Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13772g8.258ON42042021080.0
Kwal_56.238328.258ON41942017900.0
SAKL0H17138g8.258ON41942114880.0
Suva_10.1698.258ON43843814480.0
Smik_12.1448.258ON43843814360.0
Skud_12.1538.258ON43843814330.0
YLR085C (ARP6)8.258ON43843814280.0
KAFR0B027008.258ON42042314200.0
NCAS0B049908.258ON42042114090.0
ZYRO0C01738g8.258ON41442314040.0
NDAI0B019608.258ON43943913800.0
TDEL0F038508.258ON41942113780.0
Ecym_43128.258ON41141713670.0
Kpol_543.368.258ON42742713480.0
AGR091W8.258ON41041713420.0
TBLA0H014608.258ON44244213440.0
CAGL0L12166g8.258ON42141613340.0
KNAG0G020108.258ON42442313021e-178
KLLA0F19063g8.258ON41542512941e-177
TPHA0A018308.258ON42142412791e-175
NCAS0C037008.23ON3753862393e-21
TBLA0C004408.23ON3753862383e-21
TPHA0D002508.23ON3753862365e-21
ZYRO0F02772g8.23ON3753862358e-21
TDEL0C004708.23ON3753862341e-20
CAGL0K12694g8.23ON3753862341e-20
Suva_6.188.23ON3753862341e-20
Smik_6.398.23ON3753862341e-20
YFL039C (ACT1)8.23ON3753862341e-20
NDAI0G030408.23ON3753862341e-20
KNAG0L002508.23ON3753862341e-20
KAFR0D009408.23ON3753862341e-20
Kpol_1058.158.23ON3753862303e-20
SAKL0B00968g8.23ON3753862287e-20
ABR222W8.23ON3763862277e-20
KLLA0D05357g8.23ON3753862271e-19
NCAS0C035503.161ON3923792252e-19
TBLA0F008703.161ON3913902252e-19
KLTH0G18832g8.23ON3753862223e-19
Ecym_15208.23ON3763892215e-19
NDAI0G029003.161ON3913792215e-19
TDEL0D046103.161ON3913782191e-18
Smik_4.2063.161ON3913822182e-18
YDL029W (ARP2)3.161ON3913822182e-18
KLTH0F06490g3.161ON3913802153e-18
ZYRO0B04928g3.161ON3913862153e-18
Suva_4.2203.161ON3913822154e-18
Skud_4.2223.161ON3913722136e-18
KNAG0K01130na 1ON3933852128e-18
CAGL0K01595g3.161ON3913822111e-17
Kpol_1023.188.23ON3193362072e-17
Skud_6.318.23ON3603402056e-17
KLLA0C03850g3.161ON3913822057e-17
SAKL0C07370g3.161ON3913822049e-17
Ecym_52373.161ON3913772012e-16
KLLA0E22925g2.117ON3803802012e-16
Kpol_479.253.161ON3913832003e-16
ADR316W3.161ON3913801994e-16
Kwal_14.11098.23ON3603401932e-15
Ecym_63852.117ON3774161905e-15
NCAS0B071302.117ON3813711897e-15
TPHA0A009203.161ON3913841899e-15
AFR051W2.117ON4053801899e-15
NDAI0B044602.117ON3813841844e-14
SAKL0E11814g2.117ON3793661818e-14
Kwal_33.141773.161ON3373191808e-14
TDEL0B048102.117ON3734101711e-12
KAFR0C01040na 1ON3373291701e-12
ZYRO0G05676g2.117ON3813681613e-11
TPHA0I013002.117ON3794081604e-11
Kwal_33.146422.117ON3833791552e-10
YHR129C (ARP1)2.117ON3843841542e-10
CAGL0H09042g2.117ON3873791523e-10
Skud_8.1902.117ON3843901523e-10
KAFR0F005902.117ON3863821472e-09
TBLA0B010702.117ON3833861462e-09
Smik_8.2102.117ON3844081453e-09
KLTH0B05940g2.117ON3834091443e-09
Suva_15.3262.117ON3843721434e-09
SAKL0D12804g1.514ON4563611411e-08
KLTH0C02508g1.514ON4513611392e-08
TBLA0D036801.514ON4583801382e-08
KAFR0D037001.514ON4493611364e-08
ZYRO0G01936g1.514ON4613241364e-08
KNAG0B001701.514ON4533611331e-07
AFR419C1.514ON4553611312e-07
Skud_10.2891.514ON4493661302e-07
Suva_12.1541.514ON4493291293e-07
TPHA0O010401.514ON4583621284e-07
Smik_10.3551.514ON4493291284e-07
Ecym_31531.514ON4583241284e-07
Kpol_1056.161.514ON4603281284e-07
KLLA0B13904g1.514ON4563291284e-07
NDAI0A039701.514ON4623681274e-07
NCAS0A122701.514ON4543291275e-07
KNAG0H036502.117ON3873771257e-07
CAGL0F00517g1.514ON4543241259e-07
YJR065C (ARP3)1.514ON4493291241e-06
Smik_10.1611.287ON4892221241e-06
TDEL0F004701.514ON4613691231e-06
Kwal_27.99581.514ON4453281203e-06
YJL081C (ARP4)1.287ON4892221204e-06
NDAI0G055801.287ON5152271186e-06
Skud_10.1321.287ON4882241179e-06
Suva_6.1541.287ON4892221161e-05
Kpol_282.41.287ON5012391071e-04
TBLA0E038602.248ON7592291072e-04
KLLA0D02288g1.287ON5203191034e-04
AFR105C1.287ON4792241034e-04
NCAS0B060601.287ON4972491000.001
Ecym_63301.287ON480333990.001
Kwal_14.23771.287ON481224990.001
ZYRO0G21428g1.287ON483229980.002
SAKL0D05874g1.287ON497236980.002
KLTH0G09482g2.248ON745226970.002
CAGL0M03201g1.287ON493234960.003
KNAG0B019201.287ON505241960.003
KLTH0H09702g1.287ON481224950.004
TPHA0I010301.287ON503241890.019
Kwal_23.48482.248ON745265880.032
TBLA0D053601.287ON596157870.038
KAFR0A015601.287ON485227870.040
Suva_14.2812.248ON755235860.051
KLLA0F03421g2.248ON747233850.065
YNL059C (ARP5)2.248ON755236840.086
ADL253C2.248ON751135810.25
Kpol_520.117.448ON488176800.25
NCAS0G030502.248ON74347780.51
KNAG0I026506.373ON209140780.59
TDEL0D015501.287ON480224770.62
KAFR0D010308.50ON73076751.0
Skud_14.2722.248ON755227722.5
NDAI0A002001.11ON33034703.2
KNAG0B002401.509ON118291714.2
KNAG0I018602.248ON753229704.6
KAFR0J011602.248ON751230695.3
TDEL0C031207.448ON438146686.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13772g
         (420 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   816   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   694   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   577   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   562   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   557   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   556   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   554   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   551   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   547   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   545   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   536   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   535   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   531   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   523   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   521   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   522   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   518   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   506   e-178
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   503   e-177
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   497   e-175
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    97   3e-21
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    96   3e-21
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    96   5e-21
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    95   8e-21
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    95   1e-20
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    95   1e-20
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    95   1e-20
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    95   1e-20
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    95   1e-20
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    95   1e-20
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    95   1e-20
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    95   1e-20
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    93   3e-20
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    92   7e-20
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    92   7e-20
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    92   1e-19
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    91   2e-19
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    91   2e-19
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    90   3e-19
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    90   5e-19
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    90   5e-19
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    89   1e-18
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    89   2e-18
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    89   2e-18
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    87   3e-18
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    87   3e-18
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    87   4e-18
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    87   6e-18
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    86   8e-18
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    86   1e-17
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    84   2e-17
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    84   6e-17
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    84   7e-17
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    83   9e-17
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    82   2e-16
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    82   2e-16
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    82   3e-16
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    81   4e-16
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    79   2e-15
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    78   5e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    77   7e-15
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    77   9e-15
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    77   9e-15
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    75   4e-14
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    74   8e-14
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    74   8e-14
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    70   1e-12
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    70   1e-12
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    67   3e-11
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    66   4e-11
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    64   2e-10
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    64   2e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    63   3e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    63   3e-10
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    61   2e-09
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    61   2e-09
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    60   3e-09
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    60   3e-09
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    60   4e-09
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    59   1e-08
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    58   2e-08
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    58   2e-08
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    57   4e-08
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    57   4e-08
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    56   1e-07
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    55   2e-07
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    55   2e-07
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    54   3e-07
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    54   4e-07
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    54   4e-07
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    54   4e-07
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    54   4e-07
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    54   4e-07
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     54   4e-07
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    54   5e-07
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    53   7e-07
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    53   9e-07
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    52   1e-06
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    52   1e-06
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    52   1e-06
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    51   3e-06
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    51   4e-06
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    50   6e-06
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    50   9e-06
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    49   1e-05
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    46   1e-04
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    46   2e-04
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    44   4e-04
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    44   4e-04
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    43   0.001
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    43   0.001
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    43   0.001
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    42   0.002
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    42   0.002
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    42   0.002
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    42   0.003
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    42   0.003
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    41   0.004
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    39   0.019
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    39   0.032
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    38   0.038
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    38   0.040
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    38   0.051
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    37   0.065
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    37   0.086
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    36   0.25 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    35   0.25 
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    35   0.51 
KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {...    35   0.59 
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    34   0.62 
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    33   1.0  
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    32   2.5  
NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11         32   3.2  
KNAG0B00240 Chr2 complement(30285..33833) [3549 bp, 1182 aa] {ON...    32   4.2  
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    32   4.6  
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    31   5.3  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    31   6.3  

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/420 (94%), Positives = 395/420 (94%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
           NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM
Sbjct: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300
           SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF
Sbjct: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300

Query: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCP 360
           HPEIASLLNPGIIEAILESISMLPEALRPLL            IPNFASRLATELQRQCP
Sbjct: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCP 360

Query: 361 TDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAWL 420
           TDWSCRVSVPTGDARLYGWKCMQKFSETQA             HGVDWCTSKRFGYQAWL
Sbjct: 361 TDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAWL 420

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/420 (78%), Positives = 367/420 (87%), Gaps = 1/420 (0%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           MEE+P++IDNGSYEIKFG+ S  EP  ALNSIAKDKYGNYHLSNQVRSIKDISSV FNRP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQLVSWELE+QIWDYCLFNPD+F+GWS+DTTK KHLI SESCMT+PELSKNMDQVVF
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           EEYE++++FKAPVPVFVPFN    +TH+LVAKED++V  S+  +  K+Y D++LVIDSGF
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEV-APAKNYNDFQLVIDSGF 179

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
           NC+W+VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKE CLFM
Sbjct: 180 NCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFM 239

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300
           SPN+YF+SFQSR KTAKEYVLPDF+TSFQGYLRKPGQ LP +SQTI+LQDELFAVPETFF
Sbjct: 240 SPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFF 299

Query: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCP 360
           HPEIASLLN GI+E ILESISMLPEA+RPL+            IPNFASRLATELQRQCP
Sbjct: 300 HPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCP 359

Query: 361 TDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAWL 420
           TDWSCRVS+P GDA LYGWKCMQKFSET+              HGVDWCT+KRFGYQAWL
Sbjct: 360 TDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/421 (64%), Positives = 325/421 (77%), Gaps = 3/421 (0%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           M++ PI+IDNGSYE+KFG A+++ PF ALN++A+DKYGN HLSNQV  +KDIS+V F RP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL SWEL+S IWDYCL+NPDEF+ W +  TK KHL+ SE CM++PELSK  DQVVF
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           EEYE+ S FK PV  FVPFN +    +++ AKED+ V   D   +  +Y D++LVIDSGF
Sbjct: 120 EEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDS-VYRKDSTGERNEYNDFQLVIDSGF 178

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
           NCTWVVP++KG+PYYKA+KKLDIGGRFLNGFL+E LSFRHYNVMDETILVN+IKEKCLFM
Sbjct: 179 NCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFM 238

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300
           SP SYF+SFQ +  T  EYVLPDF TSFQGY+++  Q +PEDSQTI L DELF++PETFF
Sbjct: 239 SPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFF 298

Query: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCP 360
           HPEIASLL PGI+E ILESISMLPEA+RPL+            I NFA RLATELQRQCP
Sbjct: 299 HPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCP 358

Query: 361 TDWSCRVSVPTG-DARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAW 419
           TDW   VSVP   D  L+GW  M++FS+T A             HGVDWCT +RFGYQ W
Sbjct: 359 TDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKW 418

Query: 420 L 420
           L
Sbjct: 419 L 419

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/438 (61%), Positives = 324/438 (73%), Gaps = 18/438 (4%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME  PIVIDNGSYEIKFG +++  PF ALN++AKDK+G  +LSN +++IKDISSVTF RP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL  WELES IWDYCLFNP EFDG+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVVASD---------HPSD---- 165
           EEYE+DSLFK+PV VFVPF    +G    I    EDADV  SD          P D    
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225
           N DY D++LVIDSGF+CTW++PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT---LPED 282
           ETILVN+IKEKCLF+SP SYFDSF+S+ K   EYVLPDF TSF GY+R P +    LP D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXX 342
           +Q+I L DELF +PETFFHPEI+ ++ PGI+EAILES+SMLPE +RPL+           
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 343 XIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXX 402
            +PNFA RLA ELQRQ PTDW+C VSVP GD  L+GW+ M +F++T++            
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 403 XHGVDWCTSKRFGYQAWL 420
            HG DWCT  RFGYQ W+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/438 (61%), Positives = 320/438 (73%), Gaps = 18/438 (4%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME APIVIDNGSYEIKFG +++ +PF ALN++AKDK+G  +LSN +++IKDISSVTF RP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL  WELES IWDYC FNP EFDG+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVVAS-----DHPSDN------- 166
           EEYE+DSLFK+PV  FVPF    +     I    EDAD+V S     D PS+N       
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 167 -KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225
             DY D++LVIDSGFNCTW++PV+KG+PYYKAVKKLD+GGRFL G L+E LSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYL---RKPGQTLPED 282
           ETILVN+IKEKCLF+SP SYFDSF+ + K A EYVLPDF TSF GY+   RK    L ED
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXX 342
           +QTI L DELF +PETFFHPEIA +  PGI+EAILES+SMLPE +RPL+           
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 XIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXX 402
            +PNFA RLA ELQRQ PTDW+C VSVP  D  L+GW+ M +FS T +            
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 403 XHGVDWCTSKRFGYQAWL 420
            HG DWCT  RFGYQ W+
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/438 (60%), Positives = 324/438 (73%), Gaps = 18/438 (4%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME +PIVIDNGSYEIKF  +++  PF ALN++AKDK+G  +LSN +++IKDISS+TF RP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL  WELES IWDYC FNP EF G+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVVASDH-------------PSD 165
           EEYE+DSLFK+PV VFVPF    +G    I    E+ADVV S+               + 
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225
           + DY D++LVIDSGFNCTW++PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT---LPED 282
           ETILVN++KEKCLF+SP SYFDSF+++ K A EYVLPDF TSF GY+R P +    LPED
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXX 342
           +QTI L DELF +PETFFHPEI+ +  PGI+EAILES+SMLPE +RPL+           
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 XIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXX 402
            +PNFA RLA ELQRQ PTDW+C VSVP GD  L+GW+ M +F++T++            
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 403 XHGVDWCTSKRFGYQAWL 420
            HG DWCT +RFGYQ W+
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/438 (60%), Positives = 322/438 (73%), Gaps = 18/438 (4%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME  PIVIDNGSYEIKFG +++ +PF ALN++AKDK+G  +LSN +++IKDISS+TF RP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL  WELES IWDYCLFNP EFDG+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVV-------------ASDHPSD 165
           EEYE+DSLFK+PV VFVPF    +G+   I    ED D+V             + +    
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225
             DY D++LVIDSGFNCTW++PV+KG+PYYKAVKKLDIGGRFL G L+E LSFRHYN+MD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT---LPED 282
           ETILVN+IKE+CLF+SP SYFDSF+++ K A EYVLPDF TSF GY+R P +    LPED
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXX 342
           +Q I L DELF +PETFFHPEI+ +  PGI+EAILES+SMLPE +RPL+           
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 343 XIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXX 402
            +PNFA RLA ELQRQ PTDW+C VSVP GD  L+GW+ M +F++T +            
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 403 XHGVDWCTSKRFGYQAWL 420
            HG DWCT  RFGYQ W+
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 323/423 (76%), Gaps = 6/423 (1%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           MEE P+VIDNGSY +KFG AS   P+ ALN+IA DKY   +LSNQ++SIKDISSV+  RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H LGQL SWE+++ IWDYCL+NPDEF+G+++  TK+KHLI SE+CMTLPEL KNMDQV+F
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           EEYE+ SL K+PV  ++PF        I++ + D +    + PS  ++YRD++LV+DSGF
Sbjct: 121 EEYEFGSLMKSPVAGYMPF-LRNTKDQIIIGERDTEPFV-ETPS-TEEYRDFQLVVDSGF 177

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
           NCTW++PVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKEKCLF+
Sbjct: 178 NCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFV 237

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---KPGQTLPEDSQTIILQDELFAVPE 297
           SP SYFDSF+++  T++EYVLPDF TSF GY+R   + G+ LPEDSQ+I L+DELFAVPE
Sbjct: 238 SPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPE 297

Query: 298 TFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQR 357
           TFFHPEI+ +L PG++E ILES+SM+PE +RPL+            +P+FASR+A ELQR
Sbjct: 298 TFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQR 357

Query: 358 QCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQ 417
           Q PTDW CR+++  G++ L GWK M  F+ T               HG+DWCT  RFGYQ
Sbjct: 358 QLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQ 417

Query: 418 AWL 420
            W+
Sbjct: 418 NWV 420

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/421 (61%), Positives = 320/421 (76%), Gaps = 2/421 (0%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME +PI IDNGSYEIKFGT   + P+ A+N+ A DKY   +LSNQ+++IKDI+SVTF RP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL SWELES IWDY LFNPDEF G+ L+  K KHLIASE+CMTLPELSKNMDQVVF
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV-VASDHPSDNKDYRDYELVIDSG 179
           EEYE+DS +K+ +  F+ F A+   T I+  K + D+ + S +    K+Y DY+LVIDSG
Sbjct: 121 EEYEFDSYYKSSIAGFIQF-ADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSG 179

Query: 180 FNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLF 239
           FNCTW++PVIKGVPYYKAVKKLDIGGRFL+G L+E LSFRHY+VMDETILVN+IKE CLF
Sbjct: 180 FNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLF 239

Query: 240 MSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETF 299
           +SP SYFDSF+++ +TA EYVLP+F T+F G++R   + LPE++QTI L DELF+VPETF
Sbjct: 240 VSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETF 299

Query: 300 FHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQC 359
           FHPEIA +L PG++E ILES+SM+PE LRPLL            +P+FA+RL +ELQRQ 
Sbjct: 300 FHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQL 359

Query: 360 PTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAW 419
           PTDW CR SVPT +  L+GWK M +F+ T++             HG DW T  RFGYQ W
Sbjct: 360 PTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNW 419

Query: 420 L 420
           +
Sbjct: 420 I 420

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 313/423 (73%), Gaps = 12/423 (2%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME  PIV+DNGSYEIKFGT     P  A N++A+DK+G+Y+LSNQ+++IKDISSV F RP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+ GQL SWELES IWDYC FNPDEF+G+ L  +K +HL+ SE+CMT+PELSKNMDQVVF
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKD---YRDYELVID 177
           EEYE+ S+FK+P+  F PF   G  +  +  K D      D P+   +   Y  ++LVID
Sbjct: 121 EEYEFASMFKSPIAGFAPF---GRPSIAISGKGD------DQPNRKAEPDAYEPFQLVID 171

Query: 178 SGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKC 237
            GFNCTWVVPVIKG+PYYKAVKKLDIGGRFLNG L+E LSFRHYNVMDETILVN+IKE C
Sbjct: 172 VGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENC 231

Query: 238 LFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPE 297
           LF+SP SYF+SF+ + +TA EYVLPDF TSF GY++ P + LP+DSQT+ L+DELF+VPE
Sbjct: 232 LFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPE 291

Query: 298 TFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQR 357
           TFFHPEI  LL PGIIE ILES+S+LPE LRPL+            +PNFA+RLATELQR
Sbjct: 292 TFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQR 351

Query: 358 QCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQ 417
           Q PTDW+C V +P+G   LYGW  M  F+ +               HGVDWCT  RFGYQ
Sbjct: 352 QLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQ 411

Query: 418 AWL 420
            W+
Sbjct: 412 NWM 414

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/439 (57%), Positives = 322/439 (73%), Gaps = 19/439 (4%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           M+  P+V+DNGSYEIKFG ++S  P+ ALN  A DKYG+ +LSNQ++ I+++S VT  RP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQL SWELES IWDYCL+NPDEFDG+ L  +  KHLI SE CMTLPELSKNMDQV+F
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILV-----AKEDADV--------VASDHPSDNK 167
           EEYE+DSLFKAP   ++PF  + D   +L+      K D D+        +++D+  D+K
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 168 -----DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYN 222
                DY+DYELVIDSGFNCTW++P+IKGVPYYKA+KKLDIGGRFL G L+E LSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 223 VMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRK-PGQTLPE 281
           +MDET+LVN+IKEKCLF+SP SYFDSF+++ +T+ EY+LPD S+S+ GY R+   + LPE
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPE 300

Query: 282 DSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXX 341
            SQ + L DELF+VPETFFHPEI+ +L PGI+E ILES+SM+PE LRPLL          
Sbjct: 301 GSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGN 360

Query: 342 XXIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXX 401
             +P+FA+RLA ELQRQ PTDW+CR+SVP  +  L+ WK M +F+ T +           
Sbjct: 361 FNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEY 420

Query: 402 XXHGVDWCTSKRFGYQAWL 420
             HG DW T  +FGYQ WL
Sbjct: 421 YEHGPDWLTKHKFGYQNWL 439

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/421 (59%), Positives = 314/421 (74%), Gaps = 3/421 (0%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME  P+V+DNGSYE+KFG +++++PF ALN++A+DK+G  +LSNQ+  IKDISSV+F RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+ GQL SWEL+S +WDYC FNP+EFDG+ L  +K +HLIASE+CMTLPELSKNMDQVVF
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           EEYE+DSL KAP+  F+PF+   + T ++  K D++   S   S+ KDY  +++VIDSGF
Sbjct: 121 EEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTST--SETKDYEPFQMVIDSGF 178

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
           NCTWVVP+IKGVP+YKAVKKLD+GGRF+NG L+E LSFRHYNVMDETILVN+IKEKCLFM
Sbjct: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFM 238

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFF 300
           SP SYFDSF  + +TA EYVLPDF T+F GY+        +D+QT+ L+DELF+VPETFF
Sbjct: 239 SPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFF 298

Query: 301 HPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCP 360
           HPEIA LL PGIIE ILES+S++PE LRPL+            +P+F  RLATELQRQ P
Sbjct: 299 HPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLP 358

Query: 361 TDWSCRVSVPT-GDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAW 419
           TDWS ++ +P      L GW  M  F+ T               HGV+W T  RFGYQ W
Sbjct: 359 TDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNW 418

Query: 420 L 420
           +
Sbjct: 419 I 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/417 (59%), Positives = 305/417 (73%), Gaps = 8/417 (1%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKL 63
            PI+IDNGSYEIKFG +S   P+ ALN +A+DKYG YHLSNQ++ I+++S+    RP +L
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 64  GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEY 123
           GQLVSWELE  IWDYCLFN DEF  W L  +K+  LI SE+CM++PE+SK+MDQVVFEEY
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121

Query: 124 EYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCT 183
           E+ SL K PV  ++PF+   D  + +   +   VV         DY D++LV+DSGFNCT
Sbjct: 122 EFGSLMKCPVAQYIPFDNMAD--YKVYGSDGLPVVRK-----KDDYNDFQLVVDSGFNCT 174

Query: 184 WVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPN 243
           WV+PVIKGVPYYKAVKKLDIGGRFL G L+E +SFRHYN+MDETIL N+IKE+C FM P 
Sbjct: 175 WVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPV 234

Query: 244 SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFFHPE 303
           SYFDSFQ + +T  +YVLPDF TS  GY+R+P Q +PEDSQT+ L+DELF +PETFFHPE
Sbjct: 235 SYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPE 294

Query: 304 IASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCPTDW 363
           IA++L PG+IE +LESISMLPE +RPL+            I NFASRLATELQRQCPTDW
Sbjct: 295 IANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDW 354

Query: 364 SCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAWL 420
           S RV +P GD  L GWK M +FS T +             HGVDWCT  RFGY+ W+
Sbjct: 355 SVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 312/427 (73%), Gaps = 7/427 (1%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           ME+ PIVIDNGSYE+KFG + +  P  ALN++AKDKYG ++LSNQ+ +IKDISSVT  RP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQLVSWELE  +WDYC FNPDEF  ++L  TK  HL+ SE+CMTLPELS NMDQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKED---ADVVASDHPSDNKD-YRDYELVI 176
           EEYE++SLFK+PV  FVPF    D   ++  K D    D++++    + K+ Y D+ LVI
Sbjct: 121 EEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVI 180

Query: 177 DSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEK 236
           DSGFNCTW++P+IKGVPYYKAVKK+++GGRFLNG  +E +S+RHY+V DETILVN+IKEK
Sbjct: 181 DSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEK 240

Query: 237 CLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYL--RKPGQTLPEDSQTIILQDELFA 294
           CLFMSP SY DSF+++ + + +YVLPDF TSF GY+  +K    LPE+SQ I L DELF+
Sbjct: 241 CLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFS 300

Query: 295 VPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATE 354
           VPET FHPE+A LL PGI+E ILES+S++PE +RPLL            +PNF SRLATE
Sbjct: 301 VPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATE 360

Query: 355 LQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSE-TQAXXXXXXXXXXXXXHGVDWCTSKR 413
           LQRQ PTDW C + +P  D  L GWK M +F++ T               HG DW T KR
Sbjct: 361 LQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKR 420

Query: 414 FGYQAWL 420
           FGYQ W+
Sbjct: 421 FGYQNWI 427

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/417 (58%), Positives = 301/417 (72%), Gaps = 9/417 (2%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKL 63
            P++++NGSYEIKFG A+   P+ A N + +D+YG YHLSNQ+  I+DIS     RP +L
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 64  GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEY 123
           GQL+SWELE QIWDYCLFNPDEF GW L  +K+  LIASE+CMT+PE+SKNMDQVVFEEY
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121

Query: 124 EYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCT 183
           E+ S+ K PV  FVPF+   D   +  A E  +  +         Y +++LV+DSGFNCT
Sbjct: 122 EFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSG--------YNNFQLVVDSGFNCT 173

Query: 184 WVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPN 243
           WV+PVIKGVPYYKA KKLDIGGRFLNG L+E +SFRHYNVMDETIL+N+IKE+C FM P 
Sbjct: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPV 233

Query: 244 SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFFHPE 303
           SYFDSFQ + +T  EY+LPDF TS  GY+R+P Q +P+ SQ + L+DELF VPETFFHPE
Sbjct: 234 SYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPE 293

Query: 304 IASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCPTDW 363
           I+++L PG++E ILE +SM+PE LRPLL            I NFA+RLATELQRQCPTDW
Sbjct: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDW 353

Query: 364 SCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAWL 420
             RV  P  DA L GWK M++FS+T +             HG DWCT  RFGY+ W+
Sbjct: 354 KVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  522 bits (1344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/442 (54%), Positives = 318/442 (71%), Gaps = 22/442 (4%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           M++ PIVIDNGSYEIKFG ++S  PF A+N+IAKDKY   +LSNQ++ IKDISSV F RP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           ++LGQL SWELES IWDYC +NP+EFDG+ L+ T  KHL+ SE+C++LPE S+N+D ++F
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEYDSLFKAPVPVFVPF-NAEGDTTHI------------------LVAKEDADVVASD 161
           EEY Y S++K+PV  F+PF +   D   I                  LV  +    ++S+
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSE 180

Query: 162 HPSDNK--DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219
            PS  K  +Y+D++L+IDSGFNCTW++PVIKG+PYYKA+KK+DIGGRFL G L+E LSFR
Sbjct: 181 EPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFR 240

Query: 220 HYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT- 278
           HYNV DETILVN+IKEKCLF++P SY +SF+ + KTA EYVLPDF T+F GY++   +T 
Sbjct: 241 HYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTK 300

Query: 279 LPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXX 338
           LP+++Q I L+DELF+V ET FHPEI+ +L PGIIE I+ES+SMLPE +RPL+       
Sbjct: 301 LPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCI 360

Query: 339 XXXXXIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXX 398
                +PNF+ RL +ELQRQ PTDW+  V +P  DA L+GWK M +FS+T +        
Sbjct: 361 GGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITR 420

Query: 399 XXXXXHGVDWCTSKRFGYQAWL 420
                HGV+WCT  RFGYQ W+
Sbjct: 421 EEYMEHGVEWCTKHRFGYQNWI 442

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/416 (57%), Positives = 300/416 (72%), Gaps = 2/416 (0%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKLGQ 65
           IVIDNGSY++KFG AS   P  ALN++AKDKYG  HLSNQV++IKDISSV F RPH+LGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEYEY 125
           L SWELES IWDYCL+NPDEF G    + +N+H++ SE+CMTLPELSKN DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKED-ADVVASDHPSDNKDYRDYELVIDSGFNCTW 184
           DSL+KAP   ++PF    +    +  K D  ++   +     K+Y D+ LVIDSGFNCTW
Sbjct: 126 DSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTW 185

Query: 185 VVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNS 244
           V+P++KGVPYYKAVKKLD+GGRFLNG L+E +SFRHYNVMDE+ILVN+IKE+CL++ P S
Sbjct: 186 VIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVS 245

Query: 245 YFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFFHPEI 304
           YF++F+++ K   ++VLPDF TSFQGY+R P   LP+++Q + L DE F+VPE FFHPEI
Sbjct: 246 YFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEI 305

Query: 305 ASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCPTDWS 364
           +  L PGIIE +LESI MLPE LRPL+            +P F  RL +ELQRQ PTDW 
Sbjct: 306 SQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWV 365

Query: 365 CRVSVPTGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQAWL 420
           CR  + +GD  L GW  M KF+ T A             HG+DW T +RFGYQ W+
Sbjct: 366 CRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  506 bits (1302), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 302/423 (71%), Gaps = 6/423 (1%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKL 63
            P VIDNGSYEIKFG A+   PF A N IAKDKYG  +LSN +++I+DISS T  RPH+L
Sbjct: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61

Query: 64  GQLVSWELESQIWDYCLFNPDEFDGWSL-DTTKNKHLIASESCMTLPELSKNMDQVVFEE 122
           GQLVSWELE  IWDYCL+NPDEFDG+ L D T+ + LI +E+C TLPELSKN DQVVFEE
Sbjct: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121

Query: 123 YEYDSLFKAPVPVFVPF-NAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFN 181
           YE+ ++FK+P   F+PF N  G+     +  +D  V      +  K+YRD++LVIDSGFN
Sbjct: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFN 181

Query: 182 CTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMS 241
           CTWVVP+IKGVP+YKA+KK+DIGGRFLNG L+E LSFRHYN+MDETIL+N+IKEKCLF+S
Sbjct: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241

Query: 242 PNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDS---QTIILQDELFAVPET 298
           P SYFDSF+++ + A EYVLPDF TSF GYL         D    QTI L DE FAVPET
Sbjct: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301

Query: 299 FFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQ 358
           FFHPE+A++L PG++E ILE+ISM+PE LRP+L            +P+ +SRL +ELQRQ
Sbjct: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361

Query: 359 CPTDWSCRVSVP-TGDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFGYQ 417
            PTDW+CRV+VP + D  L  W  M +FS T               HG DWC+  RF YQ
Sbjct: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421

Query: 418 AWL 420
            W+
Sbjct: 422 NWI 424

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  503 bits (1294), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 239/425 (56%), Positives = 304/425 (71%), Gaps = 15/425 (3%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           M E  +VIDNGSYEIKFG +  ++P  ALN + KDKY  +HLSNQ + ++DIS     RP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSL---DTTKNKHLIASESCMTLPELSKNMDQ 117
           H+LGQLVSWELES++WDYC +N D+F  W+L   + TK+ HL+ SE+ MT+PELSKNMDQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVID 177
           V+FEEY++ S+FK PV  ++PF  +G        ++DA   A D  + +  Y+D++LVID
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPF-YQGQ------YQDDAMTAAEDKKTSS--YKDFQLVID 170

Query: 178 SGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKC 237
           SGFNCTW VP+IKGVPYYKA+KKLDIGGRFL G L+E +SFRHYNVM+ETILVN+IKE+C
Sbjct: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQC 230

Query: 238 LFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPG-QTLPEDSQTIILQDELFAVP 296
            F+ P SYF SF +++ T  EYVLPDF TSF GY++KPG + L +D+QT++L DE+F+VP
Sbjct: 231 TFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVP 290

Query: 297 ETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQ 356
           ETFFHPEIA +L PGI+E ILE I+M PE +RPLL            IPNF  RL TELQ
Sbjct: 291 ETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350

Query: 357 RQCPTDWSCRVSVPT-GDARLYGWKCMQKFSETQAXXXXXXXXXXXXXHGVDWCTSKRFG 415
           RQCP DWSC+V  P   D  L+GW+ M+ F+ +               HG+DWCT  RFG
Sbjct: 351 RQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFG 410

Query: 416 YQAWL 420
           YQ WL
Sbjct: 411 YQQWL 415

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  497 bits (1279), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/424 (54%), Positives = 305/424 (71%), Gaps = 7/424 (1%)

Query: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60
           M EAP++IDNGSYEIKFG ++   PF ALN++AKDKY  Y+LSNQ+ +IKDISSV+  RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120
           H+LGQLVSWELE +IWDYC +N D+F G+ ++     HL+ +E+ MTLPELS+N DQVVF
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           EEY +DSL+KAP   F+PF    D + I ++ +    +     S   +Y+D+ LVIDSG+
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDG---SKENNYQDFNLVIDSGY 177

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
           NC+W++P+IKGVPYYKAVKK+D+GGRFLNG L+E +S+RHY+V DE++LVN+IKE C+F+
Sbjct: 178 NCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFI 237

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR--KPGQTLPEDSQTIILQDELFAVPET 298
           SP SY +SF+ +  T  EYVLPDF TSF GY+R  K   TLPE SQ+IIL+DELF+VPE 
Sbjct: 238 SPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEG 297

Query: 299 FFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQ 358
           FFHPE+A++L PGIIE ILES+ +LPE+LR L+            IPNF SR+ TELQ+Q
Sbjct: 298 FFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQ 357

Query: 359 CPTDWSCRVSVPTGDARLYGWKCMQKFSET--QAXXXXXXXXXXXXXHGVDWCTSKRFGY 416
             T+W C VS+P  +A L  WK M+ F+E   +              HG +W T +RFGY
Sbjct: 358 VQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417

Query: 417 QAWL 420
           Q WL
Sbjct: 418 QNWL 421

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 153/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP I SL + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 153/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP + SL + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMEVKIIAP 332

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 95.5 bits (236), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 153/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP + SL + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 95.1 bits (235), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 153/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSVEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP + SL + G+ +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTASQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 93/386 (24%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 151/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G      + ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L + GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 92.4 bits (228), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 151/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQILFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR +  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S++ +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSAIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L   GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 92.0 bits (227), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 151/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 60

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 61  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 111

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 112 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 152

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR +  +L + LS R Y  +  
Sbjct: 153 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTT 204

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S++ +     P      D Q
Sbjct: 205 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSAIEKSYELP------DGQ 247

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L   GI +    SI      +R  L             
Sbjct: 248 VITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 307

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 308 PGIAERMQKEITALAPSSMKVKIIAP 333

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKNNREKMTQILFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR +  +L + L+ R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S++ +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTASQ------SSAVEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP + SL   GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 91/379 (24%), Positives = 153/379 (40%), Gaps = 70/379 (18%)

Query: 4   APIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI---------- 52
           +PIV+D G+  +K G A  N P +T  + + +        +N    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           S +  + P + G + +W     +WDY  F     +   L TT N  ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPTTSNGKILLTEPPMNPTKNR 119

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           + M +V+FE+Y++  ++ A +   +   A+G ++ +                        
Sbjct: 120 EKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------ 154

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230
             V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288
             IKEK  ++S +   D+  +R  T   + Y LP                   D +TI +
Sbjct: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIKV 253

Query: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
             E F  PE  F P +  +  PG+ E + +++      +R  L             P   
Sbjct: 254 GQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLP 313

Query: 349 SRLATELQRQCPTDWSCRV 367
           SRL  EL++     W  RV
Sbjct: 314 SRLEKELKQL----WFTRV 328

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 156/390 (40%), Gaps = 80/390 (20%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +PIV+D G+  +K G A  N P     SI     G   L  + R      +KDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGTISTPLKDIMIGDEA 60

Query: 53  ----SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTL 108
               S +  + P + G + +W     +WDY  FN        L TT    ++ +E  M  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLPTTSGGKVLLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKD 168
            +  + M +V+FE Y++  ++ A +   +   A+G ++ +                    
Sbjct: 116 VKNRERMCEVMFERYDFGGVYVA-IQAVLALYAQGLSSGV-------------------- 154

Query: 169 YRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDE 226
                 V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +
Sbjct: 155 ------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTAD 208

Query: 227 TILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
              V  IKEK  ++S +   D+  +R  T   +EY LPD      G + K GQ       
Sbjct: 209 FETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD------GRIIKVGQ------- 255

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
                 E F  PE  F P++  + +PG+ E +  +I      +R  L             
Sbjct: 256 ------ERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMY 309

Query: 345 PNFASRLATELQRQCPTDWSCRVSVPTGDA 374
           P   SRL  EL++     W  R+    GDA
Sbjct: 310 PGLPSRLERELKQL----WFTRIL--KGDA 333

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 90.1 bits (222), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/386 (23%), Positives = 150/386 (38%), Gaps = 74/386 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQILFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G      + ++D+ GR +  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S++ +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSAIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + +E F  PE  FHP +  L   GI +    SI      +R  L             
Sbjct: 247 VITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMF 306

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
           P  A R+  E+    P+    ++  P
Sbjct: 307 PGIAERMQKEITALAPSSMKVKIIAP 332

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 92/389 (23%), Positives = 149/389 (38%), Gaps = 80/389 (20%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDCY----VGDEAQ 60

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 61  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 111

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 112 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 152

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G     A+ ++D+ GR +  +L + LS R Y  +  
Sbjct: 153 --------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTT 204

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTA---KEYVLPDFSTSFQGYLRKPGQTLPE 281
            E  +V  IKEK  +++ + Y    Q+  +++   K Y LP                   
Sbjct: 205 AEREIVRDIKEKLCYVALD-YDQEMQTAAQSSAIEKSYELP------------------- 244

Query: 282 DSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXX 341
           D Q I + +E F  PE  FHP +  L   GI +    SI      +R  L          
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 342 XXIPNFASRLATELQRQCPTDWSCRVSVP 370
              P  A R+  E+    P+    ++  P
Sbjct: 305 TMFPGIAERMQKEITALAPSSMKVKIIAP 333

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 151/379 (39%), Gaps = 70/379 (18%)

Query: 4   APIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI---------- 52
           +PIV+D G+  +K G A  N P +T  + + +        +N    ++DI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVR 64

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           S +  + P + G + +W     +WDY  FN        L+ T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MKLNNTSGGKILLTEPPMNPLKNR 119

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           + M +V+FE+Y++  ++ A +   +   A+G ++ +                        
Sbjct: 120 EKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------ 154

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230
             V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETV 212

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288
             IKEK  ++S +   D+  +R  T   + Y LP                   D +TI +
Sbjct: 213 RQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRTIKV 253

Query: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
             E F  PE  F P +  +  PG+ E +  +I      +R  L             P   
Sbjct: 254 GQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLP 313

Query: 349 SRLATELQRQCPTDWSCRV 367
           SRL  EL++     W  RV
Sbjct: 314 SRLEKELKQL----WYTRV 328

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 95/378 (25%), Positives = 149/378 (39%), Gaps = 70/378 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSI-AKDKYGNYHLSNQVRSIKDI----------S 53
           PIV+D G+  +K G A  N P     SI  +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 54  SVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113
            +  + P + G + +W     +WDY  F     D   L TT N  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----DQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173
            M +V+FE+Y++  ++ A +   +   A+G ++ +                         
Sbjct: 121 QMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------- 154

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILVN 231
            V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 155 -VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVR 213

Query: 232 SIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQ 289
            IKEK  ++S +   D+  +R  T   + Y LPD      G + K GQ            
Sbjct: 214 QIKEKVCYVSYDLDLDTKLARETTTLVENYELPD------GRVIKVGQ------------ 255

Query: 290 DELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFAS 349
            E F  PE  F P +  +   G+ E +  +I      +R  L             P   S
Sbjct: 256 -ERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPS 314

Query: 350 RLATELQRQCPTDWSCRV 367
           RL  EL++     W  RV
Sbjct: 315 RLEKELKQL----WFTRV 328

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 94/382 (24%), Positives = 152/382 (39%), Gaps = 78/382 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY  F     +   L +T N  ++ +E  M   
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
           +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                     
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKTA--KEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  TA  + Y LP                   D +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP-------------------DGRT 250

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L             P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 346 NFASRLATELQRQCPTDWSCRV 367
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFSRV 328

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 94/382 (24%), Positives = 152/382 (39%), Gaps = 78/382 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVATPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY  F     +   L +T N  ++ +E  M   
Sbjct: 62  EVRSYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
           +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                     
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKTA--KEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  TA  + Y LP                   D +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP-------------------DGRT 250

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L             P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 346 NFASRLATELQRQCPTDWSCRV 367
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFSRV 328

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 90/380 (23%), Positives = 149/380 (39%), Gaps = 70/380 (18%)

Query: 3   EAPIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI--------- 52
             PIV+D G+  +K G A  N P +T  + + +        +N V  +KDI         
Sbjct: 4   RTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAV 63

Query: 53  -SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPEL 111
            S +  + P + G + +W     +WDY       +D   L +T    ++ +E  M     
Sbjct: 64  RSYLQISYPMENGVIKNWSDMELLWDYAF-----YDQMKLPSTSGGKVMLTEPPMNPLRN 118

Query: 112 SKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRD 171
            + M +V+FE+Y++  ++ A +   +   A+G ++ +                       
Sbjct: 119 REQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV----------------------- 154

Query: 172 YELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETIL 229
              V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 155 ---VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFET 211

Query: 230 VNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTII 287
           V  IKEK  ++S +   D+  +R  T   + Y LP                   D + I 
Sbjct: 212 VRQIKEKLSYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIK 252

Query: 288 LQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNF 347
           +  E F  PE  F P +  +  PG+ E +  +I      +R  L             P  
Sbjct: 253 VGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGL 312

Query: 348 ASRLATELQRQCPTDWSCRV 367
            SRL  EL++     W  RV
Sbjct: 313 PSRLEKELKQL----WFTRV 328

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 155/386 (40%), Gaps = 72/386 (18%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-IKDI---------- 52
           +PIV+D G+  +K G A  N P     SI             + + +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVR 64

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           S +  + P + G + +W+    +WDY  +N  +F      +T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNPLKNR 119

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           + M +V+FE+Y++  ++ A +   +   A+G ++ +                        
Sbjct: 120 ELMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------ 154

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230
             V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 212

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288
             IKEK  ++S +   D+  +R  T   + Y LPD      G + K GQ           
Sbjct: 213 RQIKEKLSYVSYDLNLDTKLARETTVLVENYELPD------GRVIKVGQ----------- 255

Query: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
             E F  PE  F P++  +  PGI E +  +I      +R  L             P   
Sbjct: 256 --ERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLP 313

Query: 349 SRLATELQRQCPTDWSCRVSVPTGDA 374
           SRL  EL++     W  R+    GDA
Sbjct: 314 SRLEKELKQL----WYTRIL--RGDA 333

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 151/382 (39%), Gaps = 78/382 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY  F     +   L +T N  ++ +E  M   
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLQSTSNGKILLTEPPMNPL 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
           +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                     
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  T   + Y LP                   D +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRT 250

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L             P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310

Query: 346 NFASRLATELQRQCPTDWSCRV 367
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFSRV 328

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 86.7 bits (213), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 90/372 (24%), Positives = 148/372 (39%), Gaps = 74/372 (19%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVATPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY  F     +   L +T N  ++ +E  M   
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
           +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                     
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  T   + Y LP                   D +T
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELP-------------------DGRT 250

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L             P
Sbjct: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYP 310

Query: 346 NFASRLATELQR 357
              SRL  EL++
Sbjct: 311 GLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 98/385 (25%), Positives = 152/385 (39%), Gaps = 80/385 (20%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-------IKDI---- 52
           +PIV+D G+  +K G A  N P     SI     G   L  + RS       IKDI    
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIV----GRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 53  ------SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCM 106
                 S +  + P + G +  W     +WD+       F+   L +T    ++ +E  M
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAF-----FEKMKLPSTSGGKILLTEPPM 115

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
              +  + M QV+FE+Y++  ++ A +   +   A+G ++ +                  
Sbjct: 116 NPLKNREMMCQVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------ 156

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N  
Sbjct: 157 --------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRS 208

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPED 282
            +   V  IKEK  ++S +  FD+  +R  T   + Y LPD      G + K GQ     
Sbjct: 209 ADFETVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELPD------GRIIKVGQ----- 257

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXX 342
                   E F  PE  F P +  +  PG+ E +  +I      +R  L           
Sbjct: 258 --------ERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSS 309

Query: 343 XIPNFASRLATELQRQCPTDWSCRV 367
             P   SRL  EL++     W  RV
Sbjct: 310 MYPGLPSRLEKELKQL----WFTRV 330

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 97/382 (25%), Positives = 150/382 (39%), Gaps = 78/382 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERATINKPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY  FN        L TT    ++ +E  M   
Sbjct: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ-----MQLPTTSGGKILLTEPPMNPV 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
           +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                     
Sbjct: 117 KNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  T   + Y LPD      G + K GQ        
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------GRIIKVGQ-------- 255

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
                E F  PE  F P +  +   GI E +  +I      +R  L             P
Sbjct: 256 -----ERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYP 310

Query: 346 NFASRLATELQRQCPTDWSCRV 367
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 84.3 bits (207), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/336 (25%), Positives = 137/336 (40%), Gaps = 74/336 (22%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIA--------------KDKYGNYHLSNQVR 47
           E A +VIDNGS   K G A  + P     SI               KD Y    + ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQ 59

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCM 106
           S + I  +T   P + G + +W+   +IW +  +N        L     +H ++ +E+ M
Sbjct: 60  SKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRVAPEEHPVLLTEAPM 110

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M Q++FE +   + F   +   +   + G TT I                  
Sbjct: 111 NPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI------------------ 151

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVM 224
                   V+DSG   T VVP+  G      + ++D+ GR L  +L + LS R Y  +  
Sbjct: 152 --------VLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTT 203

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKEK  +++ +     F+  ++TA +      S+S +     P      D Q
Sbjct: 204 AEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEKSYELP------DGQ 246

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESI 320
            I + +E F  PE  FHP +  L + GI +    SI
Sbjct: 247 VITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 136/340 (40%), Gaps = 60/340 (17%)

Query: 34  KDKYGNYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDT 93
           KD Y    + ++ +S + I  +T   P + G + +W+   +IW +  +N        L  
Sbjct: 35  KDSY----VGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRV 81

Query: 94  TKNKH-LIASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAK 152
              +H ++ +E+ M      + M Q++FE +   + F   +   +   + G TT I    
Sbjct: 82  APEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPA-FYVSIQAVLSLYSSGRTTGI---- 136

Query: 153 EDADVVASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFL 212
                                 V+DSG   T VVP+  G     A+ ++D+ GR L  +L
Sbjct: 137 ----------------------VLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYL 174

Query: 213 REALSFRHY--NVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQG 270
            + LS R Y  +   E  +V  IKEK  +++ +     F+  ++TA +      S+S + 
Sbjct: 175 MKILSERGYSFSTTAEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSSIEK 223

Query: 271 YLRKPGQTLPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPL 330
               P      D Q I + +E F  PE  FHP +  L + GI +    SI      +R  
Sbjct: 224 SYELP------DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 277

Query: 331 LXXXXXXXXXXXXIPNFASRLATELQRQCPTDWSCRVSVP 370
           L             P  A R+  E+    P+    ++  P
Sbjct: 278 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP 317

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 83.6 bits (205), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 147/382 (38%), Gaps = 78/382 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R      +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERGHASTPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY       F+   L TT    ++ +E  M   
Sbjct: 62  EVRSYLQISYPMENGIIRNWADMELLWDYAF-----FEQMKLPTTSGGKVLLTEPPMNPI 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
           +  + M +V+FE+Y++   + A +   +   A+G ++ +                     
Sbjct: 117 KNREQMCEVMFEKYDFGGTYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  T   + Y LP                   D + 
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP-------------------DGRV 250

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I +  E F  PE  F P +  +  PG+ E +  +I      +R  L             P
Sbjct: 251 IKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYP 310

Query: 346 NFASRLATELQRQCPTDWSCRV 367
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 91/382 (23%), Positives = 148/382 (38%), Gaps = 78/382 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASITTPLKDIMIGDEAS 61

Query: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
              S +  + P + G + +W     +WDY       ++   L +T    ++ +E  M   
Sbjct: 62  DVRSYLQISYPMENGIIKNWADMELLWDYAF-----YEQMKLPSTSGGKVLLTEPPMNPL 116

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
              + M +V+FE+Y++  ++ A +   +   A+G ++ +                     
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV--------------------- 154

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227
                V+DSG   T +VPV + V      K+LD+ GR +   L + LS R Y  N   + 
Sbjct: 155 -----VVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADF 209

Query: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
             V  IKEK  ++S +   D+  +R  T   + Y LP                   D + 
Sbjct: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELP-------------------DGRV 250

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L             P
Sbjct: 251 IKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYP 310

Query: 346 NFASRLATELQRQCPTDWSCRV 367
              SRL  EL++     W  RV
Sbjct: 311 GLPSRLEKELKQL----WFTRV 328

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 91/377 (24%), Positives = 151/377 (40%), Gaps = 66/377 (17%)

Query: 4   APIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI---------- 52
            PIV+D G+  +K G A  N P +T  + + +        SN    +KDI          
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           S +  + P + G + +W    Q+WDY       +D   + +T    ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAF-----YDQMKIPSTAGHKVLLTEPPMNPLKNR 119

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           + M +V+FE+Y++  ++ A +   +   A+G ++ +                        
Sbjct: 120 EQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------ 154

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230
             V+DSG   T +VPV + V      ++LD+ GR +  +L + LS R Y  N   +   V
Sbjct: 155 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETV 212

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQD 290
             IKEK  ++S +   D+     K A E      +T  + Y       LP D + I +  
Sbjct: 213 RQIKEKLCYVSYDLDLDT-----KLAHET-----TTLVETY------ELP-DGRVIKVGS 255

Query: 291 ELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
           E F  PE  F P +  +   GI E +  +I      +   L             P   SR
Sbjct: 256 ERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSR 315

Query: 351 LATELQRQCPTDWSCRV 367
           L  EL++     W  RV
Sbjct: 316 LEKELKQL----WFTRV 328

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 149/380 (39%), Gaps = 67/380 (17%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNS-IAKDKY---------GNYHLSNQVRSIKDISS 54
           PIV+DNGS  IK G    ++P    +S +   KY         GN  + NQ + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           +    P + G +  W    Q+W +         G  L + ++  ++ +E+ +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M +++FE +   +++   +   +   A G TT                            
Sbjct: 125 MCELLFETFSVPAVY-VSIQAVLSLYASGRTTGC-------------------------- 157

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 230
           V+DSG  C+  VPV  G     A++++DI GR     L   +R++      +  +  I V
Sbjct: 158 VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKSTGVSLLSSSEREI-V 216

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQD 290
             IKEK  +++ +          +  K Y +    T F+         LP D + I L +
Sbjct: 217 RIIKEKACYIALDPK--------EEEKNYTMHGKQTMFR---------LP-DGKQIELDN 258

Query: 291 ELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
           E F  PE  F+P++       + E + ESI  +   LR  L            IP F  R
Sbjct: 259 EKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDR 318

Query: 351 LATELQRQCPTDWSCRVSVP 370
           +  EL+  C      ++  P
Sbjct: 319 VLKELKLSCEPQTKIKIFAP 338

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 93/383 (24%), Positives = 153/383 (39%), Gaps = 78/383 (20%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52
           +PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI      
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASISTPLKDIMIGDEA 60

Query: 53  ----SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTL 108
               S +  + P + G + +W     +WDY       ++   L +T    ++ +E  M  
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAF-----YEQMKLPSTSGGKVLLTEPPMNP 115

Query: 109 PELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKD 168
            +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                    
Sbjct: 116 LKNREQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV-------------------- 154

Query: 169 YRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDE 226
                 V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +
Sbjct: 155 ------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTAD 208

Query: 227 TILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
              V  IKEK  ++S +   D+  +R  T   ++Y LPD      G + K GQ       
Sbjct: 209 FETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD------GRIIKVGQ------- 255

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
                 E F  PE  F P +  + + G+ E +  +I      +R  L             
Sbjct: 256 ------ERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMY 309

Query: 345 PNFASRLATELQRQCPTDWSCRV 367
           P   SRL  EL++     W  RV
Sbjct: 310 PGLPSRLEKELKQL----WFTRV 328

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 146/380 (38%), Gaps = 70/380 (18%)

Query: 3   EAPIVIDNGSYEIKFGTASSNEP-FTALNSIAKDKYGNYHLSNQVRSIKDI--------- 52
           + PIV+D G+  +K G A  N P +T  + + +        +N    +KDI         
Sbjct: 4   QKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQV 63

Query: 53  -SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPEL 111
            S +  + P + G +  W     +WDY       ++   L +T    ++ +E  M     
Sbjct: 64  RSYLQISYPMENGIIRDWADMELLWDYAF-----YEQMKLPSTSGGKVLLTEPPMNPLRN 118

Query: 112 SKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRD 171
            + M +V+FE+Y++  ++   +   +   A+G ++ +                       
Sbjct: 119 REQMCEVMFEKYDFGGVYVG-IQAVLALYAQGLSSGV----------------------- 154

Query: 172 YELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETIL 229
              V+DSG   T +VPV + V      ++LD+ GR +  +L + LS R Y  N   +   
Sbjct: 155 ---VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFET 211

Query: 230 VNSIKEKCLFMSPNSYFDS--FQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTII 287
           V  IKEK  ++S +   D+   Q      ++Y LP                   D + I 
Sbjct: 212 VRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELP-------------------DGRVIK 252

Query: 288 LQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNF 347
           +  E F  PE  F P +  +  PGI E +  +I      +   L             P  
Sbjct: 253 VGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGL 312

Query: 348 ASRLATELQRQCPTDWSCRV 367
            SRL  EL++     W  RV
Sbjct: 313 PSRLEKELKQL----WFTRV 328

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/340 (22%), Positives = 134/340 (39%), Gaps = 60/340 (17%)

Query: 34  KDKYGNYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDT 93
           KD Y    + ++ +S + I  +T   P + G + +W+   +IW +  +N        L  
Sbjct: 35  KDSY----VGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYN-------ELRV 81

Query: 94  TKNKH-LIASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAK 152
              +H ++ +E+ M      + M Q++FE +   + F   +   +   + G TT I    
Sbjct: 82  APEEHPVLLTEAPMNPKSNREKMTQILFETFNVPA-FYVSIQAVLSLYSSGRTTGI---- 136

Query: 153 EDADVVASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFL 212
                                 V+DSG   T VVP+  G      + ++D+ GR +  +L
Sbjct: 137 ----------------------VLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYL 174

Query: 213 REALSFRHY--NVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQG 270
            + LS R Y  +   E  +V  IKEK  +++ +     F+  ++TA +      S++ + 
Sbjct: 175 MKILSERGYSFSTTAEREIVRDIKEKLCYVALD-----FEQEMQTAAQ------SSAIEK 223

Query: 271 YLRKPGQTLPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPL 330
               P      D Q I + +E F  PE  FHP +  L   GI +    SI      +R  
Sbjct: 224 SYELP------DGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKE 277

Query: 331 LXXXXXXXXXXXXIPNFASRLATELQRQCPTDWSCRVSVP 370
           L             P  A R+  E+    P+    ++  P
Sbjct: 278 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAP 317

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 92/416 (22%), Positives = 164/416 (39%), Gaps = 79/416 (18%)

Query: 1   MEEA----PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKY------GNYHLSNQV 46
           M+EA    PIV+DNGS  IK G +   +P    ++ + ++  +K       G+  + NQ 
Sbjct: 1   MQEALYNQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQA 60

Query: 47  RSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCM 106
           + ++ +  +    P + G + +W     IW Y +FN        L   ++  ++ +E+ +
Sbjct: 61  QELRGL--LKLRHPVEHGIVKNWSDMEHIWSY-VFN----KSLQLQNVEDHPILITEAPL 113

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
                 + M +++FE +   +L+   +   +   A G TT                    
Sbjct: 114 NPRNNRERMCELLFESFNVPALY-VSIQAVLSLYASGRTTGC------------------ 154

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYN 222
                   V+D G  C   VPV  G     +++++DI GR    FL   LR+       +
Sbjct: 155 --------VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLS 206

Query: 223 VMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPED 282
             +  + V  IKEK  +++ + + +     +        P++ T F+         LP D
Sbjct: 207 SSEREV-VRIIKEKACYVAKDPHIEEQNFSIN-------PNY-TKFK---------LP-D 247

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXX 342
            +TI L  E F  PE  F PE+       + +   +SI  +   LR LL           
Sbjct: 248 GKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTS 307

Query: 343 XIPNFASRLATELQRQCPTDWSCRVSVP--------TGDARLYGWKCMQKFSETQA 390
            +P F  RL +EL+    +    ++  P         G + L G    +K   T+A
Sbjct: 308 ILPGFGDRLLSELKSLSDSQTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTRA 363

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 87/371 (23%), Positives = 142/371 (38%), Gaps = 72/371 (19%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFT-ALNSIAKDKYGNYHLSNQV----------RSIKDIS 53
           P+V+DNGS  IK G +  N+P     N I   KY    L+N +          R+ K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113
            +    P   G + +W+    +W +  FN    D   ++      L+ +E+ +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHT-FN----DILKINDFDEHPLLITEAPLNPEKNRD 124

Query: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173
            M +V FE++++ +++ A  P  +   A G TT                           
Sbjct: 125 KMCEVFFEKFDFAAVYIAN-PSTLSLYASGRTTGC------------------------- 158

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVM-----DETI 228
            V+D G      VP+ +G     +++++D+GGR +   L+     R Y  +      E  
Sbjct: 159 -VLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQIRKYTGISLYSSSEHE 215

Query: 229 LVNSIKEKCLFMSPNSYFDSFQSRLKTAK---EYVLPDFSTSFQGYLRKPGQTLPEDSQT 285
           +V ++KEK  ++S +   D   S L   K   ++ LP                   D + 
Sbjct: 216 IVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLP-------------------DGKD 256

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           +IL    F  PE  F P+I  L    + +   ESIS +   LRP L              
Sbjct: 257 LILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFR 316

Query: 346 NFASRLATELQ 356
            F  RL  ELQ
Sbjct: 317 GFGDRLLKELQ 327

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 91/384 (23%), Positives = 152/384 (39%), Gaps = 80/384 (20%)

Query: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIA------KDKYGNYHL----------SNQVR 47
           +PIV+D G+  +K G A  N P     SI        ++ GN ++          ++ VR
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR 64

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMT 107
           S   IS      P + G + +W     +WDY       ++   L +T    ++ +E  + 
Sbjct: 65  SYLQISY-----PMENGIIKNWTDMELLWDYAF-----YEQMKLPSTSGGKVLLTEPPLN 114

Query: 108 LPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNK 167
             +  + M +V+FE+Y++  ++ A +   +   A+G ++ +                   
Sbjct: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------- 154

Query: 168 DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMD 225
                  VIDSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   
Sbjct: 155 -------VIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207

Query: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDS 283
           +   V  IKEK  ++S +   D+  +R  T   + Y LPD      G + K GQ      
Sbjct: 208 DFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELPD------GRVIKVGQ------ 255

Query: 284 QTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXX 343
                  E F   E  F P +  + + G+ E +  +I      +R  L            
Sbjct: 256 -------ERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSM 308

Query: 344 IPNFASRLATELQRQCPTDWSCRV 367
            P   SR+  EL++     W  RV
Sbjct: 309 YPGLPSRIEKELKQL----WYTRV 328

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 153/380 (40%), Gaps = 67/380 (17%)

Query: 5   PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKY------GNYHLSNQVRSIKDISS 54
           P+V+DNGS  IK G +   +P    ++ + +   +K       G+  + NQ + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGLLK 96

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           + +  P + G + +W    Q+W Y +FN        L   ++   + +E+ +   +  + 
Sbjct: 97  LRY--PLQHGIVTNWADMEQVWGY-VFN----KSLQLQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M +++FE +   +L+ + V   +   A G TT                            
Sbjct: 150 MCELLFESFNVPALYVS-VQAVLSLYASGRTTGC-------------------------- 182

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 230
           V+D G  C   VPV  G     +++++DI GR    FL   LR+       +  +  I V
Sbjct: 183 VVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-V 241

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQD 290
            +IKEK  F++ +        +L+     + P FS  F+         LP D +TI L  
Sbjct: 242 RTIKEKACFVTKD-------PKLEEQNFPMNPSFS-KFK---------LP-DGKTIELGQ 283

Query: 291 ELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
           E +  PE  F PE+       + +   +SI  +   LR LL            +P F  R
Sbjct: 284 ERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDR 343

Query: 351 LATELQRQCPTDWSCRVSVP 370
           L  EL+    +    ++  P
Sbjct: 344 LLKELKSLSGSRTKIKIFAP 363

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 91/384 (23%), Positives = 157/384 (40%), Gaps = 71/384 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFT-ALNSIAKDKYG-----------NYHLSNQVRSIKDI 52
           PIVIDNGS  IK G +  ++P     N     KY            + ++ N+ +SI+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
             +    P   G + +W+    +W + +FN    D  ++   +   L+ +E+ +T+ +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
             M + +FE +   SL+ A  P  +   A G+TT                          
Sbjct: 124 HIMCERLFETFNIPSLYVAN-PSVLSLYASGNTTGC------------------------ 158

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFL----REALSFRHYNVMDETI 228
             V+D G       P+ +G     +++K+++GGR +   L    R++     Y+  +E  
Sbjct: 159 --VVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKE 215

Query: 229 LVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVL--PDFSTSFQGYLRKPGQTLPEDSQTI 286
           +V +IKEK  ++S +  F+      K+ + Y L   + S  F+         LP D + +
Sbjct: 216 IVRTIKEKVCYISED--FN------KSEESYYLRQDEMSCKFK---------LP-DGKEL 257

Query: 287 ILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPN 346
            L  E F  PE  F+P++  L N  +     ESIS +   LRP L               
Sbjct: 258 TLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKG 317

Query: 347 FASRLATELQRQCPTDWSCRVSVP 370
           F SRL  +LQ         ++  P
Sbjct: 318 FGSRLLGDLQELTNNRAKIKILAP 341

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 144/366 (39%), Gaps = 67/366 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFT-ALNSIAKDKY---------GNYHLSNQVRSIKDISS 54
           PIV+DNGS  IK G +    P     + I   KY         G   + NQ + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGLLK 70

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           + +  P + G + +W     IW++            L+  +   ++A+E+ +   +  + 
Sbjct: 71  LRY--PLEHGIVKNWSDMELIWNHVFHK-----SLQLNNIEEHPVLATEAPLNPLKNREA 123

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M +++FE +   +++ + +   +   A G TT                            
Sbjct: 124 MCEMLFETFNVPAVYVS-IQAVLSLYASGRTTGC-------------------------- 156

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 230
           V+D G  C   VPV  G     +++++D+ GR    FL   LR+       +  +  I V
Sbjct: 157 VLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-V 215

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQD 290
             IKEK  +++        +  L   + Y L   ST F+         LP D + + L++
Sbjct: 216 RIIKEKACYVA--------RDPLTEEQTYHLTPTSTIFK---------LP-DGKVLDLKN 257

Query: 291 ELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
           E F  PE  F P++       I E   +SIS +   LRP L             P F  R
Sbjct: 258 EKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDR 317

Query: 351 LATELQ 356
           L TEL+
Sbjct: 318 LLTELR 323

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 125/319 (39%), Gaps = 59/319 (18%)

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           S +  + P + G + +W     +WDY  +     D   L +T    ++ +E  M   +  
Sbjct: 11  SYLQISYPMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNR 65

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           + M +V+FE+Y++  ++ A +   +   A+G ++ +                        
Sbjct: 66  EQMCEVMFEKYDFGGVYVA-IQAVLALYAQGLSSGV------------------------ 100

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDETILV 230
             V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y  N   +   V
Sbjct: 101 --VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETV 158

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288
             IKEK  ++S +   D+  +R  T   + Y LP                   D + I +
Sbjct: 159 RQIKEKLSYVSYDLDLDTKLARETTTLVENYELP-------------------DGRVIKV 199

Query: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
             E F  PE  F P +  +  PG+ E +  +I      +R  L             P   
Sbjct: 200 GSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLP 259

Query: 349 SRLATELQRQCPTDWSCRV 367
           SRL  EL++     W  RV
Sbjct: 260 SRLEKELKQL----WFTRV 274

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 90/410 (21%), Positives = 152/410 (37%), Gaps = 77/410 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYH------------LSNQVRSIKDI 52
           P+VIDNGS  +K G     +P     S+  D   NY+            + N+ + ++ +
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGD--ANYNKIMVGGLECDSFVGNKAQRLRGL 68

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
             +    P + G +  W+    +W + L     FD   L +     L+ +E+ +      
Sbjct: 69  --LKLKHPMERGVVSDWDDMELLWSHIL-----FDSLQLTSGMEHPLLITEAPLNPESNK 121

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           + M +V FE +   ++    +P  +   A G TT                          
Sbjct: 122 EKMLEVFFETFNIPAIC-VSIPGVLSLYASGRTTGC------------------------ 156

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGG----RFLNGFLREALSFRHYNVMDETI 228
             V+D G      VPV +G     ++K++++GG    + L   LR+      ++   E  
Sbjct: 157 --VVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFSS-GERE 213

Query: 229 LVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIIL 288
           LV ++KEK  ++S N   D  +   +  K       +T+F+         LP D   + L
Sbjct: 214 LVRTMKEKSCYVSLNQLKDEEKFTFEPGK------MNTNFK---------LP-DGNMLTL 257

Query: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
               F  PE  F P+I +   P + E  L+SI  +   LRP L               F 
Sbjct: 258 SKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFG 317

Query: 349 SRLATELQRQCPTDWSCRVSVP--------TGDARLYGWKCMQKFSETQA 390
            R   ELQ       + R+  P         G + L G    +K   T++
Sbjct: 318 DRFLQELQISTCKKSNIRILAPPERKYTAWIGGSMLAGLTTFRKMLTTKS 367

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 128/329 (38%), Gaps = 64/329 (19%)

Query: 43  SNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIAS 102
           +++VRS   IS      P + G + +W     +WDY  +     +   L  T N  ++ +
Sbjct: 6   ASEVRSYLQISY-----PMENGIIKNWTDMELLWDYAFY-----EQMKLPDTSNGKILLT 55

Query: 103 ESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDH 162
           E  M   +  + M +V+FE+Y +  ++ A +   +   A+G ++ +              
Sbjct: 56  EPPMNPIKNREKMCEVMFEKYNFGGVYVA-IQAVLALYAQGLSSGV-------------- 100

Query: 163 PSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY- 221
                       V+DSG   T +VPV + V      ++LD+ GR +   L + LS R Y 
Sbjct: 101 ------------VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYA 148

Query: 222 -NVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKT--AKEYVLPDFSTSFQGYLRKPGQT 278
            N   +   V  IKEK  ++S +   D+  +R  T   + Y LP                
Sbjct: 149 FNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELP---------------- 192

Query: 279 LPEDSQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXX 338
              D + I +  E F  PE  F P +  +   G+ E +  +I      +R  L       
Sbjct: 193 ---DGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLS 249

Query: 339 XXXXXIPNFASRLATELQRQCPTDWSCRV 367
                 P   SRL  EL++     W  RV
Sbjct: 250 GGSSMYPGLPSRLEKELKQL----WFTRV 274

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 87/368 (23%), Positives = 141/368 (38%), Gaps = 68/368 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEP------------FTALNSIAKDKYGNYHLSNQVRSIKDI 52
           P+V+DNGS  +K G +  + P               +N  +KD     +L+ + RSI   
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI--- 68

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
             +    P   G + +W     IWDY +F     D   L       ++ +E+ +      
Sbjct: 69  --LQLRHPVDHGVVKNWNDMELIWDY-MFK----DKLKLKDVDEHPVLITEAPLNPVSNR 121

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
             M  ++FE +   +L+ A  P  +   A G  +  ++   D                  
Sbjct: 122 DEMCDLLFESFGVQALYVAN-PAVLSLYASGKISGCVLDCGD------------------ 162

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL---SFRHYNVMDETIL 229
                 G++C+  VPV +G     A+K++D+GGR L   L+  L   +        E  L
Sbjct: 163 ------GYSCS--VPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMEL 214

Query: 230 VNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQ 289
           V  IKEK  +++ +   D  + +     + V   F              LP D + I L 
Sbjct: 215 VRMIKEKSCYVAVD--LDIEEEKCNYEGDQVGLKFK-------------LP-DGKFITLS 258

Query: 290 DELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFAS 349
            + F VPE  F P + S     I E I +S+S L   LRP +            +  F +
Sbjct: 259 KDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGN 318

Query: 350 RLATELQR 357
           RL  EL +
Sbjct: 319 RLVQELDK 326

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 77/408 (18%), Positives = 163/408 (39%), Gaps = 73/408 (17%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAK----DKY------GNYHLSNQVRSIKDISS 54
           P+VIDNG+  +K G    ++P    ++I      DK        N ++ N+ +  + +  
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL-- 67

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           +    P + G++  W+    +W + L +       ++   +   ++ +E+ +   +  ++
Sbjct: 68  LRLRHPMEHGEVKHWDEMEAVWKHTLLHD-----LNIQHIEEHPILITEAPLNSSKNREH 122

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M +++FE +   ++     P  +   + G TT                            
Sbjct: 123 MCEILFESFNIPAIH-VENPAVLALYSGGRTTG--------------------------C 155

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFL----REALSFRHYNVMDETILV 230
           VID G      VP+ +G     +++++DIGGR +   L    R+++    ++  +E  +V
Sbjct: 156 VIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFS-SNEKEIV 214

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQD 290
            +IKE+  +++ +          K   +Y+L   S S +  L         D +++ + +
Sbjct: 215 RTIKERACYVADDIS--------KEEHKYILDSESNSSKFKL--------PDGKSLSIGN 258

Query: 291 ELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
             F   E  F+P +    +  + E + +++S +   LRP+L            +P F +R
Sbjct: 259 VRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNR 318

Query: 351 LATELQRQCPTDWSCRVSVP--------TGDARLYGWKCMQKFSETQA 390
           +  ELQ     D   R+            G + L G    QK   T++
Sbjct: 319 ILKELQILTKQDTKLRIIASPERKYTTWIGGSILAGLSTFQKILVTKS 366

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/379 (21%), Positives = 145/379 (38%), Gaps = 61/379 (16%)

Query: 5   PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKYGNYHLSNQVRSI-----KDISSV 55
           P+V+DNGS  IK G +   +P    ++ + +   DK     LS++ + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNM 115
               P + G +  W    Q+W +  ++        L+   +  ++ +E+ +   E    M
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSS-----LKLNNIGDHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELV 175
            ++++E +   +++   +   +   A G TT                            V
Sbjct: 126 CEMLYETFNVPAVY-VSIQAVLALYAGGRTTGC--------------------------V 158

Query: 176 IDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVN 231
           ID G  C   VPV  G     A++++D+ GR    FL   LR+++     +  +  I V 
Sbjct: 159 IDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VR 217

Query: 232 SIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDE 291
            IKEK  +++P    +  +       E +     T F+         LP D + + L  E
Sbjct: 218 MIKEKACYVAPEVAAEEQKYASSRGSEEL-----TKFK---------LP-DGKILSLGAE 262

Query: 292 LFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRL 351
            F  PE  F P++       I +   +SIS +   LR  L               F  RL
Sbjct: 263 KFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDRL 322

Query: 352 ATELQRQCPTDWSCRVSVP 370
             EL+ +C  +   ++  P
Sbjct: 323 LNELRSRCEPNVKIKIFAP 341

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/384 (21%), Positives = 149/384 (38%), Gaps = 71/384 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKY------GNYHLSNQVRSIKDISS 54
           P+VIDNGS  IK G +    P    +  + +   DK       G+  + N  + ++ +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLK 73

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           + +  P K G +  W+    IW Y L    +     L       L+ +E+ M   +  + 
Sbjct: 74  LRY--PIKHGVVEDWDSMELIWSYVLNEVLQ-----LQNIGEHPLLITEAPMNPLKNREQ 126

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M QV+FE ++  +L+ +  P  +   A G TT                            
Sbjct: 127 MAQVLFETFDVSALYVSN-PAVLSLYASGRTTGC-------------------------- 159

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGG----RFLNGFLREALSFRHYNVMDETILV 230
           V+D G      VP+  G     ++ ++DIGG      L   LR++     ++  +  I V
Sbjct: 160 VVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI-V 218

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVL---PDFSTSFQGYLRKPGQTLPEDSQTII 287
            ++KEK  +++ N         +K  +E  L    D  ++F+         LP D + I 
Sbjct: 219 RTMKEKVCYLAKN---------IKKEEEKYLQGTQDLISTFK---------LP-DGRCIE 259

Query: 288 LQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNF 347
           + ++ +  PE  F P+I  L   G+ +  ++SI  +   LR  L            +  F
Sbjct: 260 VGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGF 319

Query: 348 ASRLATELQRQCPTDWSCRVSVPT 371
             R+  +L+         ++  P+
Sbjct: 320 GDRMLWDLEALTKGTSKIKIIAPS 343

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/379 (20%), Positives = 142/379 (37%), Gaps = 62/379 (16%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFT----------ALNSIAKDKYGNYHLSNQVRSIKDISS 54
           P+++DNGS  IK G A S +P            A  S+        ++ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           +    P+    ++SW+    +WDY L N  E     ++  +   ++ + S  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLE-----IEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M +V+FE++   +++ +  P+   +   G TT   V+                       
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGL-GRTTGCSVS----------------------- 160

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH---YNVMDETILVN 231
               G     +  VI G+    + +  + GG  +   + + L   H    N  +   L+ 
Sbjct: 161 ---CGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIR 217

Query: 232 SIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDE 291
           SIKE+C  +S + Y +     L T+K        TS   Y R P      D   I +  E
Sbjct: 218 SIKERCCVLSKDFYNEIRAYELITSK--------TSNNKY-RLP------DGNIIEIGSE 262

Query: 292 LFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRL 351
            F  PE  F+P+        + + I+ SIS      R  L            I  F  RL
Sbjct: 263 RFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERL 322

Query: 352 ATELQRQCPTDWSCRVSVP 370
             E++++   +    ++ P
Sbjct: 323 TKEIRKEIDGNQKIMLNAP 341

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 83/390 (21%), Positives = 152/390 (38%), Gaps = 73/390 (18%)

Query: 5   PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKY------GNYHLSNQVRSIKDISS 54
           PIVIDNGS  IK G +    P    ++ +  +  +K       G+  + N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           + +   H  G +  W+    IW Y L      +   L   +   L+ +E+ M   +  + 
Sbjct: 74  LRYPMTH--GVVEDWDSMELIWSYML-----NEVLQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M QV+FE +   +L+ +  P  +   A G TT                            
Sbjct: 127 MAQVLFETFNLPALYISN-PAVLSLYASGRTTGC-------------------------- 159

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 230
           V+D G      VP+  G     ++ ++DIGGR     L   LR++     ++   E  +V
Sbjct: 160 VVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFSS-SELEVV 218

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLP---DFSTSFQGYLRKPGQTLPEDSQTII 287
             IKEK  +++ N         +K  ++  L    D  + F+         LP D + I 
Sbjct: 219 RMIKEKVCYLAKN---------IKKEEDRYLQGHHDLGSVFK---------LP-DGKCIE 259

Query: 288 LQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNF 347
           + ++ +  PE  F P+I      G+ +  ++SI  +   LR  L            +  F
Sbjct: 260 IGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGF 319

Query: 348 ASRLATELQRQCPTDWSCRVSVPTGDARLY 377
             R+  +L  +  +  +C++ +     R Y
Sbjct: 320 GERMLHDL--EALSKGTCKIKIIAPPERKY 347

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/382 (23%), Positives = 140/382 (36%), Gaps = 68/382 (17%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKD-KYGNYHLSNQVRSIKDISS--------V 55
           PIVIDNG+  IK G     +P     SI    KY     SN + S   I +        +
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGIL 73

Query: 56  TFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNM 115
               P   G + +W+    IW Y +F+    D   L+      ++ +E  +      + M
Sbjct: 74  KLRHPMLRGVVQNWDDMETIWQY-VFD----DTLYLENLNEHPILITEPPLNNMANRQKM 128

Query: 116 DQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELV 175
            + +FE + + +++ +  PV   + A G TT                             
Sbjct: 129 CEALFEIFGFPAVYISVSPVLSLY-ASGQTTG--------------------------CA 161

Query: 176 IDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKE 235
           +D G      +PV  G     +VKK+DIGG  +     E L F        +IL N+   
Sbjct: 162 VDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDIT----EQLQF--------SILKNT--- 206

Query: 236 KCLFMSPNSYFDSFQSRLKTAKE---YVLPDFSTSFQGYL----RKPGQTLPEDSQTIIL 288
             LFM    Y  S +  ++T KE   Y+  D++   + YL    +   Q    D + + +
Sbjct: 207 -GLFM----YSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMASQFKLPDGKMLNI 261

Query: 289 QDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
               +   E  F PE+       + E   +SI  +   LR  L             P F 
Sbjct: 262 SQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFG 321

Query: 349 SRLATELQRQCPTDWSCRVSVP 370
           SRL  ELQ     D   R+  P
Sbjct: 322 SRLLKELQTLTGYDTKIRIIAP 343

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 84/386 (21%), Positives = 144/386 (37%), Gaps = 77/386 (19%)

Query: 5   PIVIDNGSYEIKFGTASSNEPF--------------TALNSIAKDKY-GNYHLSNQVRSI 49
           PIV+DNGS  +K G    ++P                 +  + K K+ GN  L+ + R +
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGN--LAQEYRGL 70

Query: 50  KDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109
                +    P   G + +WE    +WD+ +F     D   +       L+ +E+ +   
Sbjct: 71  -----LKLRYPMDHGIIENWEHMETVWDH-IFK----DCLKVSNLGEHPLVVTEAPLNPK 120

Query: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169
              + M + +FE +   +L+ A  P  +   A G TT                       
Sbjct: 121 PNREKMCETLFESFNIPALYIAN-PAVLSLYASGRTTGC--------------------- 158

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVM----- 224
                V+++G      VP+ +G     +++++DIGGR +   L+  L  R    M     
Sbjct: 159 -----VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLRKSTGMWLYSS 211

Query: 225 DETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            E  +V  IKE   ++  N   +  +  L   K+      S SF+         LP D +
Sbjct: 212 SEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKK------SISFK---------LP-DGK 255

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            +++    F  PE  F+P +    +  + + I++SIS +   LR  L             
Sbjct: 256 NLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMF 315

Query: 345 PNFASRLATELQRQCPTDWSCRVSVP 370
             F  RL TEL          R+  P
Sbjct: 316 QGFCDRLITELDFSVDKTTKVRILAP 341

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 84/408 (20%), Positives = 153/408 (37%), Gaps = 83/408 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKY------GNYHLSNQVRSIKDISS 54
           PIVIDNGS  IK G +    P    ++ +     DK       G+  + N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           + +  P K G +  W+    IW Y L          L   +   L+ +E+ M   +  + 
Sbjct: 74  LRY--PMKHGVVEDWDSMELIWSYVLNEV-----LQLQNIEEHPLLITEAPMNPLKNREM 126

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           + QV+FE +   +++ +  P  +   A G TT                            
Sbjct: 127 IAQVMFETFNLSAIYVSD-PAVLSLYASGRTTGC-------------------------- 159

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETI------ 228
           V+D G      VP+  G     ++ ++DIGG    G + E L F+       ++      
Sbjct: 160 VVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSER 215

Query: 229 -LVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYV--LPDFSTSFQGYLRKPGQTLPEDSQT 285
            +V +IKEK  +++ ++         K   +Y+    D  ++F+         LP D ++
Sbjct: 216 EIVRTIKEKVCYLAKDAK--------KEEDKYLQGTQDLISAFK---------LP-DGKS 257

Query: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIP 345
           I + ++ +  PE  F P+I      G+    ++SI  +   LR  L            + 
Sbjct: 258 IEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLK 317

Query: 346 NFASRLATELQRQCPTDWSCRVSVP--------TGDARLYGWKCMQKF 385
            F  R+  +L+         ++  P         G + L G    QK 
Sbjct: 318 GFGDRMLHDLEALTKGTSKIKIIAPPERKYTAWIGGSILTGLSTFQKL 365

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/409 (20%), Positives = 149/409 (36%), Gaps = 73/409 (17%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFT-ALNSIAKDKYGNYH----------LSNQVRSIKDIS 53
           P+V+DNGS  IK G +   +P     + I   KY              + N+ + ++ + 
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMRGL- 69

Query: 54  SVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113
            +  + P + G +  W    Q+W +  +N        L   +   ++ +E+ +   +   
Sbjct: 70  -LKLHYPLEHGVVQDWPGLEQLWTHVFYNS-----LKLANIEEHPMLITEAPLNPMKNRN 123

Query: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173
            M +++FE +   +++   +   +   A G TT                           
Sbjct: 124 KMCEMLFETFGSPAVY-VSIQAVLALYAGGRTTGC------------------------- 157

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETIL 229
            VID G  C   VPV  G     A++++D+ GR    FL   LR++      +  +  I 
Sbjct: 158 -VIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI- 215

Query: 230 VNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQ 289
           V  IKEK  F++ +   +        + E       T F+         LP D + + L 
Sbjct: 216 VRMIKEKACFVATDVGNEEQNYEGANSAE-----LETRFK---------LP-DGKILTLG 260

Query: 290 DELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFAS 349
            E F  PE  F P +       I E   +SIS +   LR  L               F  
Sbjct: 261 AEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGD 320

Query: 350 RLATELQRQCPTDWSCRVSVP--------TGDARLYGWKCMQKFSETQA 390
           RL +E+++    +   ++  P         G + L G    +K   T+A
Sbjct: 321 RLLSEIRKTSEPNTKIKIFAPPERKYSTWIGGSILAGLSTFEKLWVTRA 369

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 81/372 (21%), Positives = 145/372 (38%), Gaps = 77/372 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEP----FTALNSIAKDKY------GNYHLSNQVRSIKDISS 54
           PIVIDNGS  IK G +   +P    ++ +     DK       G+  + N+ + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           + +  P + G +  W+    IW + L      +   L   +   L+ +E+ M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHIL-----NEVLQLQNIEEHPLLITEAPMNPLKNREV 126

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M QV+FE +   +L+ +  P  +   A G TT                            
Sbjct: 127 MAQVLFETFNLPALYVSN-PAVLSLYASGRTTGC-------------------------- 159

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 230
           VID G      VP+  G     ++ ++DIGGR     L   LR++     ++  +  I V
Sbjct: 160 VIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-V 218

Query: 231 NSIKEKCLFMSP------NSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQ 284
            +IKEK  +++       N+Y    Q            D ++ F+         LP D +
Sbjct: 219 RTIKEKVCYLATDIKKEENTYMQESQ------------DLTSVFK---------LP-DGK 256

Query: 285 TIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXI 344
            I + ++ +  PE  F P+I      G+ +  ++SI  +   LR  L            +
Sbjct: 257 CIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTL 316

Query: 345 PNFASRLATELQ 356
             F  R+  +L+
Sbjct: 317 RGFGDRMLHDLE 328

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 139/361 (38%), Gaps = 69/361 (19%)

Query: 17  FGTASSNEPFTALNSIA------KDKYG----NYHLSNQVRSIKDISSVTFNRPHKLGQL 66
           FG ++S   F +L + A        K G    ++++ N+  +     S + + P + GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  VSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQVVFEEYEY 125
            +W+   + W+  +F         L T    H  + +E  +  PE  + + ++ FE +  
Sbjct: 129 ENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNC 181

Query: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCTWV 185
             L+                   +  +    + AS   S   D      VIDSG   T V
Sbjct: 182 AGLY-------------------IAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHV 222

Query: 186 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNSY 245
           +PV +G     A+K + I GR +  F++  L  R    +D ++                 
Sbjct: 223 IPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRT--------------- 265

Query: 246 FDSFQSRLKTAKEYVLPDFSTSFQGYLRKPG---QTLPEDSQT-----IILQDELFAVPE 297
                 R+K    YV PD    F  + R  G   Q + E+S++     + +  E F  PE
Sbjct: 266 ----AERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSESTKKKIVDVGYERFLAPE 321

Query: 298 TFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATEL 355
            FF+PEIAS   L P +   + ++I   P  +R  L              +F  RL  +L
Sbjct: 322 IFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 380

Query: 356 Q 356
           +
Sbjct: 381 K 381

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/361 (22%), Positives = 136/361 (37%), Gaps = 69/361 (19%)

Query: 17  FGTASSNEPFTALNSIA------KDKYG----NYHLSNQVRSIKDISSVTFNRPHKLGQL 66
           FG ++S   F +L S A        K G    ++++ N+  +     S + + P + GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  VSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQVVFEEYEY 125
            +W+   + W+  +F         L T    H  + +E  +  PE  + + ++ FE +  
Sbjct: 124 ENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNC 176

Query: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCTWV 185
             L+                   +  +    + AS   S   D      VIDSG   T V
Sbjct: 177 AGLY-------------------IAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHV 217

Query: 186 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNSY 245
           +PV +G     A+K + I GR +  F++  L  R     D T+                 
Sbjct: 218 IPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRT--------------- 260

Query: 246 FDSFQSRLKTAKEYVLPDFSTSFQGYLRKP---GQTLPEDSQ-----TIILQDELFAVPE 297
                 R+K    YV  D    F  + R P    Q + E+S+      I +  E F  PE
Sbjct: 261 ----AERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEKTKRKVIDVGYERFLAPE 316

Query: 298 TFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATEL 355
            FF+PEIAS   L P +   + ++I   P  +R  L              +F  RL  +L
Sbjct: 317 IFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 375

Query: 356 Q 356
           +
Sbjct: 376 K 376

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 82/380 (21%), Positives = 144/380 (37%), Gaps = 72/380 (18%)

Query: 10  NGSYEIKFGTASSNEPFTAL--------NSIAKDKYG---NYHLSNQVRSIKDISSVTFN 58
           NGS    FG ++S   F  L        N++A  +     ++++ N+        S + +
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSYSLS 122

Query: 59  RPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQV 118
            P + GQ+ +W+   + W+  +F       +     ++ + + +E  +  PE  + + ++
Sbjct: 123 YPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHYFLLTEPPLNPPENREQVAEI 176

Query: 119 VFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDS 178
            FE +    L+                   +  +    + AS   S   D      VIDS
Sbjct: 177 FFESFNCAGLY-------------------IAVQAVLALAASWTSSKVIDRSLTGTVIDS 217

Query: 179 GFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCL 238
           G   T V+PV +G     A+K + I GR +  F++  L  R     D ++          
Sbjct: 218 GDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRT-------- 267

Query: 239 FMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP---GQTLPEDSQ-----TIILQD 290
                        R+K    YV PD    F  + R+P    Q + E  +      + +  
Sbjct: 268 -----------AERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKTKQKVVDVGY 316

Query: 291 ELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
           E F  PE FF+PEIAS   L P +   + ++I   P  +R  L              +F+
Sbjct: 317 ERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFS 375

Query: 349 SRLATELQRQCPTDWSCRVS 368
            R    LQR   +  + R+S
Sbjct: 376 RR----LQRDMKSIVNARIS 391

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/361 (21%), Positives = 137/361 (37%), Gaps = 69/361 (19%)

Query: 17  FGTASSNEPFTALNS---IAKDKYG-------NYHLSNQVRSIKDISSVTFNRPHKLGQL 66
           FG ++S   F +LN+   ++ +  G       ++++ N+  +     S + + P + GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  VSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQVVFEEYEY 125
            +W+   + W+  +F         L T    H  + +E  +  PE  + + ++ FE +  
Sbjct: 122 ENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNC 174

Query: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCTWV 185
             L+                   +  +    + AS   S   D      VIDSG   T V
Sbjct: 175 AGLY-------------------IAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHV 215

Query: 186 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNSY 245
           +PV +G     A+K + I GR +  F++  L  R     D ++                 
Sbjct: 216 IPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLRT--------------- 258

Query: 246 FDSFQSRLKTAKEYVLPDFSTSFQGYLRKP---GQTLPEDSQ-----TIILQDELFAVPE 297
                 R+K    YV PD    F  + R P    Q + E+ +      + +  E F  PE
Sbjct: 259 ----AERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQKKIVDVGYERFLAPE 314

Query: 298 TFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATEL 355
            FF+PEIAS   L P +   +  +I   P  +R  L              +F  RL  ++
Sbjct: 315 IFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDI 373

Query: 356 Q 356
           +
Sbjct: 374 K 374

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 69/324 (21%), Positives = 130/324 (40%), Gaps = 49/324 (15%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+  +    ++ + N P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 106 DFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 158

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 159 FFLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLAL 199

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 200 AASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL- 258

Query: 218 FRHYNVMDETI-LVNSIKEKCLFMSPN--SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRK 274
            R    +D ++     IK++  ++ P+    F+ F    +   +YV+ +   + Q     
Sbjct: 259 -RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVENQDKTRQ----- 312

Query: 275 PGQTLPEDSQTIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLX 332
                    + + +  E F  PE FF+PEIAS   L P +   + ++I   P  +R  L 
Sbjct: 313 ---------KVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVLDQTIQACPIDVRKGLY 362

Query: 333 XXXXXXXXXXXIPNFASRLATELQ 356
                        +F  RL  +L+
Sbjct: 363 NNIVLSGGSTMFKDFGRRLQRDLK 386

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 79/361 (21%), Positives = 137/361 (37%), Gaps = 69/361 (19%)

Query: 17  FGTASSNEPFTALNS---IAKDKYG-------NYHLSNQVRSIKDISSVTFNRPHKLGQL 66
           FG ++S   F  L+S   ++ +  G       ++++ N+       +S + + P + GQ+
Sbjct: 66  FGNSTSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASYSLSYPIRHGQV 125

Query: 67  VSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQVVFEEYEY 125
            +W+   + W+  +F         L T    H  + +E  +  PE  + + ++ FE +  
Sbjct: 126 ENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQIAEIFFESFNC 178

Query: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCTWV 185
             L+                   +  +    + AS   S   D      VIDSG   T V
Sbjct: 179 AGLY-------------------IAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHV 219

Query: 186 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNSY 245
           +PV +G     A+K + I GR +  F++  L  R     D ++                 
Sbjct: 220 IPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRT--------------- 262

Query: 246 FDSFQSRLKTAKEYVLPDFSTSFQGYLRKP---GQTLPEDSQ-----TIILQDELFAVPE 297
                 R+K    YV PD    F  + R P    Q + E+ +      + +  E F  PE
Sbjct: 263 ----AERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQEKTQKKVVDVGYERFLAPE 318

Query: 298 TFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATEL 355
            FF+PEIAS   L P +   + ++I   P  +R  L              +F  RL  +L
Sbjct: 319 IFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 377

Query: 356 Q 356
           +
Sbjct: 378 K 378

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 133/361 (36%), Gaps = 69/361 (19%)

Query: 17  FGTASSNEPFTALNSIA------KDKYG----NYHLSNQVRSIKDISSVTFNRPHKLGQL 66
           FG  +S   FT   S +        K G    ++++ N+  +     S + + P + GQ+
Sbjct: 68  FGNTTSATSFTGFTSSSLMSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQV 127

Query: 67  VSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQVVFEEYEY 125
             W    + W+  +F         L T    H  + +E  +  PE  + + ++ FE +  
Sbjct: 128 EDWNHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNC 180

Query: 126 DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCTWV 185
             L+                   +  +    + AS   S   D      VIDSG   T V
Sbjct: 181 AGLY-------------------IAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHV 221

Query: 186 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNSY 245
           +PV +G     A+K + I GR +  F++  L  R    +D ++                 
Sbjct: 222 IPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRT--------------- 264

Query: 246 FDSFQSRLKTAKEYVLPDFSTSFQGYLR---KPGQTLPEDSQ-----TIILQDELFAVPE 297
                 R+K    YV PD    F  + R   K  Q + E+ +      + +  E F  PE
Sbjct: 265 ----AERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVENKEKTQKKVVDVGYERFLAPE 320

Query: 298 TFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATEL 355
            FF+PEIAS   L P +   + ++I   P  +R  L              +F  RL  +L
Sbjct: 321 IFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 379

Query: 356 Q 356
           +
Sbjct: 380 R 380

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 136/366 (37%), Gaps = 68/366 (18%)

Query: 11  GSYEIKFGTASSNEPFTA-----LNSIAKDKYG----NYHLSNQVRSIKDISSVTFNRPH 61
           GS    FG A+S   F       L++    K G    ++++ N+        S + + P 
Sbjct: 57  GSEASYFGNATSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPI 116

Query: 62  KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQVVF 120
           + GQ+ +W+   + W+  +F         L T    H  + +E  +  PE  + + ++ F
Sbjct: 117 RHGQVENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 121 EEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGF 180
           E +    L+                   +  +    + AS   S   D      VIDSG 
Sbjct: 170 ESFNCAGLY-------------------IAVQAVLALAASWTSSKVTDRSLTGTVIDSGD 210

Query: 181 NCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFM 240
             T V+PV +G     A+K + I GR +  F++  L  R     D ++            
Sbjct: 211 GVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRT---------- 258

Query: 241 SPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP---GQTLPEDSQ-----TIILQDEL 292
                      ++K    YV PD    F  + R P    Q + E+ +      + +  E 
Sbjct: 259 ---------AEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKVVDIGYER 309

Query: 293 FAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
           F  PE FF+PEIAS   L P +   + ++I   P  +R  L              +F  R
Sbjct: 310 FLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRR 368

Query: 351 LATELQ 356
           L  +L+
Sbjct: 369 LQRDLK 374

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 123/329 (37%), Gaps = 59/329 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+        S + + P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 94  DFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 146

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLAL 187

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 188 AASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP-- 275
            R     D ++                       ++K    YV PD    F  + R P  
Sbjct: 247 -RERGEADTSLRT-------------------AEKIKQEYCYVCPDIVKEFNKFDRDPSK 286

Query: 276 -GQTLPEDSQ-----TIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEAL 327
             Q + E+ +      + +  E F  PE FF+PEIAS   L P +   + ++I   P  +
Sbjct: 287 FAQFVVENQEKTRRKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDV 345

Query: 328 RPLLXXXXXXXXXXXXIPNFASRLATELQ 356
           R  L              +F  RL  +L+
Sbjct: 346 RKGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 76/362 (20%), Positives = 139/362 (38%), Gaps = 64/362 (17%)

Query: 20  ASSNEPFTALNSIAKDKYG---NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIW 76
           AS++  F   N++A  +     ++++ N+        + + + P + GQ+ +W+   + W
Sbjct: 81  ASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERFW 140

Query: 77  DYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVF 136
           +  +F       +     ++   + +E  +  PE  + + ++ FE +    L+       
Sbjct: 141 ENSIFK------YLRAEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLY------- 187

Query: 137 VPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYK 196
                       +  +    + AS   +   D      VIDSG   T V+PV +G     
Sbjct: 188 ------------IAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGS 235

Query: 197 AVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTA 256
           A+K + I GR +  F++  L  R     D ++                       R+K  
Sbjct: 236 AIKNIPIAGRDITLFIQSLL--RERGEADSSLKT-------------------AERIKQE 274

Query: 257 KEYVLPDFSTSFQGYLRKP---GQTLPEDS-----QTIILQDELFAVPETFFHPEIAS-- 306
             YV PD    F  + R+P    Q + E+      + I +  E F  PE FF+PEIAS  
Sbjct: 275 YCYVCPDIVKEFNKFDRQPEKFAQFIIENQDKTTKKVIDIGYERFLAPEIFFNPEIASSD 334

Query: 307 LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASRLATELQRQCPTDWSCR 366
            L P +   + ++I   P  +R  L              +F+ R    LQR   +  S R
Sbjct: 335 FLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRR----LQRDVKSIVSNR 389

Query: 367 VS 368
           ++
Sbjct: 390 IA 391

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 123/329 (37%), Gaps = 59/329 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+        S + + P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 94  DFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 146

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLAL 187

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 188 AASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP-- 275
            R     D ++                       ++K    YV PD    F  + R P  
Sbjct: 247 -RERGEADTSLRT-------------------AEKIKQEYCYVCPDIVKEFNKFDRDPSK 286

Query: 276 -GQTLPEDSQ-----TIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEAL 327
             Q + E+ +      + +  E F  PE FF+PEIAS   L P +   + ++I   P  +
Sbjct: 287 FAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDV 345

Query: 328 RPLLXXXXXXXXXXXXIPNFASRLATELQ 356
           R  L              +F  RL  +L+
Sbjct: 346 RKGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 69/324 (21%), Positives = 129/324 (39%), Gaps = 49/324 (15%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+  +     + + + P K GQ+ +W    + W+  +F         L T    H
Sbjct: 103 DFYIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSIFK-------YLRTEPEDH 155

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 156 FFLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLAL 196

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 197 AASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 255

Query: 218 FRHYNVMDETI-LVNSIKEKCLFMSPN--SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRK 274
            R    +D ++     IK++  ++ P+    F+ F   +    ++++ +     QG  +K
Sbjct: 256 -RERGEVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFIIEN-----QGKTQK 309

Query: 275 PGQTLPEDSQTIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLX 332
                    + + +  E F  PE FF+PEIAS   L P +   +  +I   P  +R  L 
Sbjct: 310 ---------KIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLY 359

Query: 333 XXXXXXXXXXXIPNFASRLATELQ 356
                        +F  RL  +L+
Sbjct: 360 SNIVLSGGSTMFKDFGRRLQRDLR 383

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/328 (20%), Positives = 124/328 (37%), Gaps = 57/328 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+        S + + P + GQ+ +W+   + W+  +F       +     ++  
Sbjct: 105 DFYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK------YLRAEPEDHF 158

Query: 99  LIASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVV 158
            + +E  +  PE  + + ++ FE +    L+                   +  +    + 
Sbjct: 159 FLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLALA 199

Query: 159 ASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSF 218
           AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L  
Sbjct: 200 ASWTSSQVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL-- 257

Query: 219 RHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP--- 275
           R     D ++                       R+K    YV PD    F  + R+P   
Sbjct: 258 RERGEADTSLRT-------------------AERIKQEYCYVCPDIVKEFNKFDRQPEKF 298

Query: 276 GQTLPED-----SQTIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALR 328
            Q + E+      + + +  E F  PE FF+PEIAS   L P +   +  +I   P  +R
Sbjct: 299 AQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVR 357

Query: 329 PLLXXXXXXXXXXXXIPNFASRLATELQ 356
             L              +F+ RL  +++
Sbjct: 358 KGLYNNIVLSGGSTMFKDFSRRLQRDIK 385

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 123/329 (37%), Gaps = 59/329 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+        S + + P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 101 DFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 153

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 154 FFLLTEPPLNPPENRQQVAEIFFESFNCAGLY-------------------IAVQAVLAL 194

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 195 AASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 253

Query: 218 FRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---K 274
            R     D ++                       R+K    YV PD    F  + R   K
Sbjct: 254 -RERGEQDASLRT-------------------AERIKQEYCYVCPDIVKEFNKFDRDSEK 293

Query: 275 PGQTLPEDSQ-----TIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEAL 327
             Q + E+ +      + +  E F  PE FF+PEIAS   L P +   + E+I   P  +
Sbjct: 294 FAQFIVENKERTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDV 352

Query: 328 RPLLXXXXXXXXXXXXIPNFASRLATELQ 356
           R  L              +F  RL  +L+
Sbjct: 353 RKGLYNNIVLSGGSTMFKDFGRRLQRDLK 381

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 137/368 (37%), Gaps = 69/368 (18%)

Query: 10  NGSYEIKFGTASSNEPFTALNS---IAKDKYG-------NYHLSNQVRSIKDISSVTFNR 59
           N S    FG ++S   F  LN    ++ +  G       ++++ N+        S + + 
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 60  PHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL-IASESCMTLPELSKNMDQV 118
           P + GQ+ +W+   + W+  +F         L T    H  + +E  +  PE  + + ++
Sbjct: 128 PIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHFFLLTEPPLNPPENREQIAEI 180

Query: 119 VFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDS 178
            FE +    L+                   +  +    + AS   S   D      VIDS
Sbjct: 181 FFESFNCAGLY-------------------IAVQAVLALAASWTSSKVTDRSLTGTVIDS 221

Query: 179 GFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCL 238
           G   T V+PV +G     A+K + I GR +  F++  L  R    +D ++          
Sbjct: 222 GDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKT-------- 271

Query: 239 FMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---KPGQTLPEDSQ-----TIILQD 290
                        R+K    YV PD    F  + R   K  Q + E+ +      + +  
Sbjct: 272 -----------AERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQEQTRKKVVDVGY 320

Query: 291 ELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFA 348
           E F  PE FF+PEIAS   L P +   +  +I   P  +R  L              +F 
Sbjct: 321 ERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFG 379

Query: 349 SRLATELQ 356
            RL  +L+
Sbjct: 380 RRLQRDLK 387

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/329 (21%), Positives = 124/329 (37%), Gaps = 59/329 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+        S + + P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 99  DFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 151

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 152 FFLLTEPPLNPPENREQIAEIFFESFNCAGLY-------------------IAVQAVLAL 192

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 193 AASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 251

Query: 218 FRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---K 274
            R     D ++                       R+K    YV PD    F  + R   K
Sbjct: 252 -RERGEADTSLRT-------------------AERIKQEYCYVCPDIVKEFNKFDRDGEK 291

Query: 275 PGQTLPEDSQT-----IILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEAL 327
             Q + E+ ++     + +  E F  PE FF+PEIAS   L P +   + ++I   P  +
Sbjct: 292 FAQFVVENQESTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDV 350

Query: 328 RPLLXXXXXXXXXXXXIPNFASRLATELQ 356
           R  L              +F  RL  +L+
Sbjct: 351 RKGLYNNIVLSGGSTMFKDFGRRLQRDLK 379

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 71/377 (18%), Positives = 151/377 (40%), Gaps = 61/377 (16%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIA-KDKYGNYH---------LSNQVRSIKDISS 54
           P+V+DNGS  +K G +    P     ++A K +Y             + N+ + ++    
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR--GL 70

Query: 55  VTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
           +   RP   G++ +W+    +W +  ++  +  G       +  L+ +E+ +   +  + 
Sbjct: 71  LALRRPISRGEVTNWDDMELLWSHIFYSKLQL-GQGNSQIGDHPLLITEAPLNSTKNRET 129

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
           M ++++E + +D+L+ A  P  +   A G TT                            
Sbjct: 130 MCEILYETFNFDALYVAH-PAVLSLYATGQTTGC-------------------------- 162

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILV 230
           V++ G   +   PV +G     +++++DIGGR     L  ++R++     ++  ++ I V
Sbjct: 163 VLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI-V 221

Query: 231 NSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQD 290
            +IKEK  +++ +  F+         K ++    +TS    ++ P      D Q +    
Sbjct: 222 RTIKEKANYVALDYKFEE-------EKFFIHERENTS---TVKLP------DGQELTFGK 265

Query: 291 ELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNFASR 350
             +   E  F P++       + E +LESI+ +   LR  L            +  F  R
Sbjct: 266 GKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFDQR 325

Query: 351 LATELQRQCPTDWSCRV 367
             +E ++  P     ++
Sbjct: 326 TMSETKKMLPKHTKVKI 342

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 128/324 (39%), Gaps = 49/324 (15%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+  +     S + + P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 99  DFYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 151

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE                 FN  G   +I V    A  
Sbjct: 152 FFLLTEPPLNPPENREQVAEIFFES----------------FNCAG--LYIAVQAVLALA 193

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            +   P    D      VIDSG   T V+PV +G     A+K + I GR +  F+++ L 
Sbjct: 194 ASWTSPKVT-DRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL- 251

Query: 218 FRHYNVMDETI-LVNSIKEKCLFMSPN--SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRK 274
            R     D ++     IK++  ++ P+    F+ F        ++V+       Q   RK
Sbjct: 252 -RERGEQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVES-----QEKTRK 305

Query: 275 PGQTLPEDSQTIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLX 332
                    + + +  E F  PE FF+PEIAS   L P +   + E+I   P  +R  L 
Sbjct: 306 ---------KIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLY 355

Query: 333 XXXXXXXXXXXIPNFASRLATELQ 356
                        +F  RL  +++
Sbjct: 356 NNIVLSGGSTMFKDFGRRLQRDMK 379

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 123/329 (37%), Gaps = 59/329 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ N+        S + + P + GQ+ +W+   + W+  +F         L T    H
Sbjct: 94  DFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDH 146

Query: 99  L-IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADV 157
             + +E  +  PE  + + ++ FE +    L+                   +  +    +
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLAL 187

Query: 158 VASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
            AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L 
Sbjct: 188 AASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL- 246

Query: 218 FRHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP-- 275
            R     D ++                       ++K    YV PD    F  + + P  
Sbjct: 247 -RERGEADTSLRT-------------------AEKIKQEYCYVCPDIVKEFNKFDKDPSK 286

Query: 276 -GQTLPEDSQ-----TIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEAL 327
             Q + E+ +      + +  E F  PE FF+PEIAS   L P +   + ++I   P  +
Sbjct: 287 FAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDV 345

Query: 328 RPLLXXXXXXXXXXXXIPNFASRLATELQ 356
           R  L              +F  RL  +L+
Sbjct: 346 RKGLYNNIVLSGGSTMFKDFGRRLQRDLK 374

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 88/222 (39%), Gaps = 43/222 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH 61
           E + +VID GSY    G + S+ P + L S+    YG Y      ++I    S+   R  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 62  -------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
                  K G ++ W+   + W + L N        L++      + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNE-----LYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
             +V+ E  ++++ + AP    V F A                            R   L
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAG---------------------------RPNCL 156

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 216
           V+D G +   V P++ G+   K+ ++  + G+F+N  +++AL
Sbjct: 157 VVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 139/369 (37%), Gaps = 70/369 (18%)

Query: 10  NGSYEIKFGTASSNEPFTALNSIAK-------DKYG----NYHLSNQVRSIKDISSVTFN 58
           +GS    FG ++S   F +L+S +         K G    ++++ N+        S   +
Sbjct: 66  SGSGRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSYGLS 125

Query: 59  RPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH-LIASESCMTLPELSKNMDQ 117
            P + GQ+ +W+   + W+  +F         L T    H  + +E  +  PE  + + +
Sbjct: 126 YPIRHGQVENWDHMERFWENSIFK-------YLRTEPEDHCFLLTEPPLNPPENREQVAE 178

Query: 118 VVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVID 177
           + FE +    L+                   +  +    + AS   S   D      VID
Sbjct: 179 IFFESFNCAGLY-------------------IAVQAVLALAASWTSSKVIDRSLTGTVID 219

Query: 178 SGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKC 237
           SG   T V+PV +G     A+K + I GR +  F+++ L  R     ++T L  +     
Sbjct: 220 SGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG---EEDTSLRTA----- 271

Query: 238 LFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---KPGQTLPEDSQ-----TIILQ 289
                         R+K    YV PD    F  + R   K  Q + E  +      + + 
Sbjct: 272 -------------ERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVVESQEKTRRKVVDVG 318

Query: 290 DELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALRPLLXXXXXXXXXXXXIPNF 347
            E F  PE FF+PEIAS   L P +   +  +I   P  +R  L              +F
Sbjct: 319 CERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDF 377

Query: 348 ASRLATELQ 356
             RL  +L+
Sbjct: 378 GRRLQRDLK 386

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/328 (21%), Positives = 125/328 (38%), Gaps = 57/328 (17%)

Query: 39  NYHLSNQVRSIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKH 98
           ++++ ++  +     S + + P + GQ+ +W+   + W+  +F       +     ++ +
Sbjct: 90  DFYIGDEAIAASQGPSYSLSYPIRHGQVENWDHMERFWENSIFK------YLRTEPEDHY 143

Query: 99  LIASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVV 158
            + +E  +  PE  + + ++ FE +    L+                   +  +    + 
Sbjct: 144 FLLTEPPLNPPENREQVAEIFFESFNCAGLY-------------------IAVQAVLALA 184

Query: 159 ASDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSF 218
           AS   S   D      VIDSG   T V+PV +G     A+K + I GR +  F++  L  
Sbjct: 185 ASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL-- 242

Query: 219 RHYNVMDETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---KP 275
           R     D T+                       R+K    YV  D    F  + R   K 
Sbjct: 243 RERGEEDTTLRT-------------------AERIKQEYCYVCSDIVKEFNKFDRDSEKF 283

Query: 276 GQTLPEDSQ-----TIILQDELFAVPETFFHPEIAS--LLNPGIIEAILESISMLPEALR 328
            Q + E+S+      I +  E F  PE FF+PEIAS   L P +   + ++I   P  +R
Sbjct: 284 AQFIVENSEKTRRKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVR 342

Query: 329 PLLXXXXXXXXXXXXIPNFASRLATELQ 356
             L              +F  RL  +L+
Sbjct: 343 KGLYNNIVLSGGSTMFKDFGRRLQRDLK 370

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 87/222 (39%), Gaps = 43/222 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH 61
           E + +VID GSY    G + S+ P + L S+    YG Y      + I    S+   R  
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 62  -------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
                  + G ++ W+   + W + L N        L++      + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNE-----LYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
             +V+ E  ++++ + AP    V F A                            R   L
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAG---------------------------RPNCL 156

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 216
           V+D G +   V P++ G+   K+ ++  I G+F+N  +++AL
Sbjct: 157 VVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 86/227 (37%), Gaps = 48/227 (21%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDI-----SSVTFNRP 60
           IVID GSY    G + S+ P     SI    YG Y  + +  + K        S+   RP
Sbjct: 15  IVIDPGSYTTNIGYSGSDCP----ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113
                   + G++  W+   + WD+ L N        L +     ++ +E      E  K
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNE-----LFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173
              +V+ E  ++++ + +PV   V F A                            R   
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAG---------------------------RPNC 158

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
           LV+D G + T V PVI G+   K+  +  I GR++N  +   L  R 
Sbjct: 159 LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 88/224 (39%), Gaps = 47/224 (20%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH 61
           E + +VID GSY    G + S+ P + L S+    YG   L+    S K  S  +   P 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YG--KLTADENSKKMFSEQSIGIPR 66

Query: 62  K---------LGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           K          G ++ W+   + W + L N        LD+      + +E      E  
Sbjct: 67  KDYELKPIIENGLVIDWDTAQEQWQWALRNE-----LYLDSNSGIPALLTEPVWNSMENR 121

Query: 113 KNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDY 172
           K   +V+ E  ++++ + AP    V F A                            R  
Sbjct: 122 KKSLEVLLEGMQFEACYLAPTSTCVSFAAG---------------------------RPN 154

Query: 173 ELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 216
            LV+D G +   V P++ G+   K+ ++  I G+F+N  +++AL
Sbjct: 155 CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 87/222 (39%), Gaps = 43/222 (19%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH 61
           E + +VID GSY    G + S+ P + L S+    YG        ++I    S+   R  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 62  -------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
                  + G ++ W+   + W + L N        LD+      + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNE-----LYLDSNSGIPALLTEPVWNSTENRKK 123

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
             +V+ E  ++++ + AP    V F A                            R   L
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAG---------------------------RPNCL 156

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 216
           V+D G +   V P++ G+   K+ ++  I G+F+N  +++A+
Sbjct: 157 VVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 93/239 (38%), Gaps = 52/239 (21%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKD-------KYGNYHL------SNQVRS 48
           E + +VID GS+    G + ++ P   L S   +         GN  +      +N+ + 
Sbjct: 13  EISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSKK 72

Query: 49  IKDISSVTFNRPH-------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIA 101
           I    S+ + R         K G+++ W+   + WD+ L N        L++        
Sbjct: 73  IFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKN-----ALYLESNSGIPAFL 127

Query: 102 SESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASD 161
           +E      E  K   +V+ E  ++++ + +P P  + F                   AS 
Sbjct: 128 TEPIWNTVENRKKSLEVLLEGLQFEACYLSPTPTCISF-------------------ASG 168

Query: 162 HPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
            P+         LV+D G +   V PVI G+   K+  +  I GRF+N  ++E L  R 
Sbjct: 169 RPNC--------LVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 93/229 (40%), Gaps = 47/229 (20%)

Query: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISS------VTFN 58
           PI ID GSY +K G  + + P T + +    +Y +  L+  +  I + ++      +   
Sbjct: 38  PIAIDFGSYNVKAGYTNQSLP-THVFTNKLTRYRDRKLAKTMTFIGNDTNLDQPLRIQAK 96

Query: 59  RPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQV 118
           RP+    + +WE   +I+DY L +       + + + +  +I +E    L     N  Q+
Sbjct: 97  RPYDGLFIANWEYAEEIFDYTLHH---LGVQTTNGSISNPIILTEKMACLQSQRANWYQL 153

Query: 119 VFEEYE-------YDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRD 171
           +FE ++        DSL+        PF ++G                            
Sbjct: 154 LFETFDVPSATFGLDSLYAFYNNCANPFESDG---------------------------- 185

Query: 172 YELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
             LVI+ G   T +VP+++G       K+++ GGR    +L   L+ ++
Sbjct: 186 --LVINCGHEDTNIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/319 (20%), Positives = 116/319 (36%), Gaps = 63/319 (19%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH---- 61
           IVID GS+    G + ++ P     SI    YGN       + I +   + F R      
Sbjct: 17  IVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIK 72

Query: 62  ---KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQV 118
              +   +V W+   + W+Y L    +F+     + K   ++ +E         K   ++
Sbjct: 73  PIVENSTIVDWDRAQEQWEYALNTDLKFE-----SNKGTPVLLTEPIWNSEASRKKSLEI 127

Query: 119 VFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDS 178
           + E  E+++ +                   L A   A   A   P+         LV+D 
Sbjct: 128 LLESMEFEACY-------------------LAANSSAVSFAMGRPTC--------LVVDI 160

Query: 179 GFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCL 238
           G + + V PVI G+   K+  +  + G++LN  + + L  R         +   +K+K  
Sbjct: 161 GHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREI-----VPIFQVLKKKPD 215

Query: 239 FMSPNSYFDSFQSRLKTAKE------------YVLPDFSTSFQGYL---RKPGQTLPEDS 283
           F+     FD  +S +  A E            ++ P   +SF+  L    K     P   
Sbjct: 216 FVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKRSLEAPWGE 275

Query: 284 QTIILQDELFAVPETFFHP 302
           + I   D  ++  E  F P
Sbjct: 276 ELIFDADTRYSFAEQLFRP 294

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 84/224 (37%), Gaps = 42/224 (18%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH 61
           E   +VID GS+    G + ++ P   L S     YG Y    +     + S     + +
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCPQAILPSC----YGKYTEGEKDELFSEQSIGLPRKDY 68

Query: 62  KL------GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNM 115
           ++      G++V WE   + WD+ + +   F     +T      + +E      E  K  
Sbjct: 69  EIHNIVQNGEVVDWEKAEKQWDWAIRSELRF-----ETNSGMPALLTEPIWNSEENRKKS 123

Query: 116 DQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELV 175
            +V+ E  ++ + +  P    V F A G  T                           LV
Sbjct: 124 LEVLLESMDFSACYLVPTATAVSF-AMGRPTC--------------------------LV 156

Query: 176 IDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219
           +D G + T V PV+ G+   K+  +  I G  LN  +R  L+ R
Sbjct: 157 VDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/249 (21%), Positives = 95/249 (38%), Gaps = 56/249 (22%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNY-------HLSNQVRSIKDISS 54
           E   ++ID GS+    G + ++ P     SI    YG Y         + + + I   SS
Sbjct: 13  EITAVIIDPGSFSTNIGYSGTDYP----QSILPSSYGTYKETTEGQESTTKRKRIFSESS 68

Query: 55  VTFNRPH-------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMT 107
           +   RP        + G ++ W+   + W + L +        L +T     + +E    
Sbjct: 69  IQIPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQ-----LHLQSTSGIPALLTEPIWN 123

Query: 108 LPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNK 167
             E  K   +++ E   +++ + + VP  V F A                          
Sbjct: 124 SVENRKKSLEILLEGMNFEACYLSSVPTCVSFAAG------------------------- 158

Query: 168 DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDET 227
             R   LV+D G + T V PV+ G+   K+  +  I G+++N  + + L  R      E 
Sbjct: 159 --RPNCLVVDIGHDTTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPR------EI 210

Query: 228 ILVNSIKEK 236
           I + SIK++
Sbjct: 211 IPLFSIKQR 219

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/333 (20%), Positives = 122/333 (36%), Gaps = 59/333 (17%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPH---- 61
           I+ID GS+    G + ++ P   L S     YG Y    +  S+ +  S+   R      
Sbjct: 17  IIIDPGSFNTNIGYSGTDCPQAILPSC----YGQYINDEEKPSLFNEQSIGLPRKDYEIK 72

Query: 62  ---KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQV 118
              + G++V W+   + W++ + +   F+     + K    + +E      +  K   +V
Sbjct: 73  EIVRSGEVVDWDKAQEQWEWAIKSVLLFE-----SNKGLPALLTEPIWNSEDNRKKSLEV 127

Query: 119 VFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDS 178
           + E  ++++ +  P    V F A G  T                           LV+D 
Sbjct: 128 LLEGMDFEACYLTPTATAVSF-AMGRPTC--------------------------LVVDI 160

Query: 179 GFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVN------- 231
           G + T V PVI G+   K+  +  I G  LN  +R +L  R    + +            
Sbjct: 161 GHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKRS 220

Query: 232 ---SIKEKCL-FMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKP-----GQTLPED 282
               I    L F++   +F  F+  +       L  F +  +   ++      G+ L  D
Sbjct: 221 FDYEIHPSLLNFVNERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFD 280

Query: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEA 315
           S+T     E    PET   PE   +   G++E 
Sbjct: 281 SETRFNIAEQLFRPETAKFPEDWPISKDGVVET 313

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 84/224 (37%), Gaps = 38/224 (16%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNS-----IAKDKYGNYHLSNQVRSIKDISSVT 56
           E + +VID GSY    G + ++ P   + S        +K G    ++Q   +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMD 116
             R  + G +V WE   + W + + +  +F  +     K      +E+     E  K   
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVI 176
           +V+ E  E+++ + AP    V F                   A   P+         LV+
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSF-------------------AMGRPTC--------LVV 159

Query: 177 DSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
           D G +   V PV+ G+   K+  +  + G+ LN  + + L  R 
Sbjct: 160 DIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 90/229 (39%), Gaps = 51/229 (22%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDIS--------SVTF 57
           +VID GS+    G + ++ P   L S     YG++  +       + S        S+TF
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSC----YGHHKTNENADGDDEKSKPKVFAEQSLTF 72

Query: 58  NRPH-------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPE 110
            RP        + G +V W+   + WD+ L N        L++ K    + +ES     E
Sbjct: 73  PRPDYEIKPIVENGLVVDWDAAQEQWDWALRNV-----LHLESNKGVPALMTESIWNTME 127

Query: 111 LSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYR 170
                 +V+ E  ++++ + +  P  V F                   A+  P+      
Sbjct: 128 NKTKSLEVLLETLDFEACYISSTPTCVSF-------------------ATGRPNC----- 163

Query: 171 DYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219
              LV+D G +     PV+ G+   ++ ++  I G+F++  + + L  R
Sbjct: 164 ---LVVDVGHDTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/236 (23%), Positives = 85/236 (36%), Gaps = 57/236 (24%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNY-----------------HLSN 44
           E + +VID GSY    G + ++ P   L S    +YG Y                  L  
Sbjct: 13  EISAVVIDPGSYTTNIGYSGTDCPQVTLPS----RYGQYISEEEEKDEQEQQEDDRKLKQ 68

Query: 45  QVRSIKDISSVTFNRPHKL----GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLI 100
           +V S + I     N   K     G ++ W+   + W + + +   F+     +TK     
Sbjct: 69  KVFSEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFE-----STKGMPAF 123

Query: 101 ASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVAS 160
            +E      E  K   +V+ E  E+++ F +P P  V F A G                 
Sbjct: 124 LTEPIWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSF-AMG----------------- 165

Query: 161 DHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREAL 216
                    R   LV+D G +   V PV+ G+   K+     I G  LN  L + L
Sbjct: 166 ---------RPTCLVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 93/226 (41%), Gaps = 44/226 (19%)

Query: 5   PIVIDNGSYEIKFGTASSNEP---FTALNSIAKDKYGNYHLS------NQVRSIKDISSV 55
           PI ID GS E++ G  + ++P   FT   S  +D+  N +L+      N   S++  +  
Sbjct: 38  PIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQAKS 97

Query: 56  TFNRPHKLGQLVS-WELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKN 114
            ++     G +VS W+   +I +Y   +     G + +   +  ++ +E   TL    +N
Sbjct: 98  PYD-----GAIVSNWDYTEEIMEYTFHHL----GVNGNDGVSNPILMTEKLATLQSQREN 148

Query: 115 MDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYEL 174
             Q++FE       F  P   F       D+     A  DA                  L
Sbjct: 149 WYQLLFE------CFGVPQVTFGI-----DSLFSFYANNDATASG--------------L 183

Query: 175 VIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
           VI+SG   T V+PV+ G       K+++ GGR    +L   L+ ++
Sbjct: 184 VINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLLALKY 229

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 84/234 (35%), Gaps = 55/234 (23%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYH------------LSNQVRSIKDIS 53
           ++ID GSY    G A ++ P     SI    +G  H             + + R +    
Sbjct: 17  VIIDPGSYTTNIGYAGTDCP----QSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQ 72

Query: 54  SVTFNRPH-------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCM 106
           S+   RP        + GQ+  W+   + W + L N        +++ +    + +E   
Sbjct: 73  SIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-----LHIESNRGIPAMLTEPLW 127

Query: 107 TLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDN 166
              E      +++ E  E+++ +                   L A   A   A+  P+  
Sbjct: 128 NSKENRSKSLEILLEGMEFEACY-------------------LTATSTAVSFATGRPNS- 167

Query: 167 KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
                  L++D G +   V PVI G+   K+ +     GRFLN  L + L  R 
Sbjct: 168 -------LIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 89/241 (36%), Gaps = 58/241 (24%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISS--VTFNR 59
           E + +VID GSY    G + ++ P    +SI   +YG++  +N+    +D  S      R
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCP----HSILPSRYGSFKKTNKDSGDEDTKSDESATKR 68

Query: 60  PH--------------------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL 99
            H                    + G +  W+   + W++ L N        L++TK    
Sbjct: 69  AHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNE-----LFLESTKGIPA 123

Query: 100 IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVA 159
           + +E      +  K   + + E   +++ + AP    V F A G                
Sbjct: 124 LLTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSF-ATG---------------- 166

Query: 160 SDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219
                     R   LV+D G +   V PV+ G+   K+ ++    G+++N  +   L  R
Sbjct: 167 ----------RANCLVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPR 216

Query: 220 H 220
            
Sbjct: 217 E 217

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 83/224 (37%), Gaps = 38/224 (16%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNS-----IAKDKYGNYHLSNQVRSIKDISSVT 56
           E + +VID GSY    G + ++ P   + S      A  K G    ++Q   I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFM-IMPRPDFE 71

Query: 57  FNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMD 116
             R  + G +V WE   + W + + +  +F+ +     K      +E+     E  K   
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVI 176
           +V+ E  E+++ + AP      F                   A   P+         LV+
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSF-------------------AMGRPTC--------LVL 159

Query: 177 DSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
           D G +   V PV+ G+   K+  +  + G+ LN  +   L  R 
Sbjct: 160 DIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 47/241 (19%), Positives = 93/241 (38%), Gaps = 58/241 (24%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSI------AKDKYGNYHLSNQ-------------V 46
           +VID GS+    G + S+ P + L S        +D+  +++  ++             +
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIKI 76

Query: 47  RSIKDISSVTFNRPH-------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHL 99
           R + +  SV + R +       + G++V W+   + W + L N        L + +    
Sbjct: 77  RKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENE-----LFLKSNEGVPA 131

Query: 100 IASESCMTLPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVA 159
           + +E      E  K   +V+ E   +++ + +  P  V F A                  
Sbjct: 132 LLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAG----------------- 174

Query: 160 SDHPSDNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219
                     R   LV+D G +   V PV+ G+ + K+ ++  I G++LN  + + L  R
Sbjct: 175 ----------RSNCLVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPR 224

Query: 220 H 220
            
Sbjct: 225 E 225

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 38.5 bits (88), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 107/265 (40%), Gaps = 42/265 (15%)

Query: 3   EAPIVIDNGSYEIKFGTASSNEPFTAL-NSIAK--DKYGNYHLSNQVRSIK-DISSVTFN 58
           E  I ID GS E++ G  +   P     N IA+  D+  N +L+        D+S  + +
Sbjct: 36  ETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQS 95

Query: 59  RPHKLGQLVS-WELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQ 117
           R    G LV+ W+    I +Y   +         D   N  +I +E    L     N  Q
Sbjct: 96  RSPYDGALVTNWDYTEDIMEYTFHH---LGVKGTDGIPNP-IIMTEKLGALHSQRDNWYQ 151

Query: 118 VVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVID 177
           ++FE       F AP   F       D+     A  DA                  LVI 
Sbjct: 152 LLFE------CFGAPQVTFGL-----DSLFSFYANNDASASG--------------LVIS 186

Query: 178 SGFNCTWVVPVIKGVPYYKAVKKLDIGGR----FLNGFLREALSFRHYNVMDETILVNSI 233
           SG   T ++PV+ G       K+++ GGR    +L+  L  AL + ++ +   T    ++
Sbjct: 187 SGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQFKAL 244

Query: 234 KEKCLFMSPNSYFDSFQSRLKTAKE 258
            ++  ++SP+ Y D  Q R+ T +E
Sbjct: 245 YDEFCYVSPD-YQDEIQ-RILTLEE 267

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 62/157 (39%), Gaps = 32/157 (20%)

Query: 64  GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEY 123
           G +  W++  + W + L      +   +D+ K    + +E      +  K   +V+ E+ 
Sbjct: 168 GMVADWDIAEEQWSWALR-----EKLYMDSFKGIPALLTEPVWNTVQNRKKSLEVLLEKM 222

Query: 124 EYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCT 183
           E+++ +   +P  V F                   A+  P+         LV+D G +  
Sbjct: 223 EFEACYLTTIPTNVSF-------------------AAGKPNC--------LVVDVGHDTC 255

Query: 184 WVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
            V PVI G+   K+V++    GR+LN  L   +  R 
Sbjct: 256 SVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 84/227 (37%), Gaps = 47/227 (20%)

Query: 2   EEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSN--QVRSIKDISSVTFNR 59
           E + +VID GSY    G + ++ P   L S     YG+Y  ++  + +  K  S  +   
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDCPQAILPSC----YGDYTNTDDPEGKKKKVFSEQSICI 68

Query: 60  PHK---------LGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPE 110
           P K          G ++ W+   + W + L N        L +      + +E      E
Sbjct: 69  PRKDYEIKPIVENGVVIDWDAAQEQWSWALENQ-----LYLRSNSGIPALLTEPIWNTVE 123

Query: 111 LSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYR 170
             K   +++ E  ++++ + A  P  V F                              R
Sbjct: 124 NRKKSLELLLEGMDFEACYLASTPTCVSFGTG---------------------------R 156

Query: 171 DYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALS 217
              LV+D G +   V PV+ G+   K+ K+    G +LN  ++  +S
Sbjct: 157 SSCLVVDLGHDTCSVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 89/235 (37%), Gaps = 59/235 (25%)

Query: 4   APIVIDNGSYEIKFGTASSNEP---FTALNSIAKDK--------YGNYHLSNQVRSIKDI 52
            PI ID GS +++ G  +   P   F  + +  +D+         GN  L +Q  +++  
Sbjct: 38  VPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQ--AVRSQ 95

Query: 53  SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELS 112
           S   F+ P     + +W    +I DY   +     G S +      ++ +E   T+    
Sbjct: 96  SRSPFDGPF----VTNWNFTEEIMDYTFHHL----GVSPNNGVRNPILLTERMATVQSQR 147

Query: 113 KNMDQVVFEEYEY-------DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSD 165
            N  Q++FE Y         DSL+      F   N  G+ T                   
Sbjct: 148 ANWYQIMFETYNVPGVTFGIDSLYG-----FYNQNTSGNKTG------------------ 184

Query: 166 NKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
                   LVID G   T V+PV+ G       K+++ GGR    +L + ++ ++
Sbjct: 185 --------LVIDCGHEDTNVIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 86/233 (36%), Gaps = 56/233 (24%)

Query: 4   APIVIDNGSYEIKFGTASSNEPF----------------TALNSIAKDKYGNYHLSNQVR 47
            PI +D GSYE++ G  S + P                  AL  I  D      L N VR
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGND----CSLDNAVR 95

Query: 48  SIKDISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMT 107
           S           P+    + +WE    +  Y   +     G   +   +  +I +E   T
Sbjct: 96  SHS-------RSPYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMAT 144

Query: 108 LPELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNK 167
           +     N  Q++FE Y         +P  V F  +G  +            A++ P    
Sbjct: 145 VQAQRSNWYQLLFECY--------GIPQ-VTFGIDGLFS----------FYANNSPDSTG 185

Query: 168 DYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
                 L+I+SG   T ++PVIKG       K++D GG     +L+  LS ++
Sbjct: 186 ------LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 87/236 (36%), Gaps = 59/236 (25%)

Query: 3   EAPIVIDNGSYEIKFGTASSNEPF----TALNSIAKDKY-------GNYHLSNQVRSIKD 51
           ++PI ID GS +++ G  +   P      AL      K        GN  L +Q  +++ 
Sbjct: 37  QSPIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQ--AVRS 94

Query: 52  ISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPEL 111
            S   F+ P     + +W L  +I DY   +     G   D      ++ +E   T+   
Sbjct: 95  QSRSPFDGPF----VTNWNLTEEILDYTFHHL----GVVPDNGIPNPILLTERLATVQSQ 146

Query: 112 SKNMDQVVFEEYEY-------DSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPS 164
             N  Q++FE Y         DSLF      F  +N  G+ T                  
Sbjct: 147 RTNWYQILFETYNVPGVTFGIDSLFS-----FYNYNPSGNKTG----------------- 184

Query: 165 DNKDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
                    LVI  G   T V+PV+ G       K+++ GG     +L + ++ ++
Sbjct: 185 ---------LVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 50/135 (37%), Gaps = 17/135 (12%)

Query: 265 STSFQGYLRKPGQTLPEDSQTIILQDEL------FAVPETFFHPEIASLLNPGIIE---- 314
           +++   +LR P    P DS+ I  Q ++        VPE  F P I  L   G++E    
Sbjct: 585 NSTLHLFLRGP---RPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCET 641

Query: 315 AILESISMLPEALRPL---LXXXXXXXXXXXXIPNFASRLATELQRQCPTDWSCRVSVPT 371
            +L+       AL      +            +P    R+  E     P     +V++  
Sbjct: 642 VLLKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLAK 701

Query: 372 GDARLYGWKCMQKFS 386
            D  L  WK M KF+
Sbjct: 702 -DPSLSAWKGMAKFA 715

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 70/176 (39%), Gaps = 29/176 (16%)

Query: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETIL 229
           +   LVID   + + V P++ GV     + K   GG FL+  +      + ++ +DE + 
Sbjct: 152 KKTSLVIDISGSGSSVTPIVDGVIIKNGIVKSKYGGDFLDYQI-----IKKFSTIDEDLE 206

Query: 230 VNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQ 289
                   +++S NS+  +F+  +    +  L D    ++  LR   +   + S T +  
Sbjct: 207 EEMTNSSNIWVSSNSWIKNFKKTMLQVTDKKLQDVEKYYEEQLRLQAELQNQGSITSVGT 266

Query: 290 D---------------------ELFAVPETFFHPEIASL---LNPGIIEAILESIS 321
           +                     EL+   E  F P++AS     + G+ E I  SI+
Sbjct: 267 NPLSVKKEYLYRSRKTVTFESRELYQFGEYLFQPQLASEQYNRDDGLGELIYRSIT 322

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
           LVID G   T V+PV++G       K+++ GGR    +L + L+ ++
Sbjct: 183 LVIDCGNEETDVIPVVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

>KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {ON}
           Anc_6.373 YCR093W
          Length = 2091

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 233 IKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYL 272
           + EK LF+  N   D+F  +++  K+ + P+++T F GYL
Sbjct: 787 VTEKVLFIVNNLTMDNFDEKIQGLKQALTPNYATWFSGYL 826

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 44/224 (19%), Positives = 83/224 (37%), Gaps = 46/224 (20%)

Query: 6   IVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDI---SSVTFNRPH- 61
           +VID GS+    G + ++ P   L S     YG      +  + K I    S+   RP  
Sbjct: 17  VVIDPGSFSTNIGFSGTDCPQAILPSC----YGEQKAETEDNAPKKIFAEQSIGIPRPDY 72

Query: 62  ------KLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNM 115
                 +   +V W+   + W + L      D   L++      + +E      E     
Sbjct: 73  EIKPIVQNSMVVDWDAAEEQWSWALK-----DILYLNSNSGIPALLTEPIWNTLENKTKS 127

Query: 116 DQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELV 175
            +++ E  ++++ + +  P  V F                   AS  P+         LV
Sbjct: 128 LEILLESLQFEACYLSSTPTCVSF-------------------ASGRPNC--------LV 160

Query: 176 IDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFR 219
           +D G + T V PV+ G+   K+  +  + G  +N  +++ L  +
Sbjct: 161 VDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPLKGK 204

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 108 LPELSKNMDQVVFEEYEYDSLFKAPV--PVFVPFNAE-GDTTHILVAK-----EDADVVA 159
           +P++S N+  +++EE++Y++L K P    +F     E  D  H+         EDAD ++
Sbjct: 227 IPKISLNILSIIYEEFDYETLLKTPSTEAIFKSVVTELLDICHLQCESMIEQFEDADTIS 286

Query: 160 SDHPSDNKDYRDYELV 175
            D   +    +D ELV
Sbjct: 287 FDRIIEYTKQKDKELV 302

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 88/227 (38%), Gaps = 45/227 (19%)

Query: 5   PIVIDNGSYEIKFGTASSNEP---FTALNSIAKDK--------YGNYHLSNQVRSIKDIS 53
           PI ID GS  ++ G  +   P   F  + +  +D+         GN  L +Q  +++  S
Sbjct: 39  PIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQ--AVRSQS 96

Query: 54  SVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSK 113
              F+ P     + +W    +I DY   +     G   +   +  ++ +E   T+     
Sbjct: 97  RSPFDGPF----VTNWNFTEEIMDYTFHHL----GVLPNNGISNPILLTERMATVQSQRA 148

Query: 114 NMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYE 173
           N  Q++FE Y    +      ++  +N                    ++PS NK      
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYN--------------------NNPSGNK----TG 184

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
           LVID     T VVP++ G       K+++ GG     +L + ++ ++
Sbjct: 185 LVIDCSHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>NDAI0A00200 Chr1 (19148..20140) [993 bp, 330 aa] {ON} Anc_1.11
          Length = 330

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 93  TTKNKHLIASESCMTLPELSKNMDQVVFEEYEYD 126
            T +KH  + E C+ LP LSK++DQV   E E+D
Sbjct: 165 NTNSKH--SEEICLNLPNLSKDIDQVESNENEFD 196

>KNAG0B00240 Chr2 complement(30285..33833) [3549 bp, 1182 aa] {ON}
           Anc_1.509 YJR061W
          Length = 1182

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 6/91 (6%)

Query: 6   IVIDNGSYEIKFGTASSNEPFT-ALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKLG 64
           I +D+G Y    G + S E +   LN I  DKY  Y   N+V  + D S +  + P  +G
Sbjct: 574 IDVDSGLYIDITGLSVSTEFYNKGLNDII-DKYDMYSAYNEVMKM-DPSDI--HNPD-IG 628

Query: 65  QLVSWELESQIWDYCLFNPDEFDGWSLDTTK 95
           + ++    + + DY L N  EFD W +D  K
Sbjct: 629 EGLAALNATALRDYVLANKKEFDDWKVDGAK 659

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 54/229 (23%), Positives = 92/229 (40%), Gaps = 49/229 (21%)

Query: 4   APIVIDNGSYEIKFGTASSNEP---FTALNSIAKDK--------YGNYHLSNQVRSIKDI 52
           A I ID GSY I+ G  + N P   F    +  +D+         GN  L +Q  +I+  
Sbjct: 37  ARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQ--TIRSQ 94

Query: 53  SSVTFNRPHKLGQLVS-WELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPEL 111
           S   F+     G L++ W+    + +Y   +     G S +   +  LI +E    L   
Sbjct: 95  SKSPFD-----GTLLTNWDYVEDMLEYTFHHL----GVSGNNGVSNPLIINERLACLQSQ 145

Query: 112 SKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRD 171
             +  Q++FE ++   L +    +   F+  G++T     KED                 
Sbjct: 146 RNSWYQLLFETFD---LPEVSFGIDSLFSFYGNST-----KEDG---------------- 181

Query: 172 YELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
             LVI+ G   T V+P++ G       K+++ GG     FL   L+ ++
Sbjct: 182 --LVINCGNEETDVIPIVGGRGILSECKRINWGGSQSTNFLSSLLTLKY 228

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 90/230 (39%), Gaps = 48/230 (20%)

Query: 3   EAPIVIDNGSYEIKFGTASSNEPFTAL-NSIAKDK----------YGNYHLSNQVRSIKD 51
           E PI ID GSYE++ G  SS+ P     N + + +           GN  L +Q  +++ 
Sbjct: 36  ETPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQ--TVRS 93

Query: 52  ISSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPEL 111
            S   F+       + +W+    I  Y  FN     G   D +    LI +E   +L   
Sbjct: 94  QSKSPFDGSF----IANWDYVEDIMQYT-FN---HLGVVGDNSVRNPLIINEPLGSLQSQ 145

Query: 112 SKNMDQVVFEEYEYDSLFKAPVPVFVPF-NAEGDTTHILVAKEDADVVASDHPSDNKDYR 170
            KN  +++FE +   ++      +F  + N EG+   I                      
Sbjct: 146 RKNWYELLFECFHLPNVSFGIDGMFGFYANNEGNQDGI---------------------- 183

Query: 171 DYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRH 220
               VI+     T V+PV+ G       K+++ GGR    +L + +S ++
Sbjct: 184 ----VINCSNEETDVIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 57/146 (39%), Gaps = 13/146 (8%)

Query: 174 LVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLN----GFLREAL-SFRHYNVMDETI 228
           LVID G   T V P++ G      V K   GG FL+      L E L S  H    +   
Sbjct: 148 LVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSAT 207

Query: 229 LVNSIKEKCLFMSPN--SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQT-----LPE 281
            +   K   L +     S  + +       ++        ++  Y+  P        L +
Sbjct: 208 WIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKK 267

Query: 282 DSQTIILQ-DELFAVPETFFHPEIAS 306
           +++T+ L+  + + V E  F P++AS
Sbjct: 268 NNKTVTLELRDCYRVCEYLFQPQLAS 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,901,266
Number of extensions: 1965882
Number of successful extensions: 5353
Number of sequences better than 10.0: 146
Number of HSP's gapped: 5298
Number of HSP's successfully gapped: 155
Length of query: 420
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 308
Effective length of database: 40,638,807
Effective search space: 12516752556
Effective search space used: 12516752556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)