+ADPSM+ AI+G SMD S+D+LA  YL ACEFIAQQ RQI++ MC +GH++SAI+MSGG
Sbjct: 415 PLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGG 474

Query: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHS 559
           QCRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + L+G+ S
Sbjct: 475 QCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSES 525

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 38/52 (73%)

Query: 669 DAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           + +W+ M  MT  G  + P  +++ DR+LL+AKYKIFLDMA+ Q++YR IVD
Sbjct: 533 NILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVD 584

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/523 (62%), Positives = 411/523 (78%), Gaps = 1/523 (0%)

Query: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91
           M +Y+GVDVGTGS RAC+I+  G ILSL  + I +E+LK N+ITQSS+EIWQ +C CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151
           V+++S +    + GIGFDATCSLVV++++T +EV VGP+F + ++NIILWMDHRA++ET 
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 152 LINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211
            INATGDKCLKYVGG+MSVEME+PKIKWLKN+L +  F+ CKFFDL DYLT+KA+ K+ R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271
           SF STVCKQGLLP+GVEGS  GWS+EF T+I L+EL  D+F  IGGS+ +     N  S 
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331
           GE++G +    A+ELGL   C+VGSG+IDAYAGWVGTVAA+ +  I  +   D     +D
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLD 299

Query: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLT 391
            + G LA +AGTSTCHI +S  PIFV+G+WGPYRD L+ NFWCAEGGQSCTGALL H+LT
Sbjct: 300 SSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILT 359

Query: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA 451
           THPAY EL +  +  SV  F++LN+RL  L ++  ARS++ L KH F YGDYHGNRSPI+
Sbjct: 360 THPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPIS 419

Query: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCR 511
           D SMRAAIIGQSMD SID LA+MYL ACEFI+QQ+RQI+ ++  +GH +  I+MSGGQ R
Sbjct: 420 DESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQAR 479

Query: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDL 554
           N LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++++
Sbjct: 480 NQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 43/59 (72%)

Query: 663 RSSDNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721
           ++ D+G  +WN M  +T  G V+ P A  + DRVLLNAKYKIFLDMAETQRKYR  +D+
Sbjct: 529 KNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDE 587

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/531 (61%), Positives = 416/531 (78%), Gaps = 11/531 (2%)

Query: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93
           +Y+GVDVGT S RAC++D  G ILSLA +PI R++++ N++TQSS EIW+A+C C++ ++
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153
            DS V  + I GIGFDATCSLVV+EE TNK VAVGP+F + +Q+IILWMDHRAI+E   I
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213
           N+TG +CLKYVGG+MS+EM+IPKIKWLKN+LP+ KF++C+F+DL D+LT++A+G + RSF
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273
           CSTVCK GLLP+GV+GS +GW ++   +IGL EL   +F ++GG V  S    NFLSAG+
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVV--SSTASNFLSAGD 241

Query: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333
           ++G +    A +LGL+  C+V SG+IDAYAGWVGT+AA        L    QE    + A
Sbjct: 242 YVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGI-----TLGSDGQES---ELA 293

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393
           + RLA VAGTSTCHI +S+ P F+DGVWGPYRDAL   +W  EGGQSCTGALLAHVL +H
Sbjct: 294 SSRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSH 353

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453
           PAY  L +LA    +SKFD++N+RLE L +++ A+SV  L KHLFFYGDYHGNRSPIADP
Sbjct: 354 PAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADP 413

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513
           +MRA IIGQSMD S+DDLA+M LGACEFIAQQTRQIV+ +  SGH++++I+MSGGQCRN 
Sbjct: 414 NMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNL 473

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVS 564
           +L++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE + L G     SVS
Sbjct: 474 VLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY-LHGCSDTASVS 523

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 42/66 (63%)

Query: 657 EDRMKGRSSDNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYR 716
           + R+          +W VM N+TG G++++P+   +++  LL+ KY+IFLDM ETQ++YR
Sbjct: 528 QQRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYR 587

Query: 717 TIVDDA 722
            +V  A
Sbjct: 588 DLVTRA 593

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/521 (61%), Positives = 400/521 (76%), Gaps = 5/521 (0%)

Query: 33  LYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSV 92
            +++GVDVGTGS RAC+ID  G+IL+L ++PI RE+LK  FITQSS+EIW ++C CV+ V
Sbjct: 19  FHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKV 78

Query: 93  VRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQL 152
           + D+ +PA K+ GIGFDATCSL VV++ T + +AVGP FS  DQNII+WMDHRA +ET  
Sbjct: 79  IADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDE 138

Query: 153 INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRS 212
           IN+  D  LKYVGG+MS+EME+PKIKWLKNH+P   F +  FFDL DYLTFKA+G + RS
Sbjct: 139 INSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRS 198

Query: 213 FCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAG 272
            CS VCKQGLLP+GVEGS EGWSR FL+  GL ELIE++F RIGG   NS   +NFLSAG
Sbjct: 199 LCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNS---RNFLSAG 255

Query: 273 EFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDR 332
           E++  +  +  E+LGL+  CVVGSG+IDAYAG +GT+AAR D S  A  + D     +  
Sbjct: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ARTQDDANGQDLQN 313

Query: 333 ATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTT 392
           A GRLAAVAGTSTCHI +S  PIFV+GVWGPY+D LA ++WCAEGGQSCTG LL HV+TT
Sbjct: 314 AIGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITT 373

Query: 393 HPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIAD 452
           HPAY EL   A  + +  F+ LN  +  LA+Q+   +++ L K LF YGDYHGNRSPIAD
Sbjct: 374 HPAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIAD 433

Query: 453 PSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRN 512
           P MRA+IIGQSMD +++ LAL+YL ACEFIA QTR I+ KM  +GH + +I+MSGGQCRN
Sbjct: 434 PRMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRN 493

Query: 513 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553
            +LM LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + F+
Sbjct: 494 NILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (73%)

Query: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAV 723
           +WN M  MTG G  + P    +A + LLN KYKI++DMA+TQ+KYR+++DD++
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDDSL 602

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/518 (61%), Positives = 406/518 (78%), Gaps = 4/518 (0%)

Query: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93
           YYVG+DVGTGS RAC++DS GN+LSL E+ I RE+LK NFITQS++EIWQA C CVK+ +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153
               V    + GIGFDATCSLV +E+ T+K+V VGP+F N D N+ILWMDHRA++E   I
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213
           NAT DKCLKYVGG MSVEM+IPKIKWLKN++  N F +C+FF+LADYLTFKA+GK TRSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273
           CS VCKQG LP GVEGS+EGWS+EFL+ IGLE+L  + +  +GG++KN D   NF S+G+
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKN-DSQDNFQSSGK 254

Query: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333
            +G +      ELGLS +CVVG+G+IDAYAG +GT+AA ++ S    +K D   +G+  A
Sbjct: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGS--HQIKNDSS-IGLQNA 311

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393
            GRLA+VAGTSTCH+ +S+DP+FV GVWGPYRD +A  +WCAEGGQ+CTG LL++VL+ H
Sbjct: 312 IGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIH 371

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453
           PA+ EL   +  A + KF YLN+ L+ L  + K  S + LAKH+FFYGDY GNRSP ADP
Sbjct: 372 PAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADP 431

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513
            M AAIIGQSM++++++LA+ YL ACEFIAQQTRQIV+ +  +G  +S I+MSGGQCRN 
Sbjct: 432 MMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNK 491

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551
           LLM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 492 LLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%)

Query: 666 DNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721
           D G  +W  M  MT  G +++P    + DR LL+ KY+IFLDMAETQRKYR +VDD
Sbjct: 538 DFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/531 (60%), Positives = 408/531 (76%), Gaps = 6/531 (1%)

Query: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91
           M YY+GVDVGTGSARAC+ID  G+ILS+ E  I R++LK  +ITQS+ +IW  +C C+++
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 92  VVRDSGVP--AEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEE 149
           ++++S V   + KI GIGFDATCSLVV+  +T++EVAVGP+F + DQN+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 150 TQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKE 209
           T  IN+T  KCLKYVGGQMSVEMEIPKIKWLKN++    + +CKF DL D+LT+KA+G  
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 210 TRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGK-NF 268
            RSFCS VCKQGLLP+GVEGS +GW+ EFL  IGLE+L+ED+F ++GG VK   +GK +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 269 LSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKV 328
            +AGEFIG +    ++ +G+S+ C V SG+IDAYAGW+GT+AA T   I  L        
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 329 GMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAH 388
           GM  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRD L  NFWCAEGGQSCTGALL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 389 VLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRS 448
           VL THPAY EL  ++    +S F+ LN+++  L  Q+     VHL K+LFFYGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 449 PIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGG 508
           P+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IVD M  SG++L +++MSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 509 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHS 559
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE   LS +HS
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE---LSKSHS 528

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
           +W+VM  MTG G VV P    +    LL  KY+I+LDM  TQ++YR++V+
Sbjct: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/520 (59%), Positives = 386/520 (74%), Gaps = 11/520 (2%)

Query: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93
           YY+GVDVGTGSARA ++   G  L+L E PI+R++L+ +FITQSS EIW AVCHCV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153
             SGV    + GIGFDATCSLV V+  T   V VGP+F ++ QNIILWMDHRA  ET  I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213
           NATGD+CLKYVGGQMSVEME+PKIKWLK H+P  +F +CKFFDL DYLTF A+ K+ RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273
           CS VCKQGLLP GV+GS   WS EFL  +GL ELI+ +F ++GG+ ++  K   FL+AG+
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPK---FLTAGQ 242

Query: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333
            +G +    +E+ GLS  C+V SGVIDAYAGW+G+V A+ D S         +  G+D A
Sbjct: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLDVA 294

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393
             RLA +AGTSTCHI +S+ P FV GVWGPYRD L   +WCAEGGQSCTGALLAH+L TH
Sbjct: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453
           PA+ EL +LA    VS F+YL   L+TL  +++ R+V+ L++  F YGD+HGNRSP+ADP
Sbjct: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513
           SMRA +IGQSMD SI+ LA+ YL ACEFIA QTRQIV+ M  +GH +  ++MSGGQCRN 
Sbjct: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553
           LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 662 GRSSDNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721
           G  +D    +W++M  MT  G  V P  + + +R  ++AKY IFLDM E Q+ YR+ +D 
Sbjct: 515 GIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQ 574

Query: 722 AVRN 725
             R+
Sbjct: 575 VFRS 578

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/520 (58%), Positives = 388/520 (74%), Gaps = 9/520 (1%)

Query: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91
           M YY+GVDVG+GS RAC++D  G +LS+A R I +E+     +TQSS EIW AVC+CVKS
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151
            + +S V    I GIGFDATCSLVV+ + + + VA GP+F N +QNII+WMDHRAIEET+
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 152 LINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211
            IN +GD CLKYVGGQMSVEMEIPKIKWLKNH+   +F +  F DL DYLTF ASG  TR
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271
           S+CS VCKQG LP GVEGS++GWS EFLT+IGLEE+ + +F  +GG     ++  NF  A
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGG----PNESGNFTYA 236

Query: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331
           G  +  +  +  +   ++  C+VGSG+IDAYAGW+GTVA+ T + +P     ++E V ++
Sbjct: 237 GNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVP----NNKEVVDIE 291

Query: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLT 391
              GRLAAVAGTSTCHI +S+  IFV GVWGPYRD L  ++WCAEGGQS TGALLAH+L+
Sbjct: 292 ECAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILS 351

Query: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA 451
            HP+  ELS L    +V KF +LN+ +  L+++    + + L K  F YGDYHGNRSPIA
Sbjct: 352 IHPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIA 411

Query: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCR 511
           DP+MRAAIIGQSMD S+DDLA  YL ACEFIA QT+ I+D +  +GH + AI+MSGGQCR
Sbjct: 412 DPNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCR 471

Query: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 551
           N +LM+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 472 NNILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 663 RSSDNG--DAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720
            +SD G  D +W+ M NMT  G  V PA E++ +R L+N K+KIFLDMA+TQ+ YR +V+
Sbjct: 514 NNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573

Query: 721 DAVR 724
           +A+R
Sbjct: 574 NAIR 577

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/540 (58%), Positives = 390/540 (72%), Gaps = 11/540 (2%)

Query: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93
           YYVGVDVGT  ARACIID  G IL+  + PI R Q K + ITQSS EIW AVC  V++ V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153
            +S V  +++ GI FDATCSLVV++E ++ EVAVGPDFS+  QN+ILWMDHRA+ E   I
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213
           N+TG   L+YVGG+MSVEM++PKIKWL+ H+P  +F +CKF+DL D+LT++A+G E+RSF
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273
           CSTVCK GL+P GV+ S  GWSREFL +IGLEEL ED FRR+GG++   + G  F SAGE
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALD--EPGSEFRSAGE 246

Query: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333
            +G +    A  LGL+  CVVGSGVIDAYAGWVGTV A  D +        +E  G++  
Sbjct: 247 PVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEEL 298

Query: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393
            GRLAAVAGTSTC I +S+ P FV+GVWGPYRD LA  +WC EGGQSCTGALLAH L TH
Sbjct: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453
           PAYTEL Q A    ++ FDY+N RL+ L  +  ARS+  LAKH F YGDYHGNRSP+ADP
Sbjct: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418

Query: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513
           SMRAA++G SMD S DDLAL  L A EFIA Q R I+D M  +G  +  +++SGGQ RN 
Sbjct: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478

Query: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSRKSSIAGEP 573
           LL +LLAD    P+V PR++ AAVVFGSALL A A E++ L+ T++  S    SS +  P
Sbjct: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENY-LANTNATASSILPSSASRAP 537

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721
           +W +M  +T  G VV P+ + + D  LL AKYK+FL+MAE Q+ YR +VDD
Sbjct: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/519 (56%), Positives = 383/519 (73%), Gaps = 4/519 (0%)

Query: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91
           M  Y+GVDVGTGSARACI +  G IL++  + I +++L+  FITQSS EIW A+   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151
           V+  S V    I GI FDATCSLVV ++ + + +AVGP+F +++QNIILWMDHRA  ET 
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 152 LINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211
           LIN+T DK LKYVGG+MSVE E+PKIKWLK+HL    F+ C F DLAD+LT+KA+GK   
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271
           SF S VCKQGLLP GVEGS  GWS+EFL +IGLEEL  ++F ++GGS+ N  +G NFL  
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSI-NLKEG-NFLIP 238

Query: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331
           G+ +G +D   A    L NHCVVG+GVIDAY+GWVGTVA  +DVS      + QE   ++
Sbjct: 239 GDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIE 296

Query: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLT 391
            + GR+A V+GTSTCHI +S+ P+F+ GVWGPYRD LA N W  EGGQS TGALL +++ 
Sbjct: 297 GSLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIE 356

Query: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA 451
           THPAY EL ++    + + F YL+ +LE L   +K  SV +L K++F YGDY+GNRSP+A
Sbjct: 357 THPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLA 416

Query: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCR 511
           DP M   IIGQ+MD+SI+DLA+ YL ACEFIA QTR I+D + T GH ++AI+MSGG C+
Sbjct: 417 DPLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCK 476

Query: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 550
           N LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 477 NKLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%)

Query: 669 DAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAVR 724
           D +W+ M  MT  G ++ P +E++  R  L AKY+++LDM +T  KYR  +++  +
Sbjct: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  210 bits (534), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 158/534 (29%), Positives = 252/534 (47%), Gaps = 86/534 (16%)

Query: 36  VGVDVGTGSARACIIDSMGNIL-SLAERPI---QREQLKANFITQSSQEIWQAVCHCVKS 91
           +G+D+G+ SAR  I D   ++L ++A+ P+        K+    Q S EI +A+ +C + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQE 68

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQ-TNKEVAVGPDFSNTDQNIILWMDHRAIEET 150
           +     +    +   G  ATCSL + ++  TN  +   P+    + N+I WMD  A++E 
Sbjct: 69  L----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYPN----EDNVIFWMDSSAVDEC 120

Query: 151 QLINATGDKC----LKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKAS 206
           + +N   +KC    L Y+GG+   EM IPK+K+  N    N+  +   FDL  Y+ ++  
Sbjct: 121 EWLN---EKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELG 177

Query: 207 GKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGK 266
                +      ++ +  +G +G A GWS  F           +D  ++  +V       
Sbjct: 178 RLYRWNTDELSARENINGIGNDGEASGWSSSFY----------NDIMKLPSNVT------ 221

Query: 267 NFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQE 326
                   IG            +  C      ID+YA W         VS P L      
Sbjct: 222 --------IGLTGLNSNNSSSTTTVC----SCIDSYASWFA-------VSSPNL------ 256

Query: 327 KVGMDRATGRLAAVAGTSTCHIAMSRDPIF---VDGVWGPYRDALATN--FWCAEGGQSC 381
                     L  +AGTSTC+  M   P+    + GVWGP+   L TN  +     GQSC
Sbjct: 257 -------EASLFMIAGTSTCY--MYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSC 307

Query: 382 TGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVH-LAKHLFFY 440
           TG L+ H+  +HPA  ++ +  +      ++ L + ++ +  ++K R  +H LAKH+FFY
Sbjct: 308 TGKLIEHLFKSHPAARKIQRSGEDI----YEVLENSIQDI--EKKNRKSIHILAKHMFFY 361

Query: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKM--CTSGH 498
           GDY GNR+P AD  MR + IG+S D SI +L   Y+   EF++ QT+ I+D      SG 
Sbjct: 362 GDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGA 421

Query: 499 DLSAIFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSALLGAVASE 550
            +  + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG  A+E
Sbjct: 422 RIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANE 475

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%)

Query: 695 RVLLNAKYKIFLDMAETQRKYRTIVDDAV 723
           + LL+ KY+I LDMA+ Q++Y  +VD+A+
Sbjct: 511 KRLLSVKYRIHLDMAKQQQQYHRLVDEAL 539

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  202 bits (514), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 157/530 (29%), Positives = 250/530 (47%), Gaps = 78/530 (14%)

Query: 36  VGVDVGTGSARACIIDSMGN-ILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSV-- 92
           +G+DVG+ SAR  I +   + +L +A+ P+   Q  +    ++S + WQ     +K++  
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSS----RTSWKFWQRSTEIIKALQK 89

Query: 93  -VRDSGVPAEKIHGIGFDATCSLVVVE-EQTNKEVAVGPDFSNTDQNIILWMDHRAIEET 150
            ++   +    +   G  ATCSL + E ++ N  +   P+    + N+I WMD  AI+E 
Sbjct: 90  CLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPYPN----EDNVIFWMDSSAIDEC 145

Query: 151 QLINA-TGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKE 209
           + +NA    + L ++GG    EM IPK+K+  N    N+  +   FDL  Y+ ++ S   
Sbjct: 146 KQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLY 205

Query: 210 TRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFL 269
             +    + ++    VGV+G A GWS  F   I                          L
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFYENIM------------------------HL 241

Query: 270 SAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVG 329
            +   IG+  AT  +   +++  +V S  ID+YA W    +   + S             
Sbjct: 242 PSNVIIGSNGATCKK---IASSAIVRS-CIDSYASWFAVSSPHLETS------------- 284

Query: 330 MDRATGRLAAVAGTSTCHIAMSRDPIF---VDGVWGPYRDALATN--FWCAEGGQSCTGA 384
                  L  +AGTSTC+  M   PI    + GVWGP+   L +N  F     GQSCTG 
Sbjct: 285 -------LFMIAGTSTCY--MYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGK 335

Query: 385 LLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYH 444
           L+ H+  THP   E+  L   A +  +  L   +  + ++Q  +SV    K +FFYGDY 
Sbjct: 336 LIEHLFVTHPCAKEI--LKRGADI--YQVLERTIHDI-EKQNGQSVHVFTKDIFFYGDYE 390

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVD--KMCTSGHDLSA 502
           GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QTR I+D  K    G  +  
Sbjct: 391 GNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQE 450

Query: 503 IFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 550
           + +SG Q +N  L+ L++    G+ I  P+  +D   V G+ LL   A+E
Sbjct: 451 LRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANE 500

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 695 RVLLNAKYKIFLDMAETQRKYRTIVDDA 722
           R LL AKY+I LDMA+ Q++Y  ++D+ 
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  190 bits (483), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 156/536 (29%), Positives = 246/536 (45%), Gaps = 90/536 (16%)

Query: 36  VGVDVGTGSARACIIDSMGN-ILSLAERPIQREQ---LKANFITQSSQEIWQAVCHCVKS 91
           +G+D+G+ SAR  I     + +L +A+ P+   Q    K+    Q S EI +A+  C + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151
           +     +    +   G  ATCSL + E     E  +   + N + N+I WMD  A +E +
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALI--PYPN-ENNVIFWMDSSATDECE 121

Query: 152 LINATGDK-CLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKET 210
            +NA   K  L Y+GG+   EM IPK+K+  N     +      FDL  Y+ ++      
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQ 181

Query: 211 RSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLS 270
            +    +  + +  +G +G A GWS  F   I            I  +V           
Sbjct: 182 WNIDGLLRGENINGIGNDGEASGWSSSFYKNI----------MNIPSNV----------- 220

Query: 271 AGEFIGAIDATVAEELGLSNHCVVGSGV----IDAYAGWVGTVAARTDVSIPALVKTDQE 326
               IG +        GL +  V+ + V    ID+YA W         VS P L ++   
Sbjct: 221 ---IIGPV--------GLVSKKVISTTVVRSCIDSYASWFA-------VSPPFLERS--- 259

Query: 327 KVGMDRATGRLAAVAGTSTCHIAMSRDPIF---VDGVWGPYRDAL--ATNFWCAEGGQSC 381
                     L  +AGTS+C+  M   P+    + GVWGP+ + L    +F     GQSC
Sbjct: 260 ----------LFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSC 307

Query: 382 TGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYG 441
           TG L+ H+  +HP   ++  L   A +  +  L   +  + +++K  S+  LAK +FFYG
Sbjct: 308 TGKLIEHLFESHPCARKI--LKSGADI--YQVLEQTIHGI-EKKKGLSIHILAKDMFFYG 362

Query: 442 DYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVD-----KMCTS 496
           DY GNR+P ADP M+ + IG++ D SI +L   Y+   EF++ QT+ I+D     K C  
Sbjct: 363 DYEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIR 422

Query: 497 GHDLSAIFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 550
             +L    +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L   A+E
Sbjct: 423 IQELR---ISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANE 475

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  190 bits (482), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 149/551 (27%), Positives = 249/551 (45%), Gaps = 86/551 (15%)

Query: 36  VGVDVGTGSARACIIDSMGN-ILSLAERPI---QREQLKANFITQSSQEIWQAVCHCVKS 91
           +G+DVG+ SAR  + +   + +L +A+ P+   Q    K+    Q S EI +A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151
           +     +   ++   G  ATCSL + E      + +   + N D N+I WMD  A+ E Q
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLI--PYPNED-NVIFWMDSSAVNECQ 121

Query: 152 LINAT-GDKCLKYVGGQMSVEMEIPKIKWL---KNHLPENKFNECKFFDLADYLTFKASG 207
            +N     + L Y+GG+   EM +PK+K+     +HL +  F+    FDL  Y+ ++ S 
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFH---IFDLHQYIAYELSR 178

Query: 208 KETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKN 267
               +    + ++ L  +G +G   GWS  F             ++ I     N   G  
Sbjct: 179 LYEWNIEGLLGRENLNGIGNDGEVSGWSSSF-------------YKNIINLPSNVSIGTT 225

Query: 268 FLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEK 327
            L A + I                  V    ID+YA W    +   + S           
Sbjct: 226 SLVANKHIST---------------TVVRSCIDSYASWFAVASPHLETS----------- 259

Query: 328 VGMDRATGRLAAVAGTSTCH-----IAMSRDPIFVDGVWGPYRDALAT--NFWCAEGGQS 380
                    L  +AGTS+C+     I+ +R P    GVWGP+   L    +F     GQS
Sbjct: 260 ---------LFMIAGTSSCYMYGTTISDTRIP----GVWGPFDTILDNRGDFSVYAAGQS 306

Query: 381 CTGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFY 440
           CTG L+ H+  +HP   ++  L D A +  +  L   +  + ++    S+  L K +FFY
Sbjct: 307 CTGKLIEHLFESHPCARKI--LKDGADI--YQVLEQTIRDI-EKNNGLSIHILTKDMFFY 361

Query: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHD- 499
           GDY GNR+P ADP ++ + IG+S D S+ +L   Y+   EF++ QT+ I+D       + 
Sbjct: 362 GDYEGNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNI 421

Query: 500 -LSAIFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASESFDLSG 556
            +  + +SG Q +N  L+ L++    G+ I+ P+  +D   + G+ +L   A E   L+ 
Sbjct: 422 HIKELRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLAD 481

Query: 557 THSALSVSRKS 567
             +   +S  S
Sbjct: 482 VITERDISNDS 492

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 695 RVLLNAKYKIFLDMAETQRKYRTIVDDAVRN 725
           R LL  KY I LDMA+ Q++Y  +VD+  ++
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEVFQH 541

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  181 bits (460), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 148/547 (27%), Positives = 245/547 (44%), Gaps = 109/547 (19%)

Query: 36  VGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFI----------TQSSQEIWQAV 85
           +G+D+G+ S R  +     +++      +Q  + K ++           TQS+ EI + +
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLM------VQCVKQKISYYYHGDSALWEYTQSTDEIMKVI 59

Query: 86  CHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHR 145
             C+     D  +    I   G  ATCS+ +  ++ N          +  QN+I WMD+ 
Sbjct: 60  ERCL----HDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNS 115

Query: 146 AIEETQLINATGDKCLK-YVGGQMSVEMEIPKIKWLKNHLPEN---KFNECKFFDLADYL 201
           +  E +L+N   +K L+ ++GG+   EM IPKI  L N+L  +   +       DL  YL
Sbjct: 116 SKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYL 175

Query: 202 TFKASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTE---------IGLEELIEDDF 252
            ++ + +   +F   +       +G +G   GWS +F  +         IG E  +EDDF
Sbjct: 176 AYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLEDDF 235

Query: 253 RRIGGSVKNSDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAAR 312
               G V                                    +  ID Y+ W+   +  
Sbjct: 236 EYCKGIV------------------------------------ASCIDCYSSWLSLCSPT 259

Query: 313 TDVSIPALVKTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDAL--AT 370
            + S                    L  V GTSTC++  +     + GVWGP+ D L  + 
Sbjct: 260 PEES--------------------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSN 299

Query: 371 NFWCAEGGQSCTGALLAHVLTTHPAYTELSQLADAASVSKFDY--LNSRLE---TLAQQQ 425
            +   EGGQSCTG L+ H+L THPA         ++S++K D+  L  ++E   +  ++Q
Sbjct: 300 TYAVYEGGQSCTGKLIEHLLQTHPA---------SSSIAKDDWPLLLEKIEQEISAIEEQ 350

Query: 426 KARSVVHLAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQ 485
             RS+    KH+FFYGD+ GNR+P ADP M    IG++ D S ++L L Y+   EF+A Q
Sbjct: 351 TGRSIHFKTKHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQ 410

Query: 486 TRQIVDKMCTS-GHD-LSAIFMSGGQCRNGLLMRLLADC-TGLPIVIPRY-IDAAVVFGS 541
            + ++     + G D ++ I + G Q +N  L+ L++    G  I +P+  ++ + V G+
Sbjct: 411 IKYMISIFNKAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGA 470

Query: 542 ALLGAVA 548
            LLG  A
Sbjct: 471 FLLGKSA 477

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  172 bits (436), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 146/532 (27%), Positives = 236/532 (44%), Gaps = 79/532 (14%)

Query: 36  VGVDVGTGSARACIID-SMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVVR 94
           +G+D+G+ + R  I D     ++ +  +P+       N +TQSS +I  A+  C++ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDLNP 70

Query: 95  DSGVPAEKIHGIGFDATCSLVVVEEQTN--KEVAVGPDFSNTDQNIILWMDHRAIEETQL 152
           D     + +   G  ATCSL V  +     K + +         N++ WMD  A  E ++
Sbjct: 71  D----LKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 153 INATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRS 212
           +N T  +  +++GG    EM IPK+  +    PE + ++ + FDL  Y+ ++ + K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYGWD 185

Query: 213 FCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAG 272
               + K     +G +G  +GW   F           +D  ++  +VK            
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVK------------ 223

Query: 273 EFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDR 332
             IG I A   E       C      ID Y+ W    ++  + S                
Sbjct: 224 --IGPIHALNTESPVRVASC------IDCYSNWFSMCSSSPNNS---------------- 259

Query: 333 ATGRLAAVAGTSTCHI-AMSRDPIFVDGVWGPYRDAL----ATNFWCAEGGQSCTGALLA 387
               L   AGTSTC++ A + +   + GVWGP+ + L    A  +   E GQS TG L+ 
Sbjct: 260 ----LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIE 315

Query: 388 HVLTTHPAYTELSQLADAASVSK---FDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYH 444
           H+  THPA       A A S+ K   F  + S +E L +Q    SV   +KH+F YG+  
Sbjct: 316 HLFETHPA-------ARAYSMDKSKLFSAIESAIEKL-EQDFGESVHFRSKHMFTYGELQ 367

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIF 504
           GNR+P  D SM    IG++ D S  DL L Y+   EF+A Q + I  K C    ++  I 
Sbjct: 368 GNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHI--KECFKA-EIKDIR 424

Query: 505 MSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLGAVASESFDL 554
           ++G Q +N  L+ L +     + + IP +  D   V G+ LLG  A ++ ++
Sbjct: 425 IAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINI 476

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 22/26 (84%)

Query: 695 RVLLNAKYKIFLDMAETQRKYRTIVD 720
           + LL AKYKI+LDMA+TQ +YR +VD
Sbjct: 506 KQLLEAKYKIYLDMAQTQMRYRAMVD 531

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  169 bits (427), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 150/526 (28%), Positives = 235/526 (44%), Gaps = 79/526 (15%)

Query: 36  VGVDVGTGSARACIIDSMGN--ILSLAERPIQREQL-KANFITQSSQEIWQAVCHCVKSV 92
           VGVD+G+ S R  I  S+ N  +L + ERP++      +   TQS+ EI  A+  C+  +
Sbjct: 13  VGVDLGSSSVRVGIY-SLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL 71

Query: 93  -VRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFS----NTDQNIILWMDHRAI 147
            +R  G     I   G  ATCS+ V   +         D S    ++D+N++ WMD  A 
Sbjct: 72  GLRPGG---RSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVAS 128

Query: 148 EETQLINATGDKCLKY-VGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKAS 206
           E    ++      +K  + G    EM +PK+  L    P       + FDL  Y+ +  +
Sbjct: 129 EACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSL---EVFDLHKYIAYDLA 185

Query: 207 GKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGK 266
            +      +   +     +G +G   GW +EF                     +N  K  
Sbjct: 186 RRYGWDMAALANRPNSNGIGHDGEVGGWPQEFY--------------------RNVLK-- 223

Query: 267 NFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQE 326
             L A   +G       + +G+++        ID YA W G  + + + S          
Sbjct: 224 --LPATVAVGPASTFKGQRVGVAS-------CIDCYASWFGVCSTQPEQS---------- 264

Query: 327 KVGMDRATGRLAAVAGTSTCHI-AMSRDPIFVDGVWGPYRDAL---ATNFWCAEGGQSCT 382
                     L  VAGTSTC++ A +     + G+WGP+ + L      +   E GQS T
Sbjct: 265 ----------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTT 314

Query: 383 GALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGD 442
           G LL H+  THPA  + +   D   +  F  L  R+  + +     S+ HLA+H+F YG+
Sbjct: 315 GRLLEHLFETHPAARDYA--GDTGRL--FKDLEDRIADM-EADSGCSIHHLARHMFLYGE 369

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCT-SGHDLS 501
             GNR+P ADP M    +G++ D S  +LAL Y+   EF+A QTRQIV+   T +   + 
Sbjct: 370 LQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIG 429

Query: 502 AIFMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLG 545
            + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG
Sbjct: 430 ELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG 475

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 688 AAEENADRVLLNAKYKIFLDMAETQRKYRTIVDDAV 723
           A +EN  R LL AKY I LDMA+ Q++YR+ +D  +
Sbjct: 511 ATKENLRR-LLEAKYAIHLDMAQVQQRYRSEIDAVI 545

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  165 bits (417), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 127/466 (27%), Positives = 205/466 (43%), Gaps = 71/466 (15%)

Query: 36  VGVDVGTGSARACIIDSMGNIL---SLAERPIQREQLKANF-ITQSSQEIWQAVCHCVKS 91
           +G+D+G+ S R  + +   + +    +   P        N+  TQSS+EI  A+  C + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151
           +     +   +I   G  ATCSL + + + N  +    D  + D+N++ WMD  AI+ETQ
Sbjct: 70  L----NIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 152 LINATGDKCLK-YVGGQMSVEMEIPKIKWLKNHLPENKFNECKF--FDLADYLTFKASGK 208
            +N      ++ ++GG    EM +PK++   + L +N  N   F   DL  Y+    + +
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDIL-KNTDNNSTFEIIDLHRYIAMSLAQQ 182

Query: 209 ETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNF 268
               + +      L  +G +G   GWS  F      E +++     + G  K+S      
Sbjct: 183 NGWDYTNVCNFPNLNEIGHDGELAGWSSAFY-----ENVLQLPPNIVIGPTKHSQHS--- 234

Query: 269 LSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKV 328
                               S   +  S  ID Y+ W   + +    S            
Sbjct: 235 --------------------SKQGLKVSSCIDCYSNWFALLPSNLQNS------------ 262

Query: 329 GMDRATGRLAAVAGTSTCHI-AMSRDPIFVDGVWGPYRDAL--ATNFWCAEGGQSCTGAL 385
                   L  V GTSTC++ A S     + GVWGP+ +    +  F   E GQSCTG L
Sbjct: 263 --------LFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKL 314

Query: 386 LAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHL-AKHLFFYGDYH 444
           + H+  THPA + +    D   +  F  +N  +E +  +Q  +  +H+  KH+FFYGD  
Sbjct: 315 IEHLFKTHPASSHIDT-RDWPHL--FSQINDFIEKV--EQNTQDSIHMQTKHMFFYGDLD 369

Query: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIV 490
           GNR+P ADPSM    IG++ D S  +L   Y+   EFIA Q + ++
Sbjct: 370 GNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHML 415

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 660 MKGRSSDNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIV 719
           + G++S +  ++  V +N T   +   P   +     LL  KY+I+ +MAE QRKYR  V
Sbjct: 472 LMGKASTSDKSIVEVAHNQTYSYR--PPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQV 529

Query: 720 DDAVRN 725
           ++ + N
Sbjct: 530 NNVIEN 535

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  163 bits (413), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 154/528 (29%), Positives = 234/528 (44%), Gaps = 85/528 (16%)

Query: 36  VGVDVGTGSARACII----DSMGNILSLAERPIQREQLKANF--ITQSSQEIWQAVCHCV 89
           +G+D+G+ S R  I     DS+  + S    P   E  + +    TQ S EI  A+  C 
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFS-KPVPYYYESNRTSLWEYTQDSAEILTAIKECF 66

Query: 90  KSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEE 149
                 + +    +   G  ATCSLV+ E   +             +N++ WMD  A EE
Sbjct: 67  DM----ADLQKYDVKSCGVAATCSLVLCERSGDDTFQ---HCEGDSRNVVFWMDSMAKEE 119

Query: 150 TQLINATGDK-CLKYVGGQMSVEMEIPKI-KWLKNHLPENKFN-ECKFFDLADYLTFKAS 206
           T  +NA   +  L ++GG    EM IPK+ ++LK+   E K N + + FDL  Y+ +K +
Sbjct: 120 TNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKLA 179

Query: 207 GKETRSFCSTVCKQGLLP----VGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNS 262
               + +C    +    P    +G +G   GWS+ F           D   R+  +V   
Sbjct: 180 ----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFY----------DKIVRLPPNVT-- 223

Query: 263 DKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVK 322
                       IG    T+  E  L    V+    ID Y+ W   + +           
Sbjct: 224 ------------IGC-PKTIENEDSL----VIVDSCIDCYSSWFSPLQS----------- 255

Query: 323 TDQEKVGMDRATGRLAAVAGTSTCHI---AMSRDPIFVDGVWGPYRDALATNFWCAEGGQ 379
                  +++ T  L  VAGTSTC+I      +    V G+WGP+ D L  N    E G 
Sbjct: 256 -------LNKNT--LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGS 306

Query: 380 SCTGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFF 439
           SC+G L+ H+ T+HP+   L+ L+    +SK +   +  ET    Q A S+   A + F 
Sbjct: 307 SCSGKLIEHLFTSHPSAISLN-LSTGQLISKLEEEINIWET----QNATSIHFEACNNFL 361

Query: 440 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHD 499
           YGD  GNR+P  DP MR   IG+S D S  DL + Y+   E +A QT+ +VD      + 
Sbjct: 362 YGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNF-EKLNS 420

Query: 500 LSAIFMSGGQCRNGLLMRL--LADCTGLPIVIPRYIDAAVVFGSALLG 545
           ++ +F+ G Q +N  L++L  L +   L +V     D   V G+ LLG
Sbjct: 421 INELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  163 bits (413), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 148/525 (28%), Positives = 220/525 (41%), Gaps = 81/525 (15%)

Query: 36  VGVDVGTGSARACIID-SMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVVR 94
           +G+D+G+   R    +      +++  R +   + +    TQSS EI +A+  C +S+  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 95  DSGVPAEKIHGIGFDATCSLVVVEEQTNK---EVAVGPDFSN-TDQNIILWMDHRAIEET 150
              +    +   G  ATCSL V    + K      V  D     DQN++ WMD  AIEE 
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 151 QLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKET 210
             IN        Y GG    EM +PK+        +N  ++ + FDL  Y+ +  + +  
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN-SDFEVFDLHTYVAYDLANRYG 182

Query: 211 RSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLS 270
                 + +     +G +G  +GW  EF  +     L      RIG    N         
Sbjct: 183 WDASFLINRPNHNGIGHDGEIKGWKDEFYEKT----LKLPPNVRIGPLCINRRFSP---- 234

Query: 271 AGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGM 330
                                 V  +  ID Y+ W    ++  + S              
Sbjct: 235 ----------------------VKVASCIDCYSSWFSMFSSTPERS-------------- 258

Query: 331 DRATGRLAAVAGTSTCHIAMSRDPI-FVDGVWGPYRDALAT----NFWCAEGGQSCTGAL 385
                 L   AGTSTC++  +  P   + G+WGP+ D L +    ++   E GQS TG L
Sbjct: 259 ------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKL 312

Query: 386 LAHVLTTHPAYTELSQLADAASVSKFDYLNSRLET---LAQQQKARSVVHLAKHLFFYGD 442
           + H+  +HPA      L D       + L +RLET   L +QQ A SV    KH+F YG+
Sbjct: 313 IEHLFESHPAAKPY--LEDR------NVLFNRLETEINLIEQQSAESVHFKTKHMFNYGE 364

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSA 502
             GNR+P  DP M    IG+S D S  DL L Y+   EF+A Q R I  K C  G  ++ 
Sbjct: 365 LQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHI--KECL-GAPIND 421

Query: 503 IFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSALLG 545
           I ++G Q +N  L+ L++    G  + IP    D   V G+ LLG
Sbjct: 422 IRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLG 466

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 26/34 (76%)

Query: 690 EENADRVLLNAKYKIFLDMAETQRKYRTIVDDAV 723
           EEN  R L   KYKI+L+MA+TQR+YR +V+ A+
Sbjct: 500 EENKLRALFEIKYKIYLNMAQTQRQYREMVNAAL 533

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  127 bits (318), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 122/497 (24%), Positives = 209/497 (42%), Gaps = 80/497 (16%)

Query: 36  VGVDVGTGSARACIIDSMGN-ILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVVR 94
           +GVD+G+   R  I D   + ++   +  +   +     ITQ + +I  AV     ++  
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGIITQCTSDILTAVEKAFNTLY- 64

Query: 95  DSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVG--PDFSNTDQNIILWMDHRAIEETQL 152
              +    I  +G  ATCS+VV +++    +      D +    +II WM   AIEET+ 
Sbjct: 65  ---IQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEETEY 121

Query: 153 IN-ATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211
           +N  T +  L + GG+   EM IPK+  L     ++        DL  +L +K S K   
Sbjct: 122 LNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGLT---VLDLHIWLLWKISLKLGH 178

Query: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271
                V +     +G +G   GWS+EF   + L ++                        
Sbjct: 179 KELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI------------------------ 214

Query: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331
             FIG  +A + +     + C      ID YA W    +                   ++
Sbjct: 215 --FIGN-NAVIKKNEQFGDSC------IDCYASWFQCWSTAM----------------LN 249

Query: 332 RATGRLAAVAGTSTCHIAMSR-DPIFVDGVWGPYRDALAT--------NFWCAEGGQSCT 382
           R    L  VAGTSTC +  S     F+ G+WGP++D L          N+   E G S T
Sbjct: 250 RT---LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRT 306

Query: 383 GALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGD 442
           G LL  +L+THPA  +       + V+  + +  +++ L +Q   +S+  + K+ FF+ D
Sbjct: 307 GVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFFHED 358

Query: 443 YHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSA 502
           Y    S         +I+ +  + ++ DLAL Y+   E +A Q   +++        +S 
Sbjct: 359 YEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITISK 418

Query: 503 IFMSGGQCRNGLLMRLL 519
           + ++G Q +N  L+++L
Sbjct: 419 LLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 116/525 (22%), Positives = 200/525 (38%), Gaps = 107/525 (20%)

Query: 36  VGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVVRD 95
           +G+DVG+ S R  I +          + I +E L  +   +   ++W    +    V+RD
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGT---TIKTIVKEMLYKH---EPDSKLWHYTQNAF--VMRD 56

Query: 96  SGVPA-EKIHG-------IGFDATCSLVVVEEQTN----KEVAVGPDFSNTDQNIILWMD 143
           S   A E++H         G  ATCS+V ++  +     + + +  + +N   +II W D
Sbjct: 57  SIFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKD 116

Query: 144 HRAIEETQLIN-----------ATGDKCLKYVGGQMSV--EMEIPKIKWLKNHLPENKFN 190
           H A  E Q +N              +K L  +G +     EM IPK+  L N + E  + 
Sbjct: 117 HTAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYE 176

Query: 191 ECKFFDLADYLTFKASGKETRSFCSTV---CKQGLLPVGVEGSAEGWSREFLTEIGLEEL 247
                ++ D   + A     +   +TV    K  +  +G++G  +GW   F     +  L
Sbjct: 177 TPHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFY----VWAL 232

Query: 248 IEDDFRRIGGSVKNSDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVG 307
            E  F    G  K                     V  E  +    V     ID YA W  
Sbjct: 233 PETSFPICIGPSK---------------------VINETSI----VRPKSCIDCYASWFS 267

Query: 308 TVAARTDVSIPALVKTDQEKVGMDRATGRLAAVAGTSTCHI-AMSRDPIFVDG------- 359
           T A   D                      L   AGTSTC + AM R  +   G       
Sbjct: 268 TDACTKD--------------------DTLFMAAGTSTCCLYAMPRSALEYFGEQQQPLS 307

Query: 360 -VWGPYRDALATNFWCA-EGGQSCTGALLAHVLTTHPAYTELSQLADAASVSK-FDYLNS 416
             WGP+ + L  +   + E G S TG LL  +   H       Q+  + SV++  +Y+ +
Sbjct: 308 LFWGPFTNVLDKDKKSSFEIGFSETGILLEKLFNKH-------QITASWSVAESINYVEN 360

Query: 417 RLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA--DPSMRAAIIGQSMDNSIDDLALM 474
           ++  + +++K+ S ++L   ++ +  Y     P     P          + +S   L   
Sbjct: 361 QI-AIYERKKSHS-IYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFK 418

Query: 475 YLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNGLLMRLL 519
           Y+   E++A Q   ++ +       ++ + +SG Q +N  L+ L+
Sbjct: 419 YIAILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 56/122 (45%), Gaps = 15/122 (12%)

Query: 437 LFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCT- 495
           + F   ++G  +P  DP  RA I+G S   +   +A     A E +  Q R I+  M + 
Sbjct: 503 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMGSD 559

Query: 496 --------SGHDLSAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAV 547
                      +L+ + + GG  ++  +M++ AD  G  I + R   + +V  +AL  A+
Sbjct: 560 EVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRR---SPIVECTALGAAI 616

Query: 548 AS 549
           A+
Sbjct: 617 AA 618

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 61/158 (38%), Gaps = 23/158 (14%)

Query: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQ-KARSVVHLAKHLFFYGDYHGNRSPIAD 452
           P Y     +A A +V ++   N RL   A+      S V  +  + F   + G  +P  D
Sbjct: 412 PHYALEGSVAVAGAVVQWLRDNLRLIPRAEDVGPLASAVPNSGGVVFVPAFSGLFAPYWD 471

Query: 453 PSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHD------------- 499
           P  RA I+G S   +   +A     A E +  Q R I+  M +                 
Sbjct: 472 PDARATIMGMSQYTTASHIA---RAAVEGVCFQARAILKAMSSDAFGSEDKDFLEEVVDE 528

Query: 500 ------LSAIFMSGGQCRNGLLMRLLADCTGLPIVIPR 531
                 LS + + GG  R+  +M++ AD  G  + + R
Sbjct: 529 TYEKTLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRR 566

>Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013C
           (PDR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 207]
           FULL
          Length = 924

 Score = 31.6 bits (70), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 394 PAYTELSQLADAASVSKFDYLNSRLET-LAQQQKARSVVHLAKHLFFYGDYH 444
           P   +L ++ +A S+  F+YLN  + T +       S++ L KH ++ G+YH
Sbjct: 382 PFVKDLIRIKEAISILSFEYLNLTMHTPVGDLDFFESLLILIKHQYWIGEYH 433

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,442,712
Number of extensions: 2797378
Number of successful extensions: 7386
Number of sequences better than 10.0: 40
Number of HSP's gapped: 7489
Number of HSP's successfully gapped: 71
Length of query: 725
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 608
Effective length of database: 40,065,477
Effective search space: 24359810016
Effective search space used: 24359810016
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)