Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0G13750g8.259ON1399139969570.0
Kwal_56.238258.259ON1396140246950.0
SAKL0H17094g8.259ON1422142739210.0
TDEL0F038608.259ON1399141036600.0
KAFR0B027108.259ON1416141835850.0
Suva_10.1708.259ON1416144035310.0
Skud_12.1548.259ON1417144235230.0
Ecym_43118.259ON1376137735220.0
AGR089C8.259ON1370136635100.0
Smik_12.1458.259ON1418138734890.0
NCAS0B050008.259ON1409139634790.0
ZYRO0C01716g8.259ON1413137934580.0
Kpol_392.88.259ON1427138434370.0
YLR086W (SMC4)8.259ON1418143834320.0
NDAI0B019708.259ON1415139033490.0
KNAG0G020208.259ON1444139732170.0
KLLA0F19085g8.259ON1372139031980.0
TBLA0E044108.259ON1422144931530.0
TPHA0J007208.259ON1393139031450.0
CAGL0L12188g8.259ON1398140829600.0
KAFR0C032008.68ON12237473682e-34
KLTH0A02706g8.68ON12281683601e-33
KLLA0D07502g8.68ON12438883592e-33
NDAI0G033208.68ON12311643556e-33
Kwal_23.50438.68ON12253313556e-33
NCAS0C040008.68ON12231643512e-32
AGL023W8.68ON12229583502e-32
TPHA0P003408.68ON12191643475e-32
Skud_6.648.68ON12301643476e-32
Ecym_73038.68ON12228903466e-32
YFL008W (SMC1)8.68ON12251643459e-32
Kpol_1011.58.68ON12211723441e-31
SAKL0B02288g8.68ON12283573441e-31
Smik_6.718.68ON12281643432e-31
KNAG0G009108.68ON12261633386e-31
TBLA0G035308.68ON12321623305e-30
CAGL0F02079g8.68ON12231643271e-29
TDEL0C009608.68ON12221703271e-29
ZYRO0F03828g8.68ON12172123242e-29
Skud_6.1197.186ON11707212949e-26
SAKL0D06116g1.295ON12298052681e-22
Suva_6.528.68ON12642172617e-22
KLLA0D16005g7.186ON11707072393e-19
CAGL0D05258g7.186ON11701842366e-19
CAGL0H02805g1.295ON12197242366e-19
KLTH0E04774g7.186ON11701822322e-18
SAKL0F07282g7.186ON11701842312e-18
Suva_6.1047.186ON11701842313e-18
Smik_7.3467.186ON11701842303e-18
YFR031C (SMC2)7.186ON11701842303e-18
NDAI0G020707.186ON11711842294e-18
Ecym_43907.186ON11701822277e-18
Kpol_1063.207.186ON11711822251e-17
NCAS0E019207.186ON11701822213e-17
KNAG0L011607.186ON11701842214e-17
TBLA0D046107.186ON11741842171e-16
Ecym_63221.295ON12327222133e-16
KLLA0A00286g1.295ON12248092107e-16
Kpol_1018.21.295ON12112002081e-15
ZYRO0G21296g1.295ON12272322081e-15
KAFR0A016101.295ON12272312053e-15
Kwal_14.24351.295ON12471962035e-15
KLTH0H09966g1.295ON12242212035e-15
TDEL0H026107.186ON1170862001e-14
TDEL0D016201.295ON12232122001e-14
NCAS0A093301.295ON12272371992e-14
TPHA0C044407.186ON1170811972e-14
ZYRO0D15642g7.186ON1170791972e-14
KAFR0G029307.186ON1170731972e-14
TBLA0C027401.295ON11191621972e-14
KNAG0B052301.295ON12251061929e-14
NDAI0G056301.295ON12291201902e-13
Smik_10.1671.295ON12291971874e-13
Suva_6.1491.295ON12302101864e-13
TPHA0I010901.295ON1216841849e-13
YJL074C (SMC3)1.295ON12302101831e-12
Skud_10.1701.295ON1230841759e-12
AAL182W1.295ON12312301741e-11
AGR236W7.186ON1170861632e-10
Kwal_55.204217.186ON1170731623e-10
KNAG0L006307.101ON11081591561e-09
KLLA0F07997g7.101ON11194831435e-08
SAKL0B09526g7.101ON10991611265e-06
KLTH0D02816g7.101ON10941691194e-05
NCAS0I005707.101ON10952151184e-05
ZYRO0G01584g7.101ON10881661169e-05
TDEL0E013404.237ON1106851151e-04
Kwal_26.72047.101ON11171601122e-04
CAGL0F01155g7.101ON11051731104e-04
TBLA0E021907.101ON10891911095e-04
KAFR0D013307.101ON10801851096e-04
TPHA0L006007.101ON11171851078e-04
ZYRO0B12122g4.237ON1109791050.001
Ecym_26257.101ON10971651030.003
NDAI0A084507.101ON1119449990.008
CAGL0H05071g4.237ON111065990.008
NCAS0J013904.237ON109679980.009
Skud_15.1217.101ON1093163980.010
AEL337C7.101ON1097162960.016
TDEL0H034907.101ON110385960.017
TPHA0B008404.237ON111968960.018
Skud_12.4684.237ON112068960.018
YLR383W (SMC6)4.237ON111468950.021
Suva_10.5004.237ON111568950.021
Smik_12.4704.237ON111468950.021
Kpol_1044.137.101ON1103125950.023
NDAI0J021804.237ON110868950.023
KNAG0B060104.237ON111768950.023
Ecym_53444.237ON110258950.025
KLLA0E05303g4.237ON109892940.028
Suva_15.1337.101ON1092157940.028
Smik_15.1317.101ON109362940.030
YOL034W (SMC5)7.101ON109362930.034
Kwal_26.93804.237ON110285910.072
TBLA0I028904.237ON109871900.099
AER044W4.237ON110357890.11
TBLA0A053001.67ON70763860.26
SAKL0H03322g4.237ON111147860.27
Kpol_483.104.237ON111847850.31
TDEL0G028102.351ON109471820.74
KAFR0A060404.237ON110268820.85
TBLA0A059706.251ON119850810.91
Suva_10.4054.46ON91698810.99
KLTH0D14080g4.237ON110253811.0
SAKL0A02596g6.289ON634210791.5
Kpol_1018.595.596ON29099771.8
AFL131W6.251ON118950782.0
Skud_15.553.93ON1038112782.1
Ecym_10721.67ON68398772.8
Ecym_21646.251ON117150773.0
NCAS0B087001.67ON71572754.9
TBLA0A057201.110ON1307108746.1
TPHA0B008304.238ON2536237746.6
Skud_4.1964.238ON1792308738.3
Suva_16.5117.535ON651116739.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0G13750g
         (1399 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  2684   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1813   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1514   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1414   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1385   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1364   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1361   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1361   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1356   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1348   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1344   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1336   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1328   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1326   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1294   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1243   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1236   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1219   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1216   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1144   0.0  
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   146   2e-34
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   143   1e-33
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   142   2e-33
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             141   6e-33
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   141   6e-33
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   139   2e-32
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   139   2e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   138   5e-32
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   138   6e-32
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   137   6e-32
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   137   9e-32
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   137   1e-31
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   137   1e-31
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   136   2e-31
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   134   6e-31
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   131   5e-30
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   130   1e-29
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   130   1e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   129   2e-29
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...   117   9e-26
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...   107   1e-22
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   105   7e-22
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    97   3e-19
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    96   6e-19
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    96   6e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    94   2e-18
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    94   2e-18
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    94   3e-18
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    93   3e-18
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    93   3e-18
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    93   4e-18
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    92   7e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    91   1e-17
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    90   3e-17
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    90   4e-17
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    88   1e-16
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    87   3e-16
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    86   7e-16
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    85   1e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    85   1e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    84   3e-15
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    83   5e-15
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    83   5e-15
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    82   1e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    82   1e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    81   2e-14
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    80   2e-14
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    80   2e-14
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...    80   2e-14
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    80   2e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    79   9e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    78   2e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   4e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    76   4e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    75   9e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    75   1e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   9e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    72   1e-11
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    67   2e-10
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    67   3e-10
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    65   1e-09
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    60   5e-08
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    53   5e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    50   4e-05
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    50   4e-05
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    49   9e-05
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    49   1e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    48   2e-04
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    47   4e-04
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    47   5e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    47   6e-04
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    46   8e-04
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.001
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    44   0.003
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    43   0.008
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.008
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.009
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    42   0.010
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    42   0.016
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    42   0.017
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.018
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.018
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.021
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.021
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.021
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.023
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.023
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.023
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    41   0.025
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    41   0.028
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    41   0.028
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.030
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    40   0.034
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    40   0.072
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.099
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.11 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    38   0.26 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.27 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    37   0.31 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    36   0.74 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.85 
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    36   0.91 
Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {...    36   0.99 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   1.0  
SAKL0A02596g Chr1 complement(235391..237295) [1905 bp, 634 aa] {...    35   1.5  
Kpol_1018.59 s1018 complement(175990..176862) [873 bp, 290 aa] {...    34   1.8  
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    35   2.0  
Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON...    35   2.1  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...    34   2.8  
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    34   3.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    33   4.9  
TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON} Anc_...    33   6.1  
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    33   6.6  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    33   8.3  
Suva_16.511 Chr16 complement(876329..878284) [1956 bp, 651 aa] {...    33   9.1  

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 2684 bits (6957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1328/1399 (94%), Positives = 1328/1399 (94%)

Query: 1    MESPLSKKQKTFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS 60
            MESPLSKKQKTFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS
Sbjct: 1    MESPLSKKQKTFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS 60

Query: 61   NVPYLQPLKSELSSSRGRVYSQXXXXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGL 120
            NVPYLQPLKSELSSSRGRVYSQ            KLELIQLSPTKKTRLESQKTEQVRGL
Sbjct: 61   NVPYLQPLKSELSSSRGRVYSQSPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGL 120

Query: 121  AQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180
            AQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN
Sbjct: 121  AQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180

Query: 181  KMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT 240
            KMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT
Sbjct: 181  KMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT 240

Query: 241  SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL 300
            SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL
Sbjct: 241  SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL 300

Query: 301  EDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXX 360
            EDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESG             
Sbjct: 301  EDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKK 360

Query: 361  XXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNV 420
                RSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNV
Sbjct: 361  LTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNV 420

Query: 421  TIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEE 480
            TIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEE
Sbjct: 421  TIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEE 480

Query: 481  LFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQE 540
            LFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQE
Sbjct: 481  LFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQE 540

Query: 541  KRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQ 600
            KRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQ
Sbjct: 541  KRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQ 600

Query: 601  IIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISG 660
            IIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISG
Sbjct: 601  IIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISG 660

Query: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL 720
            FHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL
Sbjct: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL 720

Query: 721  RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRV 780
            RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRV
Sbjct: 721  RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRV 780

Query: 781  VTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIAT 840
            VTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIAT
Sbjct: 781  VTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIAT 840

Query: 841  DTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDD 900
            DTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDD
Sbjct: 841  DTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDD 900

Query: 901  TLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRIS 960
            TLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRIS
Sbjct: 901  TLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRIS 960

Query: 961  ITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEA 1020
            ITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTN            DNKILELEA
Sbjct: 961  ITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEA 1020

Query: 1021 SIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHD 1080
            SIDKLQ                    SSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHD
Sbjct: 1021 SIDKLQKEGEEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHD 1080

Query: 1081 LLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGC 1140
            LLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGC
Sbjct: 1081 LLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGC 1140

Query: 1141 MGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAY 1200
            MGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLK          IGQLNDFVENAY
Sbjct: 1141 MGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAY 1200

Query: 1201 ADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLK 1260
            ADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLK
Sbjct: 1201 ADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLK 1260

Query: 1261 EMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFAL 1320
            EMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFAL
Sbjct: 1261 EMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFAL 1320

Query: 1321 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK 1380
            HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK
Sbjct: 1321 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK 1380

Query: 1381 NRNMTKSVALENKDLINRS 1399
            NRNMTKSVALENKDLINRS
Sbjct: 1381 NRNMTKSVALENKDLINRS 1399

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1813 bits (4695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/1402 (66%), Positives = 1100/1402 (78%), Gaps = 9/1402 (0%)

Query: 1    MESPLSKKQKTFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS 60
            M+SPL+KKQKT V+ + + S TEES DVTRASRSRTPRKLVLGSPDKRFAFSQPV+SSSS
Sbjct: 1    MDSPLAKKQKTHVSNESENSSTEESPDVTRASRSRTPRKLVLGSPDKRFAFSQPVSSSSS 60

Query: 61   NVPYLQPLKSELSSSRGRVYSQXXXXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGL 120
            NVP+LQPLK+ELSSSRGRVYSQ            KLELIQLSP KK+RLESQK ++ R +
Sbjct: 61   NVPHLQPLKNELSSSRGRVYSQSPPRSPNRSPTRKLELIQLSPMKKSRLESQKFQESRAM 120

Query: 121  AQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180
               I+RLCI+RL LHNFKSYAGTQVVGPFH+SFSAVVGPNGSGKSNVIDSLLFVFGFRAN
Sbjct: 121  MGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180

Query: 181  KMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT 240
            KMRQGKLS+LIHKSE HP+LDSCHV++FFQYVQDE DG T++ Q +P +V+ RKAF+NNT
Sbjct: 181  KMRQGKLSELIHKSELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNT 240

Query: 241  SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL 300
            SKYY+NGKESSYT +T+LLR EGIDLDHKRFLILQGEVESIAQMKPKAEKE DDGLLEYL
Sbjct: 241  SKYYLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYL 300

Query: 301  EDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXX 360
            EDIIGTA+YKPLIE TL +I +LND+C+EKENR+EIVEREKSSLE G             
Sbjct: 301  EDIIGTAQYKPLIENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKT 360

Query: 361  XXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNV 420
                RSKLLQ+ LWKN  K  +T+EKI   +EKLSAE+AK T+H  E+  ++++ +SL +
Sbjct: 361  LTILRSKLLQYHLWKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKL 420

Query: 421  TIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEE 480
             +  + +SE  LT EKR CDRDRVSLEEKLKN++QK+VK+ ++  +  +SI+ TQAK+EE
Sbjct: 421  ILGDLGESEKKLTLEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEE 480

Query: 481  LFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQE 540
            L  DQ Q+EK+L ELN ++  EK KLDEIK SLK K   IS QI EIE+ELEPWNVKLQE
Sbjct: 481  LANDQEQHEKDLLELNGTMKEEKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQE 540

Query: 541  KRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQ 600
            K++Q+KLEET ISV KES AKI ++I      I   R K+ EQ  ++  LEKE  DI RQ
Sbjct: 541  KKAQVKLEETTISVFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQ 600

Query: 601  IIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISG 660
            + +GQ+ECDNA  K+KEMK +LT HRQRS+DA+SSLSTFENKNKVL+AL RLQRSGRISG
Sbjct: 601  LTVGQSECDNAVKKIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISG 660

Query: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL 720
            FHGRLGDLGTIDDKYDVAISTACPRLDD+VVETVECGQQCIE+LRKNKLGYARFILLDKL
Sbjct: 661  FHGRLGDLGTIDDKYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKL 720

Query: 721  RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRV 780
            R+FN++ I+TP NV RL+DLV P + KFRNAFYSVLRDTLVAKDLKEAN+VAYGKQR+RV
Sbjct: 721  RNFNLSPIKTPENVPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRV 780

Query: 781  VTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIAT 840
            VTLDGKLIDLSGTMSGGGN +A GMMKSE+  + ++FTAEEV+QID+EL+ERE NF+IA 
Sbjct: 781  VTLDGKLIDLSGTMSGGGNFKARGMMKSEQ-QSNSAFTAEEVQQIDKELSEREHNFQIAA 839

Query: 841  DTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDD 900
            DTLHEME+ALQ LKDREPEIE DISKR+++IDSL SE+K  E R   L +E+   ESS++
Sbjct: 840  DTLHEMEEALQKLKDREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNE 899

Query: 901  TLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRIS 960
             L  A  +L SLK+E + LE EM+SKK ++K LQEQIMK+GGTKLQ+Q S+VDS+ QRI+
Sbjct: 900  ELSTAEVKLKSLKSEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRIT 959

Query: 961  ITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEA 1020
            I L K K+ KT +KKA+ND+KRY+KQA QL+ ++  C+               K+ EL  
Sbjct: 960  IVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSE 1019

Query: 1021 SIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHD 1080
            SI+KL+                    + EG+DF   E+    QL+KL +L   + K+  +
Sbjct: 1020 SINKLKDELELTEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAE 1079

Query: 1081 LLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGC 1140
             L  L SLKIRDVTATLQ L++ L +ES++         E      S  D M+VD  +G 
Sbjct: 1080 FLHSLNSLKIRDVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQG- 1138

Query: 1141 MGNEPTASQPEDQMDVDEPEEMETS---PSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVE 1197
                 + S  E Q+   E E   T    P+ LPKL E +L+          I QL D+VE
Sbjct: 1139 ----ESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVE 1194

Query: 1198 NAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISM 1257
            NAYADIE+LEEY +RL++++ARK++LN AV++RD VRQ+ +NL+KKRLDEFM GFN I M
Sbjct: 1195 NAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICM 1254

Query: 1258 TLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALV 1317
             LKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNI+NLSGGEKTLSSLALV
Sbjct: 1255 ILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALV 1314

Query: 1318 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1377
            FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG
Sbjct: 1315 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVG 1374

Query: 1378 IYKNRNMTKSVALENKDLINRS 1399
            +YKN+NMTKSVAL+N DLI+RS
Sbjct: 1375 VYKNKNMTKSVALQNTDLIDRS 1396

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1514 bits (3921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 813/1427 (56%), Positives = 1026/1427 (71%), Gaps = 40/1427 (2%)

Query: 2    ESPLSKKQKTFVNRDEDFSQTEESVDV------------------TRASR--SRTPRKLV 41
            +SPL+KKQKT   R +D  Q + +  V                  TR  R  S TPRKLV
Sbjct: 3    DSPLAKKQKT---RTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSPTPRKLV 59

Query: 42   LGSPDKRFAFSQPVTSSSSNVPYLQPLKSELSSSRGR-VYSQXX----XXXXXXXXXXKL 96
            LGSP+K++A+SQP TSSS +VP LQP    +  SRGR  YSQ                +L
Sbjct: 60   LGSPEKKYAYSQPSTSSSLSVPNLQP--PNVDGSRGRRFYSQSPPRSPHRSPNRSPTRRL 117

Query: 97   ELIQLSPTKKTRLESQKT--EQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFS 154
            ELIQLSP K  R E QK   E+ +   Q + RLCI++LSLHNFKSYAGTQ++GPFH+SFS
Sbjct: 118  ELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAGTQIIGPFHTSFS 177

Query: 155  AVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQD 214
            AVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLSDLIHKSEA+PNL+SC V++ F+YV D
Sbjct: 178  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLESCSVDIHFRYVVD 237

Query: 215  ELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLIL 274
            E DG T    ++P +V+TRKAF+NN+SKYY++GKES+YT+VT+LLR +GIDLDHKRFLIL
Sbjct: 238  ESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQGIDLDHKRFLIL 297

Query: 275  QGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRY 334
            QGEVESI+QMKPKAE+E DDGLLEYLEDIIGTAKYK  IE  LV+ID LNDVC EKENR+
Sbjct: 298  QGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDTLNDVCVEKENRF 357

Query: 335  EIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKL 394
            E+VE+EK+SLESG                 +SKL Q+ +W++  K + T  KI  L E L
Sbjct: 358  ELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSETLGKISELNEHL 417

Query: 395  SAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNIS 454
              E+AKY + +RE+ QL          +  +      LTS++R  DR++ S+EEK +N+ 
Sbjct: 418  GQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDREKTSMEEKQRNLD 477

Query: 455  QKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLK 514
            +K++KAEK   +T NS+  ++ KLEEL   Q QY+++L +LN+SLL E++KLDEIK+SL+
Sbjct: 478  KKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEERSKLDEIKLSLR 537

Query: 515  GKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDIS 574
             KT  IS +I   E++LEPWN +LQEK+SQ+KL E++I++LKES  K  + I + + +I 
Sbjct: 538  DKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKKVQNIIQLKTEIE 597

Query: 575  NNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKS 634
               +K   Q  AI  L+ E  +I ++I IG+ EC +AS+K+ EMK VL +HRQR+++A+S
Sbjct: 598  AFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNVLISHRQRAMEARS 657

Query: 635  SLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETV 694
            +LS  ENKNKVLSAL RLQRSGRI+GFHGRLGDLGTIDD YDVAISTACPRLDD+VV+ V
Sbjct: 658  TLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAISTACPRLDDIVVDNV 717

Query: 695  ECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYS 754
            ECGQQCIEHLRKNKLGYARFI+LDKLR FN++ IQTP  V RLFDLV   + KF  AFYS
Sbjct: 718  ECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLVRSKNGKFLPAFYS 777

Query: 755  VLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTG 814
            VLRDTLV  DLK+ANRVAYGK+RFRVVTLDGKLID SGT+SGGG H   G+MKS++   G
Sbjct: 778  VLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHVMKGLMKSKQ-QPG 836

Query: 815  ASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSL 874
            A +T EEV+ I++EL ERE+NF IA +T H+ME+AL+  KDREPEIE +I+KRR++I+S 
Sbjct: 837  AGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPEIEVEIAKRRLDIESS 896

Query: 875  LSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQ 934
             +E+KL +++   L+ ++      D  L +A S+L  L  E   +E E K+K+  I  L+
Sbjct: 897  STELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEIENETKNKQQLINSLK 956

Query: 935  EQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDI 994
            E+IMKIGGTKLQLQ S V+SI ++I+I   KQK+D+TA KKAENDLKR E Q  + S DI
Sbjct: 957  EKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAENDLKRLENQCREASNDI 1016

Query: 995  DQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQDFA 1054
            + C              + KI +L+ S+++ +                    ++   DF 
Sbjct: 1017 ESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFK 1076

Query: 1055 VFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDEL 1114
              E++INN+LEKLN L +HI K+      +L SLKIRD+T TLQ LN+  L E    D+ 
Sbjct: 1077 SVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENE-DDF 1135

Query: 1115 HGQSSEARSQE---PSNGDLMEVDTVEGCMGNEPTASQPE-DQMDVDEPEEMETSPSDLP 1170
              Q  E + ++    S+ + M++D  +     +   +  E D MD+DE E  ETS + LP
Sbjct: 1136 EVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYEN-ETS-NGLP 1193

Query: 1171 KLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQR 1230
            K +EAQL+          I +LN +V+NA+ DI+VLEEY +RL +++ RKL+LN+AV +R
Sbjct: 1194 KFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKR 1253

Query: 1231 DSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFS 1290
            D VR+NC+ L+KKRLD+FM GF+ ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFS
Sbjct: 1254 DEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFS 1313

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
            VMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYI
Sbjct: 1314 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYI 1373

Query: 1351 KERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            KERTKNAQFIVISLRNNMFELAQQLVGIYKN NMT+S  L+N D++N
Sbjct: 1374 KERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1414 bits (3660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 752/1410 (53%), Positives = 989/1410 (70%), Gaps = 25/1410 (1%)

Query: 2    ESPLSKKQKTFVNRDEDFSQTEESVDVTRASRS-----RTPRKLVLGSPDKRFAFSQPVT 56
            ++PL+K+Q+   N   +F     S      S S      TP+KLV+G+ D   + SQP+ 
Sbjct: 3    DTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDDTTSQSQPIV 62

Query: 57   SSSS-NVPYLQPLKSELSSSRGR---VYSQXXXXXXXXXXXXKLELIQLSPTKKTRLESQ 112
            SSSS   P LQ   S   SSRGR    YSQ            KLELI++SP KK RLE Q
Sbjct: 63   SSSSLQAPSLQHPNS---SSRGREQRTYSQSPPRSPGRSPTRKLELIKISPVKKNRLELQ 119

Query: 113  KTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLL 172
            +        +   RLCIN+L L +FKSYAG QVVGPFHSSFSAVVGPNGSGKSNVIDS+L
Sbjct: 120  RLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSML 179

Query: 173  FVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVT 232
            FVFGFRANKMRQ +LSDLIH SE HPNL SC VEV FQYV DE DG T + +++P LVVT
Sbjct: 180  FVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEEKPTLVVT 239

Query: 233  RKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEG 292
            RKAFKNN+SKYYVN KES+YT+VT+LL+KEGIDLDHKRFLILQGEVE+IAQM+PKAEKEG
Sbjct: 240  RKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMRPKAEKEG 299

Query: 293  DDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXX 352
            +DGLLEYLEDI GTAKYKP IE  L +I+ LN+ C EKENR+ IV++EKSSLE+G     
Sbjct: 300  EDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLETGKDEAL 359

Query: 353  XXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLE 412
                        RSK++Q+K+W+N  K T+T +K   L+ +L  E  KY+E  +E+  L+
Sbjct: 360  EFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETLKEVDSLK 419

Query: 413  SESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSIN 472
             ESK +   I  +   E +L ++KR  D+ RV++EEK+K+++QK  KAEK   +  +S+N
Sbjct: 420  DESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLKSNQHSLN 479

Query: 473  ATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELE 532
            AT+A L EL + Q+ YEKEL +LN+ L+ E+ KL+++KISLK KT  IS  I + E++LE
Sbjct: 480  ATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIAQYEKDLE 539

Query: 533  PWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEK 592
            PW+ +LQ+KR++I+L E+++S+LK++ A+I ++I + +N+I+   ++   + + I  L++
Sbjct: 540  PWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEKVIRELKQ 599

Query: 593  EHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRL 652
            E +D+  ++     EC +AS ++K+M  +L   RQR+LDA+++ S+ +NK+ VL+AL +L
Sbjct: 600  EESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTVLTALTKL 659

Query: 653  QRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYA 712
            Q+SGRISGFHGRLGDLG ID+KYDVAISTACPRL+D+VVE+VECGQQCIE+LRKNKLGYA
Sbjct: 660  QKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLRKNKLGYA 719

Query: 713  RFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVA 772
            RFILLDKLR F+   IQTP NV RLFDLV P D+KF  AFYSVLRDTL A+ L +ANRVA
Sbjct: 720  RFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSLAQANRVA 779

Query: 773  YGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGAS--FTAEEVRQIDEELT 830
            YGK+RFRVV+LDGKLID+SGTMSGGG+H   G+M+  + N+ +   F+ EEV Q++ ELT
Sbjct: 780  YGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVAQLENELT 839

Query: 831  ERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKK 890
            E+E++F+IA+DT  EMED L+ LKDR PEI+  +SK  ME +S +SE+KL E       +
Sbjct: 840  EKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEKLLLERLE 899

Query: 891  EQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGS 950
             QK     ++    A +R+ +LK E + L  +  + + KI  L+++IM+IGG++LQ+Q S
Sbjct: 900  AQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIAVLKDKIMEIGGSELQIQNS 959

Query: 951  LVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXX 1010
             V S  QR+ I   KQK+ K ++KKAEN+LK+  K  G    D+D  +            
Sbjct: 960  KVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKDLDLYSQEIASLKENADN 1019

Query: 1011 XDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDL 1070
                +  +E S+D+ Q                     +   +F   +++IN++LEKLN L
Sbjct: 1020 VQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEFKSLKIEINDKLEKLNAL 1079

Query: 1071 LNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGD 1130
            L HI K+   L   L +LKIRDVT TLQ L++    ES +  ++  +  E R+ E ++  
Sbjct: 1080 LGHITKEVRQLESDLNNLKIRDVTRTLQLLDE---GESTNNSKMPNELQEKRT-EGADAT 1135

Query: 1131 LMEVDTVEGCMGNEPTASQPEDQMDVDE-PEEMETSPSDLPKLTEAQLKXXXXXXXXXXI 1189
              E +  +  M  E +    ++ M+VDE P E+E     LP+++EA+LK          I
Sbjct: 1136 RQEGEESDVSMEEEKSN---DEVMEVDEKPHELENG---LPRVSEAELKSLDVEDLGAQI 1189

Query: 1190 GQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFM 1249
              L ++V++   D+E+LEEY KRL + + RK++LN+AV +RD++R+    L+K+R DEFM
Sbjct: 1190 EDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKKRRFDEFM 1249

Query: 1250 NGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEK 1309
             GF  ISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEK
Sbjct: 1250 QGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEK 1309

Query: 1310 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1369
            TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF
Sbjct: 1310 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1369

Query: 1370 ELAQQLVGIYKNRNMTKSVALENKDLINRS 1399
            ELAQQLVGIYK +NMTKS +L+N D++NR+
Sbjct: 1370 ELAQQLVGIYKTQNMTKSASLKNNDILNRT 1399

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1385 bits (3585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/1418 (53%), Positives = 964/1418 (67%), Gaps = 29/1418 (2%)

Query: 3    SPLSKKQKTFVNRD--------EDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQP 54
            +PLSKKQK   + +        +D  +T   V  +   +S TPRKL+LGS D ++  SQP
Sbjct: 4    TPLSKKQKVVSDEERITPNQNEQDNDKTHPEVTASSFLKSHTPRKLLLGSADNKYVLSQP 63

Query: 55   VTSSSS------NVPYLQPLKSELSSSRGR---VYSQXXXXXXXXXXXXKLELIQLSPTK 105
            + SSSS       VP LQP  S+   SRGR    YSQ            KLELIQLSP K
Sbjct: 64   IISSSSHGSSSLQVPNLQPPLSQ--PSRGRDKKAYSQSPPRSPGRSPVRKLELIQLSPIK 121

Query: 106  KTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKS 165
              R+E QK    +   Q   RL I++L L +FKSYAGTQ+VGPF++SFSA+VGPNGSGKS
Sbjct: 122  NNRIELQKLYNSKN--QNKVRLYIDKLVLQDFKSYAGTQIVGPFNTSFSAIVGPNGSGKS 179

Query: 166  NVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD 225
            NVIDS+LFVFGFRANKMRQ +L DLIHKSEA PN+ SC VEV FQYV DE DG + + +D
Sbjct: 180  NVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQYVIDENDGTSKIIED 239

Query: 226  RPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
            R  LVV RKAFKNN+SKYY+NGKES+YT+VT LL++EGIDLDHKRFLILQGEVE+IAQMK
Sbjct: 240  RKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVENIAQMK 299

Query: 286  PKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLE 345
             KAEKEGDDGLLEYLEDIIGT+KYK LIE  +V+I+ LN++C EKE R+EIVE EK+SLE
Sbjct: 300  AKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEKEKRFEIVETEKNSLE 359

Query: 346  SGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHK 405
            S                  RSKL Q+KL++ + K   T +KI   +  L  ER+KY + +
Sbjct: 360  SDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNFKNALQEERSKYEKIQ 419

Query: 406  REIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHH 465
             EI Q   E +  N  I      E  L  +KR  D   VS+EE++KN++QKK KAEKT H
Sbjct: 420  SEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERIKNLTQKKTKAEKTLH 479

Query: 466  ATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIG 525
                 I   ++ L++L   Q+ Y+ E   L K L  E++KLD+IK+SLK KT  IS QI 
Sbjct: 480  DKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIKLSLKDKTKDISSQIS 539

Query: 526  EIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQ 585
              E+++EPW  K+QEK+ QI+L E++IS+LKES AK+ E +   + +I + RK++  ++ 
Sbjct: 540  LYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLKVEIDDVRKEIDNKNS 599

Query: 586  AIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKV 645
             IE L+KE   +++++ +G++EC  A  K KEM+ +L +HRQR++DA+S+L   ENK+ V
Sbjct: 600  IIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAIDARSALHMAENKSTV 659

Query: 646  LSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLR 705
            LSAL RLQ+SGRI+GFHGRLGDLG I DKYD+AISTAC RLDD+VV++VECGQQCIE+LR
Sbjct: 660  LSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIVVDSVECGQQCIEYLR 719

Query: 706  KNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDL 765
            KNKLGYARFILLDKLR+F +  +QTP NV RLFDLV PID KF NAFYSVLRDTLVA D+
Sbjct: 720  KNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSNAFYSVLRDTLVATDI 779

Query: 766  KEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTG--ASFTAEEVR 823
            ++ANRVAYGK+R+RVVTLDGKLID+SGTM+GGG+H + G+MK +  N      + A +V 
Sbjct: 780  RQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKNSNMEHLEVYEAGDVE 839

Query: 824  QIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCED 883
            +I+ +L ERE NFKIA DTL EM + L+ L+D+EPEIE +I+K  M++DSL  ++ L E 
Sbjct: 840  KIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLLMDVDSLNDQLNLKEQ 899

Query: 884  RAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGT 943
            +   L+K      +  D L  A + L +L+ E + LE + +SKK KI  L+E+IMKIGG 
Sbjct: 900  QLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKEKINTLKEEIMKIGGK 959

Query: 944  KLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXX 1003
            +LQ+Q S V S+ +RI I   K K+DK  +K+ E +L++ ++   Q  +D   C N    
Sbjct: 960  ELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFKQAELDNTACVNDLET 1019

Query: 1004 XXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQ 1063
                      ++ E EA  D +                          ++  FE++I N+
Sbjct: 1020 LQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEESMNEYKSFEIEIKNK 1079

Query: 1064 LEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSES----RSGDELHGQSS 1119
            LEKLN LL++  KD   L ++L+S  +RDVT +L+ +     + S    +S + L   SS
Sbjct: 1080 LEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNSVGVKQSSNNLDVSSS 1139

Query: 1120 EARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKX 1179
               + +  + ++   D             Q  D MD+D   E E S   +PKLT+  LK 
Sbjct: 1140 HTPNVDKHDDEISMEDADNDSQNEIEEKEQDADIMDLDNVTE-EVSKG-IPKLTDDDLKS 1197

Query: 1180 XXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDN 1239
                     I QL D+VEN+ ADIE+LEEY +RL +F+ RKL+LN  V +RD VR   + 
Sbjct: 1198 IDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDLNTTVARRDEVRDELEK 1257

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWR 1299
            L+K R DEFM GF+ IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWR
Sbjct: 1258 LKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1317

Query: 1300 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1359
            NI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF
Sbjct: 1318 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1377

Query: 1360 IVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            IVISLRNNMFELAQQLVGIYK  NMT+S  L+NKD++N
Sbjct: 1378 IVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILN 1415

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1364 bits (3531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/1440 (52%), Positives = 981/1440 (68%), Gaps = 68/1440 (4%)

Query: 2    ESPLSKKQKTFVNRDEDFS-----------------QTEESVDV------TRASRSRTPR 38
            +SPLSK+QK     + + S                 +TE++ D       +  ++S TPR
Sbjct: 3    DSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHTPR 62

Query: 39   KLVLGSPDKRFAFSQPVTSSSS--NVPYLQPLKSELSSSRGR---VYSQXXXXXXXXXXX 93
            KLVL S + R+AFSQP  S++S  +VP LQP ++    SRGR    YSQ           
Sbjct: 63   KLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEA---PSRGRDYKAYSQSPPRSPGRSPT 119

Query: 94   XKLELIQLSPTKKTRLESQK---TEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFH 150
             +LEL+QLSP K +R+E QK   + Q  G  Q   RL I++L L NFKSYAG QVVGPFH
Sbjct: 120  RRLELLQLSPVKNSRIELQKLYDSHQPSGEQQG--RLFIDKLVLENFKSYAGKQVVGPFH 177

Query: 151  SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQ 210
            +SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE  PNL SC V V F+
Sbjct: 178  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFE 237

Query: 211  YVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKR 270
            YV DE  G + + +++PGLV+TRKAF+NN+SKYY+NGKES+YTQVT+LL+ EGIDLDHKR
Sbjct: 238  YVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKR 297

Query: 271  FLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEK 330
            FLILQGEVE+IAQMK KAEKE DDGLLEYLEDIIGTA YKPLIE  L QI+ LN++C EK
Sbjct: 298  FLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEK 357

Query: 331  ENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTL 390
            ENR+EIV REK+SLESG                 +SKL Q KL +++ K  +T EK  +L
Sbjct: 358  ENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSL 417

Query: 391  EEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKL 450
             +   +E+ K+ E  +E+ ++ES+ K +   +      E +L  EKR  +  RVSLEE+ 
Sbjct: 418  NKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERT 477

Query: 451  KNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIK 510
            KN+  K  KAEK   +T +SI+  +  LEEL  +Q ++E E+ +LN+SL  E+  LD+IK
Sbjct: 478  KNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIK 537

Query: 511  ISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSE 570
            +SLK KT  IS +I + E++LEPW+++LQEK+SQI+L E+++S+L+E+  K+ +     E
Sbjct: 538  LSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALE 597

Query: 571  NDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSL 630
             +I+  + +  E    I  L+K    +      G+ +   A  K+KEM+ +L  HRQR++
Sbjct: 598  ENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAM 657

Query: 631  DAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVV 690
            +A+SSLS  ENK+KVL+AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPRLDDVV
Sbjct: 658  EARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVV 717

Query: 691  VETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRN 750
            V+TVEC Q CI++LRKNKLGYARFILLD+LR FN+  + TP NV RLFDLV P D KF N
Sbjct: 718  VDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSN 777

Query: 751  AFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMK--- 807
            AFYSVLRDTLVA+DLK+AN VAYGK+RFRVVT+DGKLID+SGTMSGGGNH   G+M+   
Sbjct: 778  AFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGK 837

Query: 808  --SERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDIS 865
              S+R++    +T EEV +I+ EL+ERE+NF++A DT+HEME  L+ ++D+EP++E+ I 
Sbjct: 838  NQSDRMD---DYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQIL 894

Query: 866  KRRMEIDSLLSEIKLCEDRAASLKKEQKL--NESSDDT--LIEANSRLDSLKAECKLLEG 921
            +  ME DSL SE+ L E++     KE K+  ++S +DT  L +    L+ L+ E   L+ 
Sbjct: 895  RAEMEADSLASELALAEEQV----KEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQA 950

Query: 922  EMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLK 981
            E K+KK +IK LQ+QIMKIGGT LQ+Q S V+S+ QRI I + K K+ K+ +KK+  D+ 
Sbjct: 951  ETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVT 1010

Query: 982  RYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXX 1041
            +++KQ   +  DI+  +N               +++ +  +  +                
Sbjct: 1011 KFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKE 1070

Query: 1042 XXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLN 1101
                   +  +F   E+++ N+LEKLN LL +I  D     K+L  L IRDVT T     
Sbjct: 1071 KVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHT----- 1125

Query: 1102 KLLLSESRSGDEL--HGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEP 1159
             LL+ ++   D L   G+  +  +QE  +G+       +G    E   +     M++DE 
Sbjct: 1126 -LLILDNNQMDILDKEGEDRQETNQEDISGE------AKGETQGEEGDNDDRHCMNIDET 1178

Query: 1160 EEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQAR 1219
             + E S   +P+L+E +LK          IG+L  +++    DI VLEEY +RL +F+ R
Sbjct: 1179 SD-EVSRG-IPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRR 1236

Query: 1220 KLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDS 1279
            KL+LN+AV++RD V++  + L+KKR DEFM GFN ISMTLKEMYQMITMGGNAELELVDS
Sbjct: 1237 KLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDS 1296

Query: 1280 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1339
            LDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD
Sbjct: 1297 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1356

Query: 1340 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK  N TKS  ++N D++NR+
Sbjct: 1357 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1361 bits (3523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/1442 (52%), Positives = 981/1442 (68%), Gaps = 73/1442 (5%)

Query: 2    ESPLSKKQKTFVNRDEDFS-----------------QTEESVDVTRAS------RSRTPR 38
            +SPLSKKQK     + + S                 +TE++ D    S      RS TPR
Sbjct: 3    DSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHTPR 62

Query: 39   KLVLGSPDKRFAFSQPVTSSSS--NVPYLQPLKSELSSSRGR---VYSQXXXXXXXXXXX 93
            KLVL S + R+AFSQP  S+++  +VP LQP K    SSRGR    YSQ           
Sbjct: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKV---SSRGRDYKAYSQSPPRSPGRSPA 119

Query: 94   XKLELIQLSPTKKTRLESQK---TEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFH 150
             +LEL+QLSP K +R+E QK   + +  G  Q   RL IN+L L NFKSYAG QVVGPFH
Sbjct: 120  RRLELLQLSPVKNSRIELQKLYDSHKSSGKQQG--RLFINKLVLDNFKSYAGRQVVGPFH 177

Query: 151  SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQ 210
            +SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSEA P+L +C V V F+
Sbjct: 178  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFE 237

Query: 211  YVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKR 270
            Y+ DE  G + + +++PGLV+TR+AFKNN+SKYY+N KESSYT+VT+LL+KEGIDLDHKR
Sbjct: 238  YIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKR 297

Query: 271  FLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEK 330
            FLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGTA YKPLIE+ L QI+ LN++C EK
Sbjct: 298  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEK 357

Query: 331  ENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTL 390
             NR+EIV+REK+SLESG                 +SKLLQ K+ +++ K  +T EKI +L
Sbjct: 358  ANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSL 417

Query: 391  EEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKL 450
              +  +E+ K+ E  RE+ +++++ K +   I      E +L+ EKR  +  RVSLEE+ 
Sbjct: 418  NREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERT 477

Query: 451  KNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIK 510
            KN+  K  KAEK   +T +SI+ ++   +EL + Q ++EKE+ +LN+SL  E+  LD+IK
Sbjct: 478  KNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIK 537

Query: 511  ISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSE 570
            +SLK KT  IS +I   E+E EPW+++LQEK+SQI+L E+++S+L+E+ AK+ +     E
Sbjct: 538  LSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALE 597

Query: 571  NDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECD----NASNKMKEMKAVLTTHR 626
              I + +++     Q ++GL  + +   + +I G+++ +    +A  K+KEM+ +L  HR
Sbjct: 598  EKIISKKQR----KQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHR 653

Query: 627  QRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRL 686
            QR+++A+SSLS  +NKN VL+AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAISTACPRL
Sbjct: 654  QRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRL 713

Query: 687  DDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDN 746
            DDVVV+TVEC Q CI++LRKNKLGYARFILLD+LR FN+  I TP NV RLFD+V P D 
Sbjct: 714  DDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDP 773

Query: 747  KFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMM 806
            KF NAFYSVL+DTLVA+DLK+AN+VAYGK+RFRVVT+DGKLID+SGTMSGGGNH   G+M
Sbjct: 774  KFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLM 833

Query: 807  KSERLNTGAS-----FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIE 861
               RL T  S     +T EEV +I+ EL ERE+NF++A DT+HEME+ L+ ++D+EP++E
Sbjct: 834  ---RLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLE 890

Query: 862  TDISKRRMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSLKAECKLL 919
            + IS+  ME DSL SE+ L E +A  A +  ++ +NE +    +  N  L+ L+ E + L
Sbjct: 891  SQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKN--LEHLRGEYEDL 948

Query: 920  EGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAEND 979
            + E ++KK +IK LQ+QIMKIGGTKL  Q S V S+ QRI I + K K+ K+ +KK+E D
Sbjct: 949  QSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGD 1008

Query: 980  LKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXX 1039
            + +Y+KQ      D +  +N               + E + ++ ++              
Sbjct: 1009 VLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQL 1068

Query: 1040 XXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQT 1099
                        +F   E+++ N+LEKLN LL HI  +     K+L  L IRDVT TLQ 
Sbjct: 1069 KERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQM 1128

Query: 1100 L--NKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVD 1157
            L  N++ + E    DE      +  S  P +  + E D           A      M++D
Sbjct: 1129 LDNNQMDVVEDGIKDE-QDADQDKPSGIPDDEKIQEKD----------DADNNHHSMNID 1177

Query: 1158 EPEEMETSPS-DLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDF 1216
               EM +  S  +PKL E +LK          I  L  ++     DI VLEEY +RL++F
Sbjct: 1178 ---EMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEF 1234

Query: 1217 QARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELEL 1276
            + RKL+LN+AV++RD V++  + L+K R DEFMNGFN ISMTLKEMYQMITMGGNAELEL
Sbjct: 1235 KRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELEL 1294

Query: 1277 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1336
            VDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDA
Sbjct: 1295 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDA 1354

Query: 1337 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLI 1396
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TKS  ++N D++
Sbjct: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414

Query: 1397 NR 1398
             R
Sbjct: 1415 KR 1416

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1361 bits (3522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/1377 (54%), Positives = 933/1377 (67%), Gaps = 32/1377 (2%)

Query: 36   TPRKLVLGSPDKRFAFSQPVTSSSSNV--PYLQP-LKSELSSSRGR-VYSQXXXXXXXXX 91
            TP KL+ GSP ++   SQ  ++S++ +  P LQP   S+LS  RGR VYSQ         
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLS--RGRSVYSQSPPRSPNRS 72

Query: 92   XXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHS 151
               ++ELIQLSP K +RLE QK     G     +RL I  L L+NFKSYAG QVVGPFHS
Sbjct: 73   PARRIELIQLSPIKNSRLELQKI--YDGKQTTTKRLSIKNLILNNFKSYAGVQVVGPFHS 130

Query: 152  SFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQY 211
            SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLS+LIHKSE H NL  C VE+ FQY
Sbjct: 131  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEITFQY 190

Query: 212  VQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRF 271
            V D+ DG T V  D   L V RK FKNNTSKYY+NGKESSYT+VT+ LR EGIDLDHKRF
Sbjct: 191  VMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDHKRF 250

Query: 272  LILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKE 331
            LILQGEVESIAQMKPKA+ EGDDGLLEYLEDIIGTAKYK  I   LV++D LND+C EKE
Sbjct: 251  LILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICMEKE 310

Query: 332  NRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLE 391
             R+E+VE+EK SLE+G                 +SK LQ  + K + K   T +KI    
Sbjct: 311  IRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKISAFT 370

Query: 392  EKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLK 451
            EKL  ER KY E ++EI  L   S +L   I  I   +S L  +K    R+ VS EEKLK
Sbjct: 371  EKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRELVSSEEKLK 430

Query: 452  NISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKI 511
            +++QK+ KAEKT      +I   +  +  L + Q ++E  L ELN+SL  E+++LD IK+
Sbjct: 431  SLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSERSELDAIKM 490

Query: 512  SLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEN 571
            SL+ KT +IS ++  +E+ELEPW  KL+ K SQIKL E++I ++KES  K+ +EIS+   
Sbjct: 491  SLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKLEQEISQLRK 550

Query: 572  DISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLD 631
            DI + + ++    + I  LEKE   I   I   Q ECD+A  K+ +MK VLT HRQR  D
Sbjct: 551  DIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVLTNHRQRMTD 610

Query: 632  AKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVV 691
            A+ +LS  ENKNKVL AL RLQ+SGRI GFHGRLGDLGTIDDKYD+AIS ACPRLDD+VV
Sbjct: 611  ARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVACPRLDDIVV 670

Query: 692  ETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNA 751
            ETVEC QQCIEHLRKNKLGYARFILLDKL+ FNM  + TP NV RLFDL  P +  F  A
Sbjct: 671  ETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTTPKNEIFAPA 730

Query: 752  FYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERL 811
             YSVLRDTLVAKDL +ANRVAYG +RFRVVTLDGKLID+SGTMSGGG+    G+MKS++ 
Sbjct: 731  LYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVVKGLMKSKQ- 789

Query: 812  NTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEI 871
             +   +T+EEV++++ ELT+RE NFKIATDT  EME ALQ  KDR+P I+ +ISK +++I
Sbjct: 790  RSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVEISKHKIDI 849

Query: 872  DSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIK 931
            D+L SE++  +D    L+   + N+  +  L +  ++L +L +E   L+ E K K  +I 
Sbjct: 850  DTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDESKVKNEQIS 909

Query: 932  ELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLS 991
            EL+ QIMKIGG KLQ Q S VDS+ Q++ I + KQK+++T +KK E ++ R  KQ     
Sbjct: 910  ELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRASKQKLGAE 969

Query: 992  VDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQ 1051
             DI+ C                 + E E  I+ ++                    ++  +
Sbjct: 970  NDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNLDDKAAYVE 1029

Query: 1052 DFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSG 1111
             F   E+++   LEKL +L +HI  +     ++L +LK+RDV   LQ L++         
Sbjct: 1030 KFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDE--------- 1080

Query: 1112 DELHGQSSEARSQEPSNGDLMEVDTVEG-----------CMGNEPTASQPEDQMDVDEPE 1160
              L  +S   R+  PSN  + E+ TVE             +  +P +   ++ MDVD+  
Sbjct: 1081 HNLPLESLTDRAVTPSNQCIPEM-TVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA 1139

Query: 1161 EMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARK 1220
                 P  LPKLTEA+L           I QL ++++ AYADI++LEEY  RL +++ RK
Sbjct: 1140 SY-IGPG-LPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRK 1197

Query: 1221 LELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSL 1280
            L+LN++VE+R+ +R   + L+K RL+EFM+GF  ISMT+KE+YQMITMGGNAELELVDSL
Sbjct: 1198 LDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSL 1257

Query: 1281 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340
            DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1258 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1317

Query: 1341 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK+ NMTKS  L+N D++N
Sbjct: 1318 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILN 1374

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1356 bits (3510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 719/1366 (52%), Positives = 933/1366 (68%), Gaps = 15/1366 (1%)

Query: 36   TPRKLVLGSPDKRFAFSQPVTSSSS---NVPYLQPLKSELSSSRGRV-YSQXXXXXXXXX 91
            TP KL+  SPD++   S+  + S++     P LQP  +    SRGR  YSQ         
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAH-QISRGRSQYSQSPPRSPNRS 72

Query: 92   XXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHS 151
                +ELIQLSP K +RLE Q+    +   + +ERLCI  L L NFKSYAG QVVGPFHS
Sbjct: 73   PGRAVELIQLSPIKNSRLELQRLYDTK--QKKVERLCIRTLVLENFKSYAGRQVVGPFHS 130

Query: 152  SFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQY 211
            SFSAVVGPNGSGKSNVIDS+LF FGFRANKMRQGKLS LIHKSE +P+LD C VE+ FQY
Sbjct: 131  SFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQY 190

Query: 212  VQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRF 271
            V DE DG T V   +P L V RKAFKNNTSKYY+NGKES+YT+VT LLR EGIDLDHKRF
Sbjct: 191  VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRF 250

Query: 272  LILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKE 331
            LILQGEVESIAQMKPKAE EGDDGLLEYLEDIIGT KYK  IEQ LV++D LND+C EKE
Sbjct: 251  LILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKE 310

Query: 332  NRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLE 391
            NR+++VE+EK SLE G                  SK  Q+ L+ N  K   T   +    
Sbjct: 311  NRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370

Query: 392  EKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLK 451
             KL  E+AK  E ++EI +L   S+ L   +  + ++     ++ R  +R+ VS EEK K
Sbjct: 371  NKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQK 430

Query: 452  NISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKI 511
            ++ QK+ KAEKT +    SI   + K+EE      +YE  L  LN +++  + +L+++K+
Sbjct: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490

Query: 512  SLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEN 571
            +L  KTG I+ ++  +E+ELEPW  K++EK+S+IKL E++IS++KE+  K+  EI+    
Sbjct: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550

Query: 572  DISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLD 631
            +I   R  ++ + ++IE L  E + I+  I++G+ EC +A +K++EMK VL THRQR  D
Sbjct: 551  EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610

Query: 632  AKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVV 691
            A+S++S+ ENKNKVL+AL RLQ+SGRI G+HGRLGDLGTIDDKYD+AISTACPRLDD+VV
Sbjct: 611  ARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVV 670

Query: 692  ETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNA 751
            +TVECGQQCIEHLRKNKLGYARFILLDKLR FN+    TP NV RLFDLV P + KF  A
Sbjct: 671  DTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPA 730

Query: 752  FYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERL 811
            FYSVLRDTLV  DL +ANRVAYGK+R+RVVTLDGKLID+SGTM+GGG+  ASG+MKS + 
Sbjct: 731  FYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQ- 789

Query: 812  NTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEI 871
               + +T EEV++++EEL ERE+NFK+A +T  EME ALQ+  DR+PEIE ++SK++M+I
Sbjct: 790  -QSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDI 848

Query: 872  DSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIK 931
            +++ +E++   +R   L++  K +      L  A  +L +L A+        +SK  +IK
Sbjct: 849  ETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIK 908

Query: 932  ELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLS 991
            EL+ +IM+IGG +LQ   S VDS+ Q+I I   KQK+DKTA KKAE +LKR  KQ     
Sbjct: 909  ELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARKQQITAK 968

Query: 992  VDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQ 1051
             DI+ C                 + EL+  +  LQ                    + +  
Sbjct: 969  DDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKID 1028

Query: 1052 DFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSG 1111
             ++  E+++  QL+KL +L N++ K+ ++   +L  LK+RD+   +     L L E++S 
Sbjct: 1029 SYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVM-----LDLEENKSL 1083

Query: 1112 DELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPK 1171
                   +    +E     ++E         NE   S  E+ + ++  E+     + LPK
Sbjct: 1084 QSFSHSPTPDTKRENIQSSMLETHLASPS-PNERKISIAENNLSMEVDEQASVLENGLPK 1142

Query: 1172 LTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRD 1231
            L +++L           I QL D+++N+  DIE+L+EY KRL +++ R+++LN+A+ +RD
Sbjct: 1143 LPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRD 1202

Query: 1232 SVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1291
              R +C+ L+K+RLDEFM GF  IS+TLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV
Sbjct: 1203 ETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1262

Query: 1292 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1351
            MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1263 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1322

Query: 1352 ERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            ERTKNAQFIVISLRNNMFELAQ+LVGIYKN NMT+S  L+N+D+IN
Sbjct: 1323 ERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1348 bits (3489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/1387 (53%), Positives = 953/1387 (68%), Gaps = 37/1387 (2%)

Query: 29   TRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS--NVPYLQPLKSELSSSRGR---VYSQX 83
            T  ++S TPRKLVL S + R+AFSQP  S+++  +VP LQP  +   SSRGR    YSQ 
Sbjct: 53   TSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGT---SSRGRDYKAYSQS 109

Query: 84   XXXXXXXXXXXKLELIQLSPTKKTRLESQK---TEQVRGLAQPIERLCINRLSLHNFKSY 140
                       +LEL+QLSP K +R+E QK   + Q     Q   RL IN L L NFKSY
Sbjct: 110  PPRSPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQG--RLFINELVLENFKSY 167

Query: 141  AGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200
            AG QVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSEA PNL
Sbjct: 168  AGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNL 227

Query: 201  DSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLR 260
             SC V V F+YV DE  G + + +++PGLV+TRKAFKNN+SKYY+NGKESSYT+VT+LL+
Sbjct: 228  QSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLK 287

Query: 261  KEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQI 320
             EGIDLDHKRFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGTA YKPLIE+ + QI
Sbjct: 288  NEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQI 347

Query: 321  DQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKS 380
            + LN+VC EKENR+EIV+REK+SLESG                 +SKL Q K+ +++ K 
Sbjct: 348  EALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKL 407

Query: 381  TNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCD 440
             +T EKI +L +    E+ K+ E  +++++++++ K +   I      E  L  E+R  +
Sbjct: 408  ASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELE 467

Query: 441  RDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLL 500
              RVSLEE+ KN++ K  K+E+T   T  SI+  +  L+EL   Q ++E E+ +LN+ L 
Sbjct: 468  GTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLE 527

Query: 501  VEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLA 560
             E++ LDEIK+SLK KT  IS +I + E+ELEPW+++LQEK SQI+L E+++S+L+E+ +
Sbjct: 528  EERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQS 587

Query: 561  KIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKA 620
            K+ + +   E  I   +    E    I  L+K+ + ++ +   G+    +A  K++EM+ 
Sbjct: 588  KLKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQK 647

Query: 621  VLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAIS 680
            VL THRQR+++A+SSLS  +NK+KVL+AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAIS
Sbjct: 648  VLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAIS 707

Query: 681  TACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDL 740
            TACPRLDDVVV+TVEC QQCI++LRKNKLGYARFILLD+LR FN+  I TP NV RLFDL
Sbjct: 708  TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDL 767

Query: 741  VHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNH 800
            V P D KF NAFYSVLRDTLVA+ LK+AN VAYG++RFRVVT+DGKLID+SGT+SGGGNH
Sbjct: 768  VKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNH 827

Query: 801  RASGMMKSERLNTGAS-----FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKD 855
             + G+M   RL T  S     +T EEV +I+ EL+ERE NF++A DT+HEME  L++L+D
Sbjct: 828  VSKGLM---RLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRD 884

Query: 856  REPEIETDISKRRMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSLK 913
            +EP IE+ ISK  ME DS+ SE+ L E +   A +     L++ +   +I  N  L+ LK
Sbjct: 885  QEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKN--LERLK 942

Query: 914  AECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAV 973
             E   L+ E K+KK KIK LQ +IMKIGGTKLQ+Q S V S+ QR+ I + K K+ K+ +
Sbjct: 943  GEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGI 1002

Query: 974  KKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXX 1033
            KK+E D+ +++KQ      D++  +N               + E +  + +         
Sbjct: 1003 KKSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELK 1062

Query: 1034 XXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDV 1093
                              +F   E+++ N+LEKLN LL HI K+ +   K L  L IRDV
Sbjct: 1063 EESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDV 1122

Query: 1094 TATLQTLNKLLLSESRSGDEL-HGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPED 1152
            T TL+ L+   +   ++ +++      E RS E  +         E  +  E        
Sbjct: 1123 THTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQD---------EKNIQEEERTCDDHH 1173

Query: 1153 QMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKR 1212
             MD+DE          +P+ +E +LK          I +L+ +++    DI VLEEY +R
Sbjct: 1174 SMDIDETS--NEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARR 1231

Query: 1213 LVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNA 1272
            L +F+ RKL+LN+AV++RD V+   + L+KKR DEFM GFN ISMTLKEMYQMITMGGNA
Sbjct: 1232 LAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNA 1291

Query: 1273 ELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1332
            ELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMD
Sbjct: 1292 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1351

Query: 1333 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALEN 1392
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T+S  ++N
Sbjct: 1352 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKN 1411

Query: 1393 KDLINRS 1399
             D++NR+
Sbjct: 1412 IDILNRT 1418

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1344 bits (3479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 743/1396 (53%), Positives = 968/1396 (69%), Gaps = 55/1396 (3%)

Query: 23   EESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSSNVPY-LQPLKSELSSSRGR--- 78
            ++S+     S+S TPRKL+LG  D R+AFSQP  SSSS     LQP  S  SSSRGR   
Sbjct: 42   QQSISPINNSKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVPTLQPPDS--SSSRGRKDI 99

Query: 79   -VYSQXXXXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNF 137
              YSQ            +LELIQLSP K  R++ ++           ERL IN+L+L+NF
Sbjct: 100  KSYSQSPPRSPGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNF 159

Query: 138  KSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAH 197
            KSYAG QVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE  
Sbjct: 160  KSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKF 219

Query: 198  PNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTE 257
            P+L SC V+V F Y  DE DG T + + +P LV++RKAFKNN+SKYY+NGKES+YT VT+
Sbjct: 220  PDLTSCSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTK 279

Query: 258  LLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTL 317
            LL++EGIDLDHKRFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGT+KYK LIE+ L
Sbjct: 280  LLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDL 339

Query: 318  VQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNS 377
            ++I+ LN++C EKENR+EIV+REK+SLESG                 +SKLLQ+ LW+N+
Sbjct: 340  IEIESLNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNN 399

Query: 378  FKSTNTQEKIKTLEEKLSAERAKYTEHKREI---KQLESESKSLNVTIRGIKDSESSLTS 434
             K TNT +KI  L E+ + E++K    + EI   KQL +ES+S    I+ ++  E     
Sbjct: 400  SKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQS---KIKVLEGEEKQQLK 456

Query: 435  EKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDE 494
             KR  + + VSL+EKLKN++QKK K EK    T  +I++  ++++EL K Q +Y  EL+ 
Sbjct: 457  SKRILEGEHVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELET 516

Query: 495  LNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISV 554
            LN+ L  E+  L+ +K+ LK KT  IS +I   E +LEPWN+K+QEK+++I+L E++IS+
Sbjct: 517  LNQQLQSERESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISL 576

Query: 555  LKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNK 614
            L+E   K+  +I     ++SN      ++ + +  L+K+ + I ++I  G+TEC++  +K
Sbjct: 577  LQEGQVKLKNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSK 636

Query: 615  MKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDK 674
            +KEMK VL   RQR+ +A+ +L+  +N+ KVL+AL +LQ+SGRI GFHGRLGDLGTID+ 
Sbjct: 637  LKEMKNVLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNT 696

Query: 675  YDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNV 734
            YDVA+STACPRLDD+VVETVECGQQCIE+LRKNKLGYARFILLDKLRSFN NTIQTP NV
Sbjct: 697  YDVAVSTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNV 756

Query: 735  SRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTM 794
             RLFDL+ P D+KF  AFYSVLRDTLVAKDLK+ANRVAYG++R+RVVTLDGKLID+SGTM
Sbjct: 757  PRLFDLIKPKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTM 816

Query: 795  SGGGNHRASGMMKSER--LNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQS 852
            SGGGNH + G+M  +R   N    +  E+V QI+++L+++E+NF++A +  +EME+ LQ 
Sbjct: 817  SGGGNHVSKGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQK 876

Query: 853  LKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESS--DDTLIEAN---- 906
            L +R+PEIE +ISK  MEID+  +EIK          KE++L E +  D++ ++ N    
Sbjct: 877  LNNRKPEIELEISKIIMEIDTYSAEIK---------SKERQLQEKTNIDNSELQDNEELK 927

Query: 907  ---SRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITL 963
                 L  LK E   L+ + K+KK KI  L+E+IMKIGG +LQ+Q S V SI QRI I  
Sbjct: 928  VAIENLQKLKEEHLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILT 987

Query: 964  GKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASID 1023
             KQK+D+T+ KK++ +L++ +K       DI   T+             + +  ++ SI+
Sbjct: 988  AKQKKDRTSKKKSDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIE 1047

Query: 1024 KLQXXXXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLK 1083
            + Q                         +F  FE+++NN+LEKLN LLNHI      L  
Sbjct: 1048 EFQAHKETLKDECDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLED 1107

Query: 1084 QLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGN 1143
             L  L +R +   L  L+               + SEA++  P+NG L + + +    G+
Sbjct: 1108 SLSKLTLRKMHQVLMALD---------------EESEAKA--PNNGTLSD-EQIHDQTGH 1149

Query: 1144 E--PTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYA 1201
            E   TA Q +D MD+D   E+ +  + LP L++ +L           +  L  ++E+  A
Sbjct: 1150 ELTNTAVQDDDSMDIDNGAEVIS--NGLPILSDDELSALDITLVETEVSDLEKYIESTDA 1207

Query: 1202 DIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKE 1261
            +IEVLEEY KRL +F+ RKL+LN AV++R++VR+  + L+K R +EFM+GF  ISMTLKE
Sbjct: 1208 NIEVLEEYVKRLTEFKTRKLDLNDAVDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKE 1267

Query: 1262 MYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALH 1321
            MYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALH
Sbjct: 1268 MYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALH 1327

Query: 1322 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKN 1381
            KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK 
Sbjct: 1328 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKC 1387

Query: 1382 RNMTKSVALENKDLIN 1397
             N T S  ++N++++N
Sbjct: 1388 ENRTHSATIKNREILN 1403

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1336 bits (3458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/1379 (52%), Positives = 968/1379 (70%), Gaps = 23/1379 (1%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQPVTSSSS-NVPYLQPLKSELSSSRGR---VYSQXXXXX 87
            + ++TPRKLV+G+ D R+A S    SSSS  VP LQP     +SSRGR    YSQ     
Sbjct: 47   AHAKTPRKLVVGNGDNRYAHSSQSISSSSLQVPPLQP---PATSSRGRGSKTYSQSPPRS 103

Query: 88   XXXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVG 147
                   KLELIQ+SP K +RLE QK    +       RLCI++L L +FKSYAG QVVG
Sbjct: 104  PGRSPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVG 163

Query: 148  PFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEV 207
            PF++SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE +P+L SC VEV
Sbjct: 164  PFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEV 223

Query: 208  FFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLD 267
             F+YV DE  G T + +++P LVVTRKAF+NNTSKYYVN +E++Y +VT+LL+KEG+DLD
Sbjct: 224  HFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLD 283

Query: 268  HKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVC 327
            HKRFLILQGEVE+IAQMK KAE+EG+DGLLEYLEDIIGTAKYKPLIE+ L  ++ LND+C
Sbjct: 284  HKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDIC 343

Query: 328  QEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKI 387
             EKENR++IV+REK+SLE+G                 +SKL Q+ +  ++ K  NT +KI
Sbjct: 344  IEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKI 403

Query: 388  KTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLE 447
              L +KL  E  K    K+E+ +L +    L   ++   + E  L  +KR  D   V  E
Sbjct: 404  TNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNE 463

Query: 448  EKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLD 507
            EK+KN  +K+ KAEKT  +   SI++++A+L EL + QV YE  L ELN+   VEK KL+
Sbjct: 464  EKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLE 523

Query: 508  EIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEIS 567
            +IK SLK KT  IS++I ++E+ELEPWN +LQEK++QI+L E++IS++KE+ AK+A+EI 
Sbjct: 524  KIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEID 583

Query: 568  KSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQ 627
            + + +I   ++++ +  + ++ L  +H  ++ +I  G+ EC NA  ++KEM+ +L T RQ
Sbjct: 584  QFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQ 643

Query: 628  RSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLD 687
            ++LDA+S+LS  ENK+KVL+AL RLQ+SGRISGFHGRLGDLG ID+KYDVAISTACPRL+
Sbjct: 644  KALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLE 703

Query: 688  DVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNK 747
            D+VVETVECGQQCIE+LRKNKLGYARFILLDKLR FN+++I TP +V RLFDL+HP D K
Sbjct: 704  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPK 763

Query: 748  FRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMK 807
            F +AF+SVL +TLVA DLK+ANRVAYGK+RFRVVTLDG LID+SGTMSGGG+  + G+M+
Sbjct: 764  FSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQ 823

Query: 808  SERLNTG--ASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDIS 865
              R  T     +++EEV Q++  L ERE+NF++A+DT+++ME+ L+ LK++EP IE +IS
Sbjct: 824  INRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNIS 883

Query: 866  KRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKS 925
            +  MEI+S  SEIK+ E +    ++     + ++  L E    + SLK E K ++ + KS
Sbjct: 884  QLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKS 943

Query: 926  KKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEK 985
            KK++I+ L+ +IM+IGG +L++Q S VDS+ QRI I + KQK++++ +KK EN++ +  K
Sbjct: 944  KKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHK 1003

Query: 986  QAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXX 1045
               + S D++                 + + ++  S+  +Q                   
Sbjct: 1004 MKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLND 1063

Query: 1046 XSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTL----- 1100
             + +   F  FE+++ N+LEKLN L  H+ K+     ++L  LKIRDVT  L  L     
Sbjct: 1064 INEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESN 1123

Query: 1101 NKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPE 1160
            N    SE+   D    +SS    ++  N DL   D V+          Q ++QMDV++  
Sbjct: 1124 NASDPSENPVSDVEESESSVGEGKD-ENKDLDAQDQVQDA------EKQGDNQMDVEDGG 1176

Query: 1161 EMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARK 1220
            E   S   L + +E +L           I  L +F++ + ADI+VLEEY +RL++F++R+
Sbjct: 1177 EY--SDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRR 1234

Query: 1221 LELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSL 1280
            L+LN+AVE+R+ V++  D L+KKR DEFM GF  ISMTLKEMYQMITMGGNAELELVD+L
Sbjct: 1235 LDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTL 1294

Query: 1281 DPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340
            DPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1295 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1354

Query: 1341 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399
            RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N TKS  ++N D ++ S
Sbjct: 1355 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1328 bits (3437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/1384 (53%), Positives = 963/1384 (69%), Gaps = 29/1384 (2%)

Query: 33   RSRTPRKLVLGSPDKRFAFSQPVT---SSSSNVPYLQPLKSELSSSRGRV---YSQXX-- 84
            +S+TP+KL+L   D   A +       SSS   P L P     SSSRGR    YSQ    
Sbjct: 54   KSQTPKKLILRDYDS-IAITPTAAMPPSSSLQAPSLHPPTE--SSSRGRTARTYSQSPPR 110

Query: 85   --XXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAG 142
                        KLELIQLSP K +R+  QK  + +   Q IERLCI++L LH+FKSYAG
Sbjct: 111  SPARSPARSPTRKLELIQLSPVKNSRIALQKIYESKNEKQ-IERLCIDKLVLHDFKSYAG 169

Query: 143  TQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDS 202
            TQVVGPFHSSFSAVVGPNGSGKSNVIDS+LFVFGFRA+KMRQ +LSDLIHKSE  P+L S
Sbjct: 170  TQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKS 229

Query: 203  CHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKE 262
            C VEV F+YV D+ DG T +   +  LV+TRKAFKNNTSKYY+NGKES+YT VT+LL+ E
Sbjct: 230  CSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDE 289

Query: 263  GIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQ 322
            GIDLDH RFLILQGEVE+IAQMKPKAE +GDDGLLEYLEDIIGTAKYKPLIE+   +I+ 
Sbjct: 290  GIDLDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEA 349

Query: 323  LNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTN 382
            LN++C EKENR+EIV+REK+SLESG                 +SKL Q+KLW+++ K + 
Sbjct: 350  LNEICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLST 409

Query: 383  TQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDS---ESSLTSEKRTC 439
            T EK+  ++E+    + K++  + ++ ++   SKS +  ++ IK S   E  L  +KR  
Sbjct: 410  TLEKLSNIKEEFEETKKKHSTTEIQMNEI---SKSYHEMLKNIKASQEQEKKLNIQKRNY 466

Query: 440  DRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSL 499
            D +RVSLEE+ KNI +KK K EK       +I+ T+ K+E+L K++ +YE +LDELN  L
Sbjct: 467  DTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQL 526

Query: 500  LVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESL 559
             +E+  L+EIKISLK KT   S +I + E+ELEPWN++LQ K+SQI+++E++IS++KE  
Sbjct: 527  QIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGR 586

Query: 560  AKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMK 619
             K+  +I    + IS   ++   + + I  L  E   I +++ IG TE  NA  K++EMK
Sbjct: 587  VKLENDIENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMK 646

Query: 620  AVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAI 679
            AVL  HRQ+++DA++SLS  ENKN+VL++L RLQ+SGRISGF+GRLGDLG IDD+YD+AI
Sbjct: 647  AVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAI 706

Query: 680  STACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFD 739
            STACPRL+D+VVETVECGQQCIE+LRKNKLGYARFILL+KLR+F+MN I TPNNV RLFD
Sbjct: 707  STACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFD 766

Query: 740  LVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGN 799
            LV   D KF  AFYSVLRDTLV  +LK+ANRVAYG +RFRVVTL G+LID+SGTMSGGG 
Sbjct: 767  LVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGT 826

Query: 800  HRASGMMK-SERLNTG-ASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDRE 857
              + G+MK ++  N+G  S+T E+V +I++EL  RE+NF+IA +T  EME  L+ LKDR+
Sbjct: 827  QTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRK 886

Query: 858  PEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNE--SSDDTLIEANSRLDSLKAE 915
            P++E +ISK  +EI S ++E +L + +    +K+Q L+E  S+++ L      L +L+ +
Sbjct: 887  PDVELEISKFELEITSWVTEHELMQQQLN--EKQQSLDECMSNNEELSTMEHELGTLQND 944

Query: 916  CKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKK 975
             K L+ E KSKK++IK L+++IMK+GG KLQ+Q S VDSI Q+  I  GK K+DK  +KK
Sbjct: 945  YKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKK 1004

Query: 976  AENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXX 1035
            AE +LKR  K+  + S D+   T+               + E E  + +L+         
Sbjct: 1005 AETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQN 1064

Query: 1036 XXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTA 1095
                             F VF+++  N+ EKLN+LLN I KD      +L+SLKIRD+T 
Sbjct: 1065 SENLKDQLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITH 1124

Query: 1096 TLQTLNKLLLSESRSGDELHGQS-SEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQM 1154
            TLQ L+   + +      +   + S + +    N + ME   +E    +    +  + +M
Sbjct: 1125 TLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEM 1184

Query: 1155 DVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLV 1214
            ++DE +  E S   +P+++E + K            QL D+++    +I+VLEEY +R+ 
Sbjct: 1185 EIDE-DNNEISKG-IPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVA 1242

Query: 1215 DFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAEL 1274
            +++ RKL+LN AV++R+ VR+  D L+K R +EFM GF  IS+TLKEMYQMITMGGNAEL
Sbjct: 1243 EYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAEL 1302

Query: 1275 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1334
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1303 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1362

Query: 1335 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKD 1394
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK+ N TKS  L+N D
Sbjct: 1363 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNND 1422

Query: 1395 LINR 1398
            +INR
Sbjct: 1423 IINR 1426

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1326 bits (3432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/1438 (52%), Positives = 980/1438 (68%), Gaps = 62/1438 (4%)

Query: 2    ESPLSKKQKTFVNRD----------EDFSQTEESVDVTR-------------ASRSRTPR 38
            +SPLSK+QK    ++          E+ SQ E  V+++               S+S TPR
Sbjct: 3    DSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYTPR 62

Query: 39   KLVLGSPDKRFAFSQPV--TSSSSNVPYLQPLKSELSSSRGR---VYSQXXXXXXXXXXX 93
            KLVL S + R+AFSQP   T++S +VP LQP K+   SSRGR    YSQ           
Sbjct: 63   KLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKT---SSRGRDHKSYSQSPPRSPGRSPT 119

Query: 94   XKLELIQLSPTKKTRLESQKT-EQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSS 152
             +LEL+QLSP K +R+E QK  ++ +  ++   RL IN L L NFKSYAG QVVGPFH+S
Sbjct: 120  RRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTS 179

Query: 153  FSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYV 212
            FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSEA P+L SC V V FQYV
Sbjct: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYV 239

Query: 213  QDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFL 272
             DE  G + + +++PGL++TRKAFKNN+SKYY+N KESSYT+VT+LL+ EGIDLDHKRFL
Sbjct: 240  IDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFL 299

Query: 273  ILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKEN 332
            ILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGTA YKPLIE+ + QI+ LN+VC EKEN
Sbjct: 300  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKEN 359

Query: 333  RYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEE 392
            R+EIV+REK+SLESG                 RSKL Q KL +++ K  +T EKI +  +
Sbjct: 360  RFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNK 419

Query: 393  KLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKN 452
             L  E+ K+ E  +++ +++++ K +   I      E +L  E+R  +  RVSLEE+ KN
Sbjct: 420  DLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKN 479

Query: 453  ISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKIS 512
            +  K  KAEKT  +T +SI+  +  LEEL   Q ++E E+ +L + L  E++ LD+IK+S
Sbjct: 480  LVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLS 539

Query: 513  LKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEND 572
            LK KT  IS +I   E+ELEPW+++LQEK SQI+L E+++S+L+E+ AK+ + +   E  
Sbjct: 540  LKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEK 599

Query: 573  ISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDA 632
            I   +    E    I  L+K+   ++ +   G+    +A  K+KEM+ VL  HRQR+++A
Sbjct: 600  ILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEA 659

Query: 633  KSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVE 692
            +SSLS  +NK+KVL+AL RLQ+SGRI+GFHGRLGDLG IDD +DVAISTACPRLDDVVV+
Sbjct: 660  RSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVD 719

Query: 693  TVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAF 752
            TVEC Q CI++LRKNKLGYARFILLD+LR FN+  I TP NV RLFDLV P + KF NAF
Sbjct: 720  TVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAF 779

Query: 753  YSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLN 812
            YSVLRDTLVA++LK+AN VAYGK+RFRVVT+DGKLID+SGTMSGGGNH A G+MK   L 
Sbjct: 780  YSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMK---LG 836

Query: 813  TGAS-----FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKR 867
            T  S     +T EEV +I+ EL+ERE NF++A+DT+HEME+ L+ L+D EP++E+ ISK 
Sbjct: 837  TNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKA 896

Query: 868  RMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKS 925
             ME DSL SE+ L E +   A +   + +++ +   ++  N  L+ L+ E   L+ E K+
Sbjct: 897  EMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKN--LERLRGEYNDLQSETKT 954

Query: 926  KKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEK 985
            KK KIK LQ++IMKIGG KLQ+Q S V+S+ Q++ I + K K+ K+A KK+  D+ +++K
Sbjct: 955  KKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQK 1014

Query: 986  QAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXXXXXXXXXXXXXX 1045
                   D++  ++               + E + ++++                     
Sbjct: 1015 LLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMED 1074

Query: 1046 XSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTL--NKL 1103
                  +F   E+++ N+LEKLN LL +I  +     K L  L IRDVT TL  L  NK+
Sbjct: 1075 MEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKM 1134

Query: 1104 --LLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEE 1161
              +  + ++  EL  +     +Q+ S  ++ + +T   C    P        M++DE  +
Sbjct: 1135 DSVKEDVKNNQELDQEYRSCETQDES--EIKDAET--SCDNYHP--------MNIDETSD 1182

Query: 1162 METSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARKL 1221
             E S   +P+L+E +L+          I +L+ +VE    DI VLEEY +RL +F+ RKL
Sbjct: 1183 -EVSRG-IPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKL 1240

Query: 1222 ELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLD 1281
            +LN AV++RD V++    L+KKR DEFM GFN ISMTLKEMYQMITMGGNAELELVDSLD
Sbjct: 1241 DLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLD 1300

Query: 1282 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1341
            PFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1301 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1360

Query: 1342 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399
            NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG+YK  N TKS  ++N D++NR+
Sbjct: 1361 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1390 (51%), Positives = 945/1390 (67%), Gaps = 36/1390 (2%)

Query: 21   QTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS-NVPYLQPLKSELSSSRGR- 78
            Q+  S+     S+S TPRKL+L   D R+AFSQP  S+SS  VP LQP ++  SSSRGR 
Sbjct: 42   QSAVSLSPPAISKSHTPRKLILHQSDNRYAFSQPTVSASSLQVPSLQPPETSSSSSRGRR 101

Query: 79   ---VYSQXXXXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLH 135
               VYSQ            KLELIQLSP K  R+  +K +++       ERL IN+L L+
Sbjct: 102  DIKVYSQSPPRSPGRSPTRKLELIQLSPVKNNRI--RKLQELYNSQIKKERLFINKLVLN 159

Query: 136  NFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSE 195
            NFKSYAG QV+GPF+++FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE
Sbjct: 160  NFKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 219

Query: 196  AHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQV 255
            + PNL SC V+V FQYV D+ +G + +  ++P L++TRKAFKNN+SKY++NGKESSYT+V
Sbjct: 220  SFPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEV 279

Query: 256  TELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQ 315
            T+LL++EGIDLDHKRFLILQGEVE+IAQMKPKAE+EGDDGLLEYLEDIIGTA YK  IE+
Sbjct: 280  TKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEK 339

Query: 316  TLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWK 375
              +++D LN++C EKENR+EIVEREK+SLES                  +SKLLQ+ + K
Sbjct: 340  NTIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILK 399

Query: 376  NSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSE 435
               K  +T +K+  L+E+   E  K+   +RE  +LE   K +N  I  IK+   + TS+
Sbjct: 400  EHEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSK 459

Query: 436  KRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDEL 495
            KR     + SLEEK+K+ ++KK KA K+   +   +   + ++E L  DQ + E  L  L
Sbjct: 460  KRELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSL 519

Query: 496  NKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVL 555
               L  EK  L+EIK+SLK KT  IS +I + E+ELEPW  +LQEK+ +I++ E++IS+L
Sbjct: 520  LSELKKEKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLL 579

Query: 556  KESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKM 615
            +E+ +K+ +EI K +ND+    +    Q + +  L+ + + I  +   G++EC NA +K+
Sbjct: 580  QENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKI 639

Query: 616  KEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKY 675
            K+M+ VL T RQ+ +DA+S L+T ENK+KVLSAL +LQ+SGRISGF+GRLGDLG ID++Y
Sbjct: 640  KDMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEY 699

Query: 676  DVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVS 735
            D+AISTA  RLDD+VV++VECGQ CIE+LRKNKLGYARFILL+KLR+  +  IQTP NV 
Sbjct: 700  DIAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVK 759

Query: 736  RLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMS 795
            RLFDLV P  + F  AFYSVLR+TLVAKDLK+ANRVAYG  RFRVVT+DGKLID+SGT++
Sbjct: 760  RLFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTIT 819

Query: 796  GGGNHRASGMMK-----SERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDAL 850
            GGG   A G+MK      E ++    ++ +++ +I++EL ERE NFK A DT  EME AL
Sbjct: 820  GGGKQTAQGLMKLRKKGQENIDI---YSNDDIEKIEKELVERENNFKFANDTYFEMEQAL 876

Query: 851  QSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLD 910
            Q LKDR+PE+E +ISK  M+ D    E++  +D+        + +  + D ++E   +L+
Sbjct: 877  QRLKDRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLN 936

Query: 911  SLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDK 970
             L+ E +LL    K+   KI +L+++IM+IGG  LQ+Q S V+SI Q I I   KQKR  
Sbjct: 937  LLQKEYQLLLDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGI 996

Query: 971  TAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXX 1030
            +++KK EN+++R EK      +D   C+             +  +  ++ +  KL+    
Sbjct: 997  SSMKKIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENS 1056

Query: 1031 XXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKI 1090
                              EG  F  +E+D+ ++LEKLN+LL HI +   +  +QL +L++
Sbjct: 1057 ELEIECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALEL 1116

Query: 1091 RDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVD----TVEGCMGNEPT 1146
            R+ T                GDE    S     +    G +   D      E  M NE  
Sbjct: 1117 RNTTTIF-------------GDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNMRNEKN 1163

Query: 1147 ASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVL 1206
            +++ E  M++D+  + E SP  +P++++A+L           IGQL ++V     +I+VL
Sbjct: 1164 STEAE--MEIDDVAD-EFSPG-IPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVL 1219

Query: 1207 EEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMI 1266
            EEY +RL D+ +RKL+LN+AVE+R+++++  D L+KKR DEFM GF  ISMTLKEMYQMI
Sbjct: 1220 EEYARRLADYNSRKLDLNQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMI 1279

Query: 1267 TMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPT 1326
            TMGGNAELEL+DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPT
Sbjct: 1280 TMGGNAELELIDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPT 1339

Query: 1327 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTK 1386
            PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N TK
Sbjct: 1340 PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTK 1399

Query: 1387 SVALENKDLI 1396
            S A+ NKD +
Sbjct: 1400 SAAIRNKDFL 1409

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1243 bits (3217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/1397 (48%), Positives = 927/1397 (66%), Gaps = 50/1397 (3%)

Query: 33   RSRTPRKLVLGSPDKRFAFSQPVTSSSSN--VPYLQ----PLKSELSSSRGRVYSQXXXX 86
            ++ TPRKL++G  + ++A SQP TS+SS+  VP LQ    PL  +    R ++YSQ    
Sbjct: 64   KTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQSPPR 123

Query: 87   XX----XXXXXXKLELIQLSPTKKTRLESQKTEQVRGL-AQPIERLCINRLSLHNFKSYA 141
                        KLELIQLSP K +RLE QK           + RL I++L LHNFKSYA
Sbjct: 124  SPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYA 183

Query: 142  GTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLD 201
            G Q +GPF +SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSE   NL+
Sbjct: 184  GEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLN 243

Query: 202  SCHVEVFFQYVQDEL----DGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTE 257
             C VEV F+YV+DE     DG T   ++   LV+TRKAFKNN+SKY++NGKES++T+VT+
Sbjct: 244  FCSVEVHFRYVKDEYTAPTDGDTMEAEN--TLVITRKAFKNNSSKYFINGKESNFTEVTK 301

Query: 258  LLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTL 317
            LL+++GIDLDHKRFLILQGEVE+IAQMK KAEK+ +DGLLEYLEDIIGT  YKPLIEQ  
Sbjct: 302  LLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKT 361

Query: 318  VQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNS 377
            V+I+ +N++C EKENR+ IV+ EK+SLE                   +SKL Q+ L+ N+
Sbjct: 362  VEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNN 421

Query: 378  FKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKR 437
             K   T  +I +L      E+ ++++  +E++ L++        +  +   E SL   KR
Sbjct: 422  DKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKR 481

Query: 438  TCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNK 497
              +   VSLEE  KN+ QK  KA+ T  ++ + I+  + +L+E  + Q +YE E+++L+K
Sbjct: 482  EINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSK 541

Query: 498  SLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKE 557
               VE+  L +IK+ LK KT   S +I  IE+ELEP N ++QEK+SQIKL E +I ++++
Sbjct: 542  QREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRD 601

Query: 558  SLAKIA-------EEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDN 610
            S  K+        EE+ K + D+ +N K V + +++   L KE  +       G  EC +
Sbjct: 602  SKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQE-------GDKECKD 654

Query: 611  ASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGT 670
            A  K+ EMKA+L +HRQ++++A+S++ST +NKNKVL++L R+Q+SGRI+GFHGRLGDLG 
Sbjct: 655  AGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGI 714

Query: 671  IDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQT 730
            I D+YDVAISTACPRLDD+VVE+VECGQ CIE LRKNKLGYARF++LDKL+ F+M+ IQT
Sbjct: 715  IADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQT 774

Query: 731  PNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDL 790
            P NV RLFDLV P + +F  A YSVLRDTLVAKDLK+ANRVAYGK+RFRVVTLDG+LID+
Sbjct: 775  PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDI 834

Query: 791  SGTMSGGGNHRASGMMKSERLNTGAS--FTAEEVRQIDEELTERERNFKIATDTLHEMED 848
            SGTMSGGG+    G+M      +G S  F+ E++++++ EL  RE+ F +A++T H ME 
Sbjct: 835  SGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQ 894

Query: 849  ALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSR 908
             L+ L DREP++E +ISK+ ++ID+L  +I+L   +      + + +    D L      
Sbjct: 895  ELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGN 954

Query: 909  LDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKR 968
            L++L  E K L+ + K+   ++  L+++IM+IGG++LQLQ S V S+ QRI I   K K+
Sbjct: 955  LEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKK 1014

Query: 969  DKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXX 1028
             KT VKK   +LK+  K     + +    T              N +L++  S++ +Q  
Sbjct: 1015 SKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDE 1074

Query: 1029 XXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESL 1088
                              +    +F   ++++ N++E+ N +L+++ K+   LL++L + 
Sbjct: 1075 KINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134

Query: 1089 KIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTAS 1148
            ++RDVT TL  L +        G E + Q +    +  SN D   +   +  + N  T+S
Sbjct: 1135 RLRDVTHTLDLLRE------EEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSS 1188

Query: 1149 --------QPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAY 1200
                      E  MDVD+  ++ +    +P+L++ +L           I QL  F+ N  
Sbjct: 1189 LSNSVKVASDEISMDVDDCGDLVS--QGIPRLSDKELSTIDTDNLNEEINQLQSFINNVS 1246

Query: 1201 ADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLK 1260
             +IE+LEEY KRLV+F+ RK++LN +V +R+ +    + L+KKR +EFM GF+ ISMTLK
Sbjct: 1247 INIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLK 1306

Query: 1261 EMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFAL 1320
            EMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFAL
Sbjct: 1307 EMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFAL 1366

Query: 1321 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK 1380
            HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK
Sbjct: 1367 HKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYK 1426

Query: 1381 NRNMTKSVALENK-DLI 1396
            + NMTK+  + N+ DLI
Sbjct: 1427 HENMTKNATIRNREDLI 1443

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1236 bits (3198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1390 (49%), Positives = 930/1390 (66%), Gaps = 63/1390 (4%)

Query: 32   SRSRTPRKLVLGSPDKRFAFSQP-VTSSSSNV---PYLQPLKSELSSSRGRVYSQXX--- 84
            S +RTPRKLVLGSP+K++A S    T+++SN    P LQP  +   + RGR YSQ     
Sbjct: 24   SPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAH--AVRGREYSQSPPRS 81

Query: 85   -XXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGT 143
                       KLELI+LSP K TRLE QK  +     Q  +RLCI++L L+NFKSYAG 
Sbjct: 82   PTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEAN--TQTSQRLCIDKLVLNNFKSYAGI 139

Query: 144  QVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSC 203
            Q +GPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLS+LIHKSE  P+L SC
Sbjct: 140  QEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASC 199

Query: 204  HVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEG 263
             V++ F YV D  +G T +      +VV R+AFKNN+SKYYVNGKES+YT+VT LL++EG
Sbjct: 200  SVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEG 259

Query: 264  IDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQL 323
            IDLDHKRFLILQGEVESIAQMK KAEK+ DDGLLEYLEDIIGTAK+KP IE+ L +I+ L
Sbjct: 260  IDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETL 319

Query: 324  NDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNT 383
            N+VC EKENR+E+V++EK +LESG                 +++LLQ +++ ++ K   +
Sbjct: 320  NEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATS 379

Query: 384  QEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDR 443
             +KI  L  +   E+++Y   ++E + L  E  +       ++    ++ S+KR+ ++D 
Sbjct: 380  CDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDF 439

Query: 444  VSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEK 503
            ++ +EKLK+I++K   AEK    + ++  A   ++E L K+    E EL  LN S+ +EK
Sbjct: 440  IATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEK 499

Query: 504  TKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIA 563
             KL+EIKI L  KT  +S ++  +E++LEP+  ++QEK+S+IKL ETKI++LK S + + 
Sbjct: 500  EKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLL 559

Query: 564  EEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLT 623
            +E +  E+ I + + +  +Q +    L  E + ++ +I   Q EC+ A  +  EM+ VL 
Sbjct: 560  KEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTAQKECEEAQKQTNEMRDVLI 619

Query: 624  THRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTAC 683
              RQ   +AK++L+ F+NKN+VL AL +LQ SGRI+GFHGRLGDLGTIDD+YD+AISTAC
Sbjct: 620  QQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTAC 679

Query: 684  PRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHP 743
            PRLDD+VVETVECGQQCI+HLRKNKLGY RFILLDKLR  N++ I TP NV RLFDL+ P
Sbjct: 680  PRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITP 739

Query: 744  IDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRAS 803
            + + FR AFYSVLRDTLVA+DL++ANRVAYGK+RFRVVTLDGKLID+SGTMSGGG+   S
Sbjct: 740  VRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQS 799

Query: 804  GMMKSERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETD 863
            G+M+S +  T + ++ +EV +++ +L+ +E N++ A   +HEME ALQ L DR PEI+  
Sbjct: 800  GLMRS-KATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQ 858

Query: 864  ISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEM 923
            ISK ++E  S ++E++    R + L +E  +NE +   L++   +LD L+   +      
Sbjct: 859  ISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDAS 918

Query: 924  KSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRY 983
            K  ++KI +L+++IM+ GG +L++Q + V S+ Q I I   KQK++KT  KK + DL R 
Sbjct: 919  KFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEKQKKEKTRSKKLDIDLARA 978

Query: 984  EKQAGQLSVDIDQCTN--------------XXXXXXXXXXXXDNKILELEASIDKLQXXX 1029
             ++  + S ++  C                            + +  EL +S++KL+   
Sbjct: 979  TREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQEL 1038

Query: 1030 XXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLK 1089
                               +  +F   E++ +++LEKL+ L  ++ K        L+SLK
Sbjct: 1039 LSIER--------------DSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLK 1084

Query: 1090 IRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQ 1149
            IRDV+  L  LN  ++           +S    + +  NGD+++  ++     N+     
Sbjct: 1085 IRDVSKLLSQLNDGII-----------ESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDS 1133

Query: 1150 PEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEY 1209
             E             + S LP LTE +L+          + QL D+++N   DIEVLEEY
Sbjct: 1134 GE-----------AATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEY 1182

Query: 1210 TKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMG 1269
             +RL ++Q RKL+LN+AV +R+ VR  C++ + +RL++FM GF  ISMTLKEMYQMITMG
Sbjct: 1183 ARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMG 1242

Query: 1270 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1329
            GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1243 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1302

Query: 1330 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVA 1389
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYKN NMTKS  
Sbjct: 1303 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTT 1362

Query: 1390 LENKDLINRS 1399
            L+N D+++ S
Sbjct: 1363 LQNIDILHSS 1372

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1219 bits (3153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1449 (47%), Positives = 943/1449 (65%), Gaps = 83/1449 (5%)

Query: 2    ESPLSKKQKTFVNRDEDFSQTE----------------ESVDVT---------------- 29
            +SP+SKKQK   +RDED                     +  D+T                
Sbjct: 3    DSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQSQ 62

Query: 30   -RASRSRTPRKLVLGSPDKRFAFSQP-VTSSSSNVPYLQPLKSELSSSRGR---VYSQXX 84
             R  RSRTPRKL++ S D RF  SQP + S+ S  P LQ      S S GR    YSQ  
Sbjct: 63   DRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQTPSLQ----HPSVSTGREHKFYSQSP 118

Query: 85   ----XXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSY 140
                           LELIQLSP K  R E QK  +++   +   RL I RL L NFKSY
Sbjct: 119  PRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSY 178

Query: 141  AGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200
            AG QVVGPFH++FSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL DLIHKSE +P L
Sbjct: 179  AGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPEL 238

Query: 201  DSCHVEVFFQYVQDELDG-RTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELL 259
             SC VE+ FQYV D+ +G  + + + +  LVV RKAFKNN+SKYY+N KESS+TQVT LL
Sbjct: 239  SSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLL 298

Query: 260  RKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQ 319
            + EGIDLDHKRFLILQGEVE+IAQMKPK+EKEGDDGLLEYLEDIIGT+ YK  IE  L +
Sbjct: 299  KNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSK 358

Query: 320  IDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFK 379
            ++ LN++C EKENR+ IVE+EK SL  G                 +SK  QH+L+ ++ K
Sbjct: 359  VEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKK 418

Query: 380  STNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTC 439
             T+T  KI   +E    E  KY+   +E+K L+ E  +LN  +   K  E  L S +R  
Sbjct: 419  LTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKN 478

Query: 440  DRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSL 499
            + + +S +E +KNI +KK  AEK  + T  SI  T  KLE L   Q  Y K+++ELN+ L
Sbjct: 479  NSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKL 538

Query: 500  LVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESL 559
             +EK+KL+EIKISLKGKT   S +I + E+ELEP+ ++LQEK SQI+L +++IS+L E+ 
Sbjct: 539  KIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENK 598

Query: 560  AKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMK 619
              ++ EI   +  I   +  V    + I G +++  + ++++  G  E +  + K++EM+
Sbjct: 599  DNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMR 658

Query: 620  AVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAI 679
              L +HRQ++ D+++SLS  +NKN VL+AL +LQ+SGRISGF+GRLGDLG ID+KYDVAI
Sbjct: 659  DKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAI 718

Query: 680  STACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFD 739
            STACPRL+D+VV++V+CGQQCI++LRKN+LGYARFILLDKLR FN+N I+TP+N  RLFD
Sbjct: 719  STACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFD 778

Query: 740  LVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGN 799
            L+   ++KF  AFYSVLRDTLVA +L  AN+VAYGK+RFRVVTLDGKLID+SGTMSGGGN
Sbjct: 779  LIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGN 838

Query: 800  HRASGMMK-SERL--NTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDR 856
            +   G+MK  + L  N     + EEV++++ EL   E+NFK+A ++L EM   +  +K++
Sbjct: 839  YVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQ 898

Query: 857  EPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNE---SSDDTLIEANSRLDSLK 913
             P  E +ISK  +EI+   +EIK      + LK++Q++++   +++D +  A+ +L +LK
Sbjct: 899  IPATELNISKTTIEIEYCENEIKQL---ISQLKEKQEIHDQESNNNDEIKVADDKLQALK 955

Query: 914  AECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAV 973
             E   L  + K  K +I++L++QIM  GG +L++Q S V S+  ++ I   KQK DK+A+
Sbjct: 956  KEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAI 1015

Query: 974  KKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXXX 1033
            KK  N LK+ + +      +  +                 ++ +LE+ I+  Q       
Sbjct: 1016 KKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEIL 1075

Query: 1034 XXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDV 1093
                           + ++F  FE++I N+L+KL DL +H+ K    L  +L +L IR++
Sbjct: 1076 LNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREI 1135

Query: 1094 TATLQTLNKLL----LSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQ 1149
            +  L++ ++ L    +S++ + ++    SS   S    N D M++D+ +           
Sbjct: 1136 SQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSNINTDTMDIDSTDN---------- 1185

Query: 1150 PEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEY 1209
                         E +P  + +L+E ++           I  L + +E++ A+IE+LEEY
Sbjct: 1186 -------------EINPG-IKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEY 1231

Query: 1210 TKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMG 1269
             +RL +++ RK +L++++ ++++ ++  + L+KKRL+EF  GF+ IS+TLKEMYQMITMG
Sbjct: 1232 VRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMG 1291

Query: 1270 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1329
            GNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1292 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1351

Query: 1330 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVA 1389
            VMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK+ NMT+S  
Sbjct: 1352 VMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSAT 1411

Query: 1390 LENKDLINR 1398
            L N D++NR
Sbjct: 1412 LVNNDMLNR 1420

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1216 bits (3145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1390 (49%), Positives = 914/1390 (65%), Gaps = 66/1390 (4%)

Query: 33   RSRTPRKLVLGSPDKRFAFSQP--VTSSSSNVPYLQPLKSELSSSRGRV---YSQXXXXX 87
            +S TP K+++ +         P  + SSS+  P LQ      SSSRGR    YSQ     
Sbjct: 45   KSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQ---HPSSSSRGRAVKAYSQSPPRS 101

Query: 88   X----XXXXXXKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGT 143
                       KLELIQLSP K +R E QK    +   + IER+C+N+L LHNFKSYAGT
Sbjct: 102  PDRSPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQ-EEKIERICLNKLVLHNFKSYAGT 160

Query: 144  QVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSC 203
            Q +GPFHSSFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKL+DLIHKSE +P+L SC
Sbjct: 161  QTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSC 220

Query: 204  HVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEG 263
             V+V F+Y+ D  D  T +   +  L++TR+AFKN+TSKYY+NGKES+Y  +T LL++EG
Sbjct: 221  AVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEG 280

Query: 264  IDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQL 323
            IDLDH RFLILQGEVE+IAQMKPKAEKEGDDGLLEYLEDIIGT KYK LI++  ++I+ L
Sbjct: 281  IDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEAL 340

Query: 324  NDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNT 383
            ND+C E+ENR++I++REK SLES                  +SKL+Q+K+W+N+ K +NT
Sbjct: 341  NDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNT 400

Query: 384  QEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDR 443
             EKI  LE++ + E+ K TE K +I +L          ++ +   E  L + KR+ D D 
Sbjct: 401  LEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDN 460

Query: 444  VSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEK 503
            VS  E+LKNI +K  K  K     + +I+++  +L+    ++  +E +L EL+ +L+ E 
Sbjct: 461  VSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTES 520

Query: 504  TKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIA 563
              L+ IK+ LK KT  +S +I + E++LEPWN+KL E +S+I+++E++ ++ +ES  K+ 
Sbjct: 521  QLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLK 580

Query: 564  EEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLT 623
              I   E D++   K   ++ + ++ L  +  ++ +++I G  E   A+ K+ EM+ +L 
Sbjct: 581  ANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILI 640

Query: 624  THRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTAC 683
              RQ++ DA++SLS  EN++KVL AL +LQ+SGRI+GFHGRLG+LG ID+KYDVAISTAC
Sbjct: 641  QDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTAC 700

Query: 684  PRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHP 743
            PRL+D+VV++VECGQQCIE+LRKN LG+ARFILLDKL  F+M  I TP NV RLFDL+  
Sbjct: 701  PRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKV 760

Query: 744  IDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRAS 803
             D KF  AFYSVLR+TLVA DLKEAN VAYGK R+RVVTL G LID+SGTMSGGGN  + 
Sbjct: 761  NDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASK 820

Query: 804  GMMKSERLNT--GASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIE 861
            G M+     +   +++++EEV +I++EL+ RE+N++ A +T+ EME  L++LK+ EP+IE
Sbjct: 821  GAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIE 880

Query: 862  TDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLD---------SL 912
             +ISK   EIDSL +E         SLK++Q LNE +    IE N   D         +L
Sbjct: 881  LEISKLNFEIDSLENE--------CSLKRKQ-LNEPNASFSIEDNMSADITEMDNALYTL 931

Query: 913  KAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTA 972
              + KL+E +MKSKK++IKELQ++IMKIGG KLQ+Q S VDS+ ++  I + KQK +K  
Sbjct: 932  NEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAG 991

Query: 973  VKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXDNKILELEASIDKLQXXXXXX 1032
            + K E+D+++  K+  +   D  +               +  + + E +++ +Q      
Sbjct: 992  IMKIESDVRKLSKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTL 1051

Query: 1033 XXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLE----SL 1088
                               +F   EV+   + EKL  LLN I K    +LK LE    SL
Sbjct: 1052 REKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKK----ILKALEEDHSSL 1107

Query: 1089 KIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTAS 1148
             IR+V   L  LN       +   EL+    + +S +  N +++  D       NE    
Sbjct: 1108 SIREVAYDLDLLNIKEQEAQKIKTELYADFEQNQSNDVINDEMIIEDN-----NNEIAKG 1162

Query: 1149 QPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEE 1208
                                +P   E+  K          + QL D+ E A  D+++LEE
Sbjct: 1163 --------------------IPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEE 1202

Query: 1209 YTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITM 1268
            YT+R+++++ RK +LN++VEQRD VR+  ++L+K R +EFM  FN ISMTLKEMYQ+ITM
Sbjct: 1203 YTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITM 1262

Query: 1269 GGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1328
            GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1263 GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1322

Query: 1329 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSV 1388
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYKN N TKS 
Sbjct: 1323 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSA 1382

Query: 1389 ALENKDLINR 1398
             L+N D++ R
Sbjct: 1383 TLKNNDILCR 1392

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1144 bits (2960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/1408 (46%), Positives = 922/1408 (65%), Gaps = 26/1408 (1%)

Query: 4    PLSKKQK-TFVNRDEDFSQTEESVDVTRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS-N 61
            P+SK+QK T  + +ED   T ++V   ++ R+ TPR L LGS ++      P   S +  
Sbjct: 5    PVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNL-LGSENRNVL---PTGGSQNLQ 60

Query: 62   VPYLQPLKSELSSSRGR---VYSQXXXXXXXXXXXXKLELIQLSPTKKTRLESQKTEQVR 118
            +P L P +S L S+RGR    YSQ            +L+LI+LSP K +R E QK  + +
Sbjct: 61   IPSLLPPES-LGSARGRDFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQKLYESK 119

Query: 119  GLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFR 178
             L    ERL I++L L++FKSYAG QV+GPFH+SFSA+VGPNGSGKSNVIDS+LFVFGFR
Sbjct: 120  KLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFR 179

Query: 179  ANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKN 238
            ANKMRQ +LSDLIHKSE  P+L SC VEV F+YV D+ DG TT+ + +  LVVTRKAFKN
Sbjct: 180  ANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKN 239

Query: 239  NTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLE 298
            N SKY+VNGKES+YT+VT LL+KEGIDLDHKRFLILQGEVE+IAQMK KAEKE DDGLLE
Sbjct: 240  NASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLE 299

Query: 299  YLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXX 358
            YLEDIIGT+KYK  IE+  ++I+ LN++C EKENR+ IVEREK+SLESG           
Sbjct: 300  YLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKE 359

Query: 359  XXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSL 418
                  +SKL Q+ L +++ K  +   K   ++++ + +  ++ +    I  + +    L
Sbjct: 360  KELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVL 419

Query: 419  NVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKL 478
               +  +   E +L+  KRT +  +V  E+ + N+  K+ + E+      + IN+T  ++
Sbjct: 420  KADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEI 479

Query: 479  EELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKL 538
            + + ++Q    +    L+ +L +EK KL+ IK+ L+ KT  +++QI E E+EL PWN + 
Sbjct: 480  QTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQS 539

Query: 539  QEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQ 598
            Q+ + +IK+ E+++S+++E+   +  +I+  EN I + ++ +  Q Q I+ L ++ T + 
Sbjct: 540  QQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVI 599

Query: 599  RQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRI 658
            ++  +G+ EC NA   +  ++  +   RQ++++ +S+ S  EN NKVLSAL RLQ+SGR+
Sbjct: 600  QERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRL 659

Query: 659  SGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLD 718
            +GFHGRLGDL  ID KYDVAISTACPRL+D+VV+TVE GQQCIE+LRKNKLGYARFILLD
Sbjct: 660  NGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLD 719

Query: 719  KLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRF 778
            KL +FN N I TP+   RLFDL+   + +F NAFYSVLRDTLV +++++ANRVAYGK+R+
Sbjct: 720  KLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRY 779

Query: 779  RVVTLDGKLIDLSGTMSGGGNHRASGMM--KSERLNTGASFTAEEVRQIDEELTERERNF 836
            RVVTLDG LIDLSGTM+GGG + + G+M          A F+ EEV+ I+ EL ++E  +
Sbjct: 780  RVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQY 839

Query: 837  KIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDS----LLSEIKLCEDRAASLKKEQ 892
            K A D  HEME+ L+ L+DR PEI+  +SK+ M+I++    + S I + E++   L+  +
Sbjct: 840  KSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMK 899

Query: 893  KLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLV 952
              N+ S   L    ++L  LK++   ++ + KS K+KIK ++++I+++GG +L+ Q  LV
Sbjct: 900  NQNDPSITLL----AKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLV 955

Query: 953  DSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXXD 1012
              I  +IS    + K+ K+   K E+ LK++ K+  + + ++   +             +
Sbjct: 956  TDITNKISENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESKEIE 1015

Query: 1013 NKILELEASIDKLQXXXXXXXXXXXXXXXXXXXXSSEGQDFAVFEVDINNQLEKLNDLLN 1072
            +K+L+++ SI+ L+                         D+    ++ NN+LEKL     
Sbjct: 1016 SKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEASEA 1075

Query: 1073 HIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGD-L 1131
             + K        L  L IRDVT   Q LN ++  E+ S D+   +     +   ++ D +
Sbjct: 1076 SLKKSIKRYNDLLSELTIRDVT---QVLNTIMTEENASVDKSDPKLENTSAVINADDDGI 1132

Query: 1132 MEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIGQ 1191
              V   +    N+       ++M++D       +P  +P L+ ++L           I  
Sbjct: 1133 SAVSENQSFNHNDENDDIDSNKMEIDSQGGF-INPG-IPVLSASELAKVDPQEVELLITS 1190

Query: 1192 LNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNG 1251
            L+DF+ ++ A+++VLEEY  R V+F  RK +LN AV+ RDSV+   + +++KR DEFM G
Sbjct: 1191 LDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEG 1250

Query: 1252 FNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTL 1311
            F  ISMTLKEMYQMIT+GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTL
Sbjct: 1251 FKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTL 1310

Query: 1312 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1371
            SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL
Sbjct: 1311 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1370

Query: 1372 AQQLVGIYKNRNMTKSVALENKDLINRS 1399
             +QLVGIYK+ NMTKS AL N+DL+ R+
Sbjct: 1371 TKQLVGIYKHENMTKSAALVNEDLVGRA 1398

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score =  146 bits (368), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 182/747 (24%), Positives = 324/747 (43%), Gaps = 108/747 (14%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY G+  +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 192 HK-------SEAHP-----NLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNN 239
           ++       SE+       N  + +V+ F++             ++   + + R   +N 
Sbjct: 67  YRGVITGEDSESDEDGSVNNPSTAYVKAFYE-------------KENKTIELMRTISRNG 113

Query: 240 TSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEY 299
            + Y + GK  SY   +  L  E I +  K FL+ QG+VE IA   P         L   
Sbjct: 114 DTNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------DLSRL 166

Query: 300 LEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXX 359
            E++ G+ +YK   +Q   +++QL+    E       +  E  + + G            
Sbjct: 167 FEEVSGSIQYKKEYDQLKEKMEQLSKAATESIKNRRRIHGELKTYKEGINKDEEYKSKVA 226

Query: 360 XXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLN 419
                ++ L+  +L+    K  N  + +   + K+S  + K          + +E ++L 
Sbjct: 227 KKKELQTILVLWQLYHLEQKKINIMKNMADTKSKMSVLKDK----------IHNEERNLQ 276

Query: 420 VTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLE 479
                I    S +T +K   D     L+EK K  S  K+  +    +T+  I   + ++E
Sbjct: 277 RAKTSIAKEMSIITKKKDKID---YKLKEKEKIASDLKL-IKLPQLSTIKRIGNIEKRIE 332

Query: 480 ELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQ 539
                   +EK+++   +S  VE+   +++K+  K K  A   ++ E     + + +  +
Sbjct: 333 -------SFEKDIER--QSSFVERFT-NQLKVVTKTKE-AFERELKETSMNFDKYRLNDE 381

Query: 540 EKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQR 599
           EK +   L E     L    + I E+I  +END    +++V E+    E L     DI +
Sbjct: 382 EKENYQSLNE---KYLTSGGSSIEEKIMINEND----KQEVGEELNRFEKL----IDISK 430

Query: 600 QII--IGQTECDNASNKMKEMKAVL----TTHRQRSLDAKSSLSTFENKNKV-------- 645
           Q I  +   E +N   +  E+  +L    + H +R  + K   S  E+ +          
Sbjct: 431 QRINDVLMVELENNQLRASELTTLLNEKNSIHAERLKELKGLQSDIESASNQEYDLNYKL 490

Query: 646 ---------LSALQRLQRSGR------------ISGFHGRLGDL-GTIDDKYDVAISTAC 683
                    LSA QR     R              G  G + DL     DKY +A+ST  
Sbjct: 491 RETLVQIDDLSANQRESMKERKLRENVAMLKRLFPGVKGLVYDLCHPKKDKYSLAVSTCL 550

Query: 684 PR-LDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDL-V 741
            R  D V+V+     Q+CI +L+K + G A FI L+ + S  + T+   N+   +  +  
Sbjct: 551 GRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETIDS-EIPTLSVSNSQGCILAINA 609

Query: 742 HPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSGTMSGGGNH 800
              D ++  A   V  DT++   L  A R+ + +  + ++VTL+G LI  +G M+GG + 
Sbjct: 610 IEYDPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKAKLVTLEGALIHKAGLMTGGVSK 669

Query: 801 RASGMMKSERLNTGASFTAEEVRQIDE 827
            ++     E   +  +   + + QI+E
Sbjct: 670 DSNNRWDKEEYQSLMNLKDKLIHQIEE 696

 Score =  137 bits (345), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/163 (41%), Positives = 105/163 (64%), Gaps = 12/163 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1290
            ++K+R + F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVAL 1390
            +     N QFIVISL+N MFE +  LVG+Y+ +  N +K V L
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 108/168 (64%), Gaps = 10/168 (5%)

Query: 1233 VRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1283
            V +    +R+ R D F + F+ +S  + ++Y+ +T          GGNA L L D  +P+
Sbjct: 1052 VNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPY 1111

Query: 1284 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV
Sbjct: 1112 LAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNV 1171

Query: 1344 SIVANYIKERT-KNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVAL 1390
              +A YI++R   N QFIVISL+N MFE +Q LVG+++ +    S AL
Sbjct: 1172 ERIATYIRQRALSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRAL 1219

 Score =  135 bits (341), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 192/742 (25%), Positives = 324/742 (43%), Gaps = 152/742 (20%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           + L+NFKSY G   +G   S+F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   IELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLI 66

Query: 192 HK------------SEAHPNLD---SCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAF 236
           ++            SE H N +   S +V+ F+          +   Q+     +TR   
Sbjct: 67  YRGTLQDGDADSGYSETHDNENNPSSAYVKAFY----------SPSGQENDVAELTRTIT 116

Query: 237 KNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGL 296
            +  S Y +NG+  S+ +  + L  E I +  + FL+ QG+VE +A  KP+        L
Sbjct: 117 LSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------L 169

Query: 297 LEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXX 356
               E + G+ +YK                 QE +   E +E+ +S+             
Sbjct: 170 TTLFEQVSGSIQYK-----------------QEYDRLREELEKARSAT------------ 200

Query: 357 XXXXXXXXRSKLLQHKLWKN----SFKS--TNTQEKIKTLEEK--------------LSA 396
                    S+L+Q +   N    SFK      +E  K LEE+              L A
Sbjct: 201 ---------SELIQSRKRANIGLKSFKEGVNKDEEYRKHLEERNKLQQQLIVWQLFHLQA 251

Query: 397 ERAKYTE----HKREIKQLESESKSLNVTIRGIKDSES---SLTSEKRTCDRDRV----S 445
           +R   TE     +RE++ L+SE  S    +   K S +   +L +++RT   D+      
Sbjct: 252 KRDSLTESLKSSQRELQSLDSELNSEEQIVAKKKLSYAKKQTLAAKQRTRLSDKTKKVDH 311

Query: 446 LEEKLKNISQKKVKAEKTHHATVNSINATQAKL---EELFKDQVQYEKELDELNKSLLVE 502
           L   L  I   K   +K   A V  I + Q  +   E L K   QYE +L  +NK+    
Sbjct: 312 LTSSLLPIKSSKESIDKRLSAAVTKIESLQRDIDRQESLVK---QYEHQLKVVNKAKTNF 368

Query: 503 KTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKI 562
           + ++DE   S    +G   +    +++  +     L    S++   E K+ + K    +I
Sbjct: 369 QAEIDESAKS----SGDFKLNEANLKRYEDLKETFLSSGGSEL---EDKLLLEKNESQEI 421

Query: 563 AEEISKSENDISNNRKKVAEQHQA-IEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAV 621
           ++EI      +  +R KV E+  A  E LE E +++ +++    ++   A  K+KE+++ 
Sbjct: 422 SDEIELYSRQLDASRLKVNEELGAEKEALENEVSELTKELSGKTSQVSAAVKKLKELQSR 481

Query: 622 LTTHRQR----SLDAKSSLSTFENKNKV-------------LSALQRLQRSGRISGFHGR 664
              +  R    S   K +L+  ++ N               +S L+RL       G  G 
Sbjct: 482 AEYNNNREYEVSFKLKETLTKLDDMNATQRETAKERKLRENVSILRRL-----FPGVRGL 536

Query: 665 LGDLGTI-DDKYDVAISTACPR-LDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL-- 720
           + +L     +KY VA+ST   +  D V+V+     QQC+  L+K + G   FI LD +  
Sbjct: 537 VHELCRPKKEKYTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDV 596

Query: 721 RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFY----SVLRDTL-VAKDLKEANRVAYGK 775
              +M  + T    +   D +    +  R   Y    S++ D+L +AKDLK    V    
Sbjct: 597 NKVSMMALDTK-GCTLAIDAIDYERDLERAMQYVCSDSIICDSLAIAKDLKWRRNV---- 651

Query: 776 QRFRVVTLDGKLIDLSGTMSGG 797
            R ++V+LDG ++  +G M+GG
Sbjct: 652 -RAKLVSLDGSIVHKAGLMTGG 672

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa]
           {ON} similar to uniprot|P32908 Saccharomyces cerevisiae
           YFL008W SMC1 Subunit of the multiprotein cohesin complex
           essential protein involved in chromosome segregation and
           in double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1243

 Score =  142 bits (359), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 232/888 (26%), Positives = 383/888 (43%), Gaps = 166/888 (18%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L LHNFKSY  T  VG   S F++++GPNGSGKSN++D++ FV G R+N++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 192 HK----------------------SEAHPN--------LDSCHVEVFFQYVQDELDGRTT 221
           ++                      SEA P           S +V   +Q  +D+LD  T 
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQ--KDDLDEPTK 124

Query: 222 VRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESI 281
                     TR    +  S Y +N +  SY +  E L  E I +  K FL+ QG+VE I
Sbjct: 125 F---------TRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERI 175

Query: 282 AQMKPKAEKEGDDGLLEYLEDIIGTAKYK----PLIEQTLVQIDQLND-------VCQEK 330
           A   P++       L   LE + G+  YK     L E+  + + +  D       V  + 
Sbjct: 176 ASQGPES-------LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDL 228

Query: 331 ENRYEIVERE---KSSLESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKI 387
           ++  E V+R+   ++SLE                   R K L   L  +  ++T  + K+
Sbjct: 229 KSFKEGVQRDEQYRTSLEIRDQLKHNFILWELFHILKRRKKLVDSLTVSKTETTALKNKL 288

Query: 388 KTLEEKLSAERAKYTEH-------KREIKQLESESKSLN-----------VTIRGIKDSE 429
              E  L+  ++   +H       K  + QLE+E  SL             TI+ I + E
Sbjct: 289 SDEERILTKIKSTTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRIHNLE 348

Query: 430 SSLTSEKRTCDRDRV---SLEEKLKNISQKKVKAEK---THHATVNSINATQAKLEELFK 483
             ++S K+  +R +      E +LK +S+ K   EK     HA +N  N ++  L+    
Sbjct: 349 KRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDLK---- 404

Query: 484 DQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRS 543
              QYE         LL EK  L      ++ K   +     E+ +E E  N +L+  R 
Sbjct: 405 ---QYE---------LLKEKY-LSSGGSHIEEKLAILKNDEFELNEESELINKRLKTTRE 451

Query: 544 QIKLE-ETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQA-IEGLEKEHTDIQRQI 601
           +I  E +  +  L+  L ++ + ++  +N I+  + K  +  Q  +E L+ +  ++   +
Sbjct: 452 RISDELQVDVDALEADLNEVTQRLN-DKNSIAAAKSKEWKGIQTNLESLKNKEYELNFSL 510

Query: 602 IIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGF 661
                + D+ +   +E      T ++R L         EN    +S L+RL       G 
Sbjct: 511 RDVLLKIDDLNADQRE------TKKERKLR--------EN----VSMLKRL-----YPGV 547

Query: 662 HGRLGDL-GTIDDKYDVAISTACPR-LDDVVVETVECGQQCIEHLRKNKLGYARFILLDK 719
            G + DL     +KY +A+ST   +  D ++V+++    +CI +L+K + G A FI LD 
Sbjct: 548 KGLVHDLCHPKKEKYAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLD- 606

Query: 720 LRSFNMNTIQTP-NNVSRLFDLVHPIDNK--FRNAFYSVLRDTLVAKDLKEANRVAYGKQ 776
             + ++N    P +NV      ++ I+ +     A   V  D+++  +L  A  + + + 
Sbjct: 607 --TIDVNPPSLPVSNVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRN 664

Query: 777 -RFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERN 835
            + ++VTL+G LI  +G M+GG   +       +    G     +   QI EELT     
Sbjct: 665 VKAKLVTLNGALIHKAGQMTGGTAQKNQNRWNKDEYQ-GLMVLKD---QITEELTALSDK 720

Query: 836 FKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLN 895
           F+              ++K R  E+E +IS    EI SL ++I   E   +    E K N
Sbjct: 721 FRA------------DNMKSR--ELENEISLLNNEISSLRTQITQLERTLSGKNVEIKHN 766

Query: 896 ESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKE----LQEQIMK 939
           E    T  E       LK+  + +E E+KSK  K++     LQEQI +
Sbjct: 767 EDLITTEYEP-----QLKSFTQRIE-ELKSKLTKLESEKDVLQEQIFR 808

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 106/169 (62%), Gaps = 14/169 (8%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            ++ KR + F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ + 
Sbjct: 1073 VKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYF 1132

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YI
Sbjct: 1133 ATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYI 1192

Query: 1351 KERTK-NAQFIVISLRNNMFELAQQLVGIYK----NRNMTKSVALENKD 1394
            K     NAQFIVISL+N MFE +Q LVGI++    N +   S+ LEN D
Sbjct: 1193 KRNANPNAQFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  141 bits (355), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 107/164 (65%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            ++KKR + F N F+ +S  L  +Y+ +T          GGNA L L D  +PF+ GV + 
Sbjct: 1062 IKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYH 1121

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1122 ATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1181

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
            +     N QFIVISL+N MFE +  LVG+++ +  N +K V L+
Sbjct: 1182 RRHGNPNLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTLD 1225

 Score =  119 bits (299), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 111/206 (53%), Gaps = 16/206 (7%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R++ +R   + DLI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 192 HK--------SEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKY 243
           ++        +  H  + S +V+ F++    +         +RP + + R    N  + Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAISTNGDTTY 125

Query: 244 YVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDI 303
            +NGK  +Y + +E L +E I +  K FL+ QG+VE IA   P         L +  E++
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 304 IGTAKYKPLIEQTLVQIDQLNDVCQE 329
            G+ +YK   ++   QI++LN    E
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAE 204

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  141 bits (355), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 97/331 (29%), Positives = 172/331 (51%), Gaps = 24/331 (7%)

Query: 1083 KQLESLKIRDVTATLQTLNKLLLSESRSGDELHG--QSSEARSQEPSNGDLMEVDTVEGC 1140
            KQL+SL+  + +  L  LN L        D+L    + +EA S++     L  ++ ++ C
Sbjct: 887  KQLDSLQ-DEASQNLAGLNALDEQIQEINDDLSASKRKNEALSEDLETNTLERLNVLKNC 945

Query: 1141 -MGN--EPTASQPEDQMDVDEPEEMETSPSDLPKLTEAQLKXXXXXXXXXXIG------- 1190
             M N   P  S   D++ +D+ +E   + ++   +  A L            G       
Sbjct: 946  KMQNIKLPEGSSSLDELPLDKVDEFTLNAANDVSINYAGLSKKLRQSGEEETGAGLKKSI 1005

Query: 1191 -QLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFM 1249
             +LN+ +     + +    Y    + +++   E  K   +   V ++   +++ R + F 
Sbjct: 1006 DELNELLTILQPNSKAAGRYEDAKLRYESIYKETEKCKAKEKKVNEDFTRIKRLRKEAFE 1065

Query: 1250 NGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRN 1300
              F+ +S ++ E+Y+ +T          GGNA L L D  +P+  G+ +   PP K +++
Sbjct: 1066 KAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYHATPPAKRFKD 1125

Query: 1301 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQF 1359
            +  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI+ +   + QF
Sbjct: 1126 MEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQF 1185

Query: 1360 IVISLRNNMFELAQQLVGIYKNRNMTKSVAL 1390
            IVISL+N MFE +Q LVG+++ +    S AL
Sbjct: 1186 IVISLKNTMFEKSQALVGVFRQQQNNTSKAL 1216

 Score =  108 bits (270), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 103/193 (53%), Gaps = 33/193 (17%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY G   +G   S+F++++GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 192 HK--------------SEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFK 237
           ++              SE HPN  S +V+ F+    +E D           + ++R   +
Sbjct: 67  YRGTLSEEEASSADFESENHPN--SAYVKAFYSPSNNEDD----------VVELSRTVTR 114

Query: 238 NNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLL 297
           +  S Y ++GK   Y + ++ L  E I +  + FL+ QG+VE +A  KP+        L 
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 298 EYLEDIIGTAKYK 310
           +  E + G+ +YK
Sbjct: 168 DLFEQVSGSLQYK 180

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/164 (42%), Positives = 108/164 (65%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1290
            ++K+R + F N F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
            +     + QFIVISL+N MFE +  LVG+Y+ +  N +K V L+
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTLD 1217

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 224/958 (23%), Positives = 413/958 (43%), Gaps = 179/958 (18%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L + NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 192 HK------SEAHP-NLDSCHVEVFFQYVQDELDGRTTVRQDRPG----LVVTRKAFKNNT 240
           ++        AH  N  S +V  F+            V+QD  G    +  TR       
Sbjct: 67  YRGRMEEGGSAHENNPKSAYVTAFY------------VKQDASGAERRMEFTRVIHNTGD 114

Query: 241 SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL 300
           S Y ++GK   Y +  ++L  E I +  + FL+ QG+VE IA       + G D L +  
Sbjct: 115 STYKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS------QSGVD-LTKLF 167

Query: 301 EDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRY--EIVEREKSSLE-SGXXXXXXXXXX 357
           E + G+ +Y+        + ++L D  ++    Y   +  R K  ++             
Sbjct: 168 EQVSGSVQYQR-------EYERLKDDYEKASAEYNESLKARRKMQIDLKSFKEGVQKEEQ 220

Query: 358 XXXXXXXRSKLLQH-KLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESK 416
                  R KL Q   LW           ++  L+ K S   A   + K ++ QL+    
Sbjct: 221 YISLLAERVKLQQQFMLW-----------QLFHLQSKRSGLVASLKDSKAKLSQLK---- 265

Query: 417 SLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQA 476
                 R + + E+ L   K    ++ + L  + + + QK+    + +   +   +A Q 
Sbjct: 266 ------RQLSNEEAILGKSKSLVAKEELLLARRRETLLQKQQDKARLNAQLLPVGSARQG 319

Query: 477 KLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLK--GKTGAISVQIGEIEQELE-- 532
               +    V  EK +D L + +  +++ + ++K  LK  GKT A        E ELE  
Sbjct: 320 TTRRM----VNIEKRIDSLQRDIERQESYVKQLKNQLKVVGKTKA------SFEAELEKS 369

Query: 533 ---PWNVKLQEKRSQIKLEET-----------KISVLKESLAKIAEEISKSENDISNNRK 578
               + +  ++K+   +L+E            K+++L+    +++EEI+  E  I  ++ 
Sbjct: 370 ASGKFTLSEEQKKEYEELKEVYLSSGGSEFEEKLAILQNKKEELSEEIAVFEKRIGISKT 429

Query: 579 KVAEQHQA-IEGLEKE--------------HTDIQRQIIIGQTECDNASNKMKEMKAVLT 623
           +     +  IE LE E              H++  R+    Q+E ++A+NK  E+   L 
Sbjct: 430 RAEHDLKVDIERLEVEVSERTGNLNDKNAIHSEKVREWKQIQSEIESANNKEYELSYKLR 489

Query: 624 THRQRSLDAKSSLSTFENKNKVL----SALQRLQRSGRISGFHGRLGDLGTI-DDKYDVA 678
               + LD  S+     NK + L    + L+RL       G  G + DL     +KY V 
Sbjct: 490 EVLAK-LDDLSANQRETNKERKLRENVATLRRL-----FPGVRGLVHDLCRPKKEKYAVG 543

Query: 679 ISTACPR-LDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRL 737
           +ST   +  D V+V+++   QQCI +L+K++ G A FI LD + + +  T+   +N   +
Sbjct: 544 VSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDT-SSPTLPAGDNTGCI 602

Query: 738 FDL-VHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSGTMS 795
             L     ++    A   V  D+++   L  A  + + +  + ++VTL+G LI  +G M+
Sbjct: 603 LTLDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLMT 662

Query: 796 GG----GNHRA---------------------------SGMMKSERLNTGASFTAEEVRQ 824
           GG      +R                            +G +KS       S  + E+  
Sbjct: 663 GGITKNNTNRWDKEEYQSLLLLKDKISTELSELTTGIRTGSIKSRDYENEVSLLSTEISS 722

Query: 825 IDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDR 884
           +  +L +  R+ K A   L+  +D ++  K+  P++++ + K   E+D  +++I   +D+
Sbjct: 723 LRSQLNQLNRSMKEALTELNYHDDLIE--KEYSPKVDS-LHKMVEEVDGQMADI--AKDK 777

Query: 885 A---ASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIG 941
           A   AS+ K+       D    E ++             G ++    ++++LQ+++M I 
Sbjct: 778 ANLQASVYKDFSKKIGFDIGEYEQHTG------------GRLRKHSRELQQLQKEVMNI- 824

Query: 942 GTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTN 999
             KL+ +        +R+  T+ +Q++ +  +KK + +L     Q   +  +++Q TN
Sbjct: 825 ENKLEFE-------TERLESTIKRQQKAREDLKKVQGELDSLTSQETDIQSNLEQVTN 875

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 105/161 (65%), Gaps = 10/161 (6%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            +++KR++ F+  FN +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVAL 1390
            +   +   QFIVISL++N+F  ++ + G+++N++   S+ +
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  138 bits (347), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 110/164 (67%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            ++KKR + F   F+ +S  ++ +Y+ +T          GGNA L L D  +PF  G+ + 
Sbjct: 1050 IKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYH 1109

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI
Sbjct: 1110 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYI 1169

Query: 1351 KERTK-NAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
            ++ +  + QFIVISL+N+MFE +  LVGI++ +  N ++ V L+
Sbjct: 1170 RKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVVTLD 1213

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 90/164 (54%), Gaps = 21/164 (12%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV GF+++ +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 192 HKSEAHPNLD--------SCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKY 243
           ++  A  + +        S +V+ F+     E DG  TV +    +   R       S Y
Sbjct: 67  YRDIASADENEFGEDGERSAYVKAFY-----EKDG--TVVELMRAITAGR------DSVY 113

Query: 244 YVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPK 287
            ++ K ++Y   ++ L  E I +  + FL+ QG+VE IA   P+
Sbjct: 114 KIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  138 bits (347), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 108/164 (65%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            +++KR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
             + R  + QFIVISL+N MFE +  LVG+Y+ +  N +K++ L+
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITLD 1224

 Score =  102 bits (255), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 104/217 (47%), Gaps = 39/217 (17%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 192 HKS-------------------EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVT 232
           ++                        N  S +V+ F+Q       G   V   R   +++
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLVELMR---IIS 117

Query: 233 RKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEG 292
           R    N  + Y ++GK  SY   +  L  E I +  K FL+ QG+VE IA   P      
Sbjct: 118 R----NGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE---- 169

Query: 293 DDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQE 329
              L +  E++ G+ +YK   ++   +I++L     E
Sbjct: 170 ---LSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATE 203

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
           Ashbya gossypii AGL023W
          Length = 1222

 Score =  137 bits (346), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 221/890 (24%), Positives = 381/890 (42%), Gaps = 156/890 (17%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY GT  VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 192 HKSEAHPNLD-------SCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYY 244
           ++       D       S +V+ F  Y++D+ +G    +     +   R       S Y 
Sbjct: 67  YRGRMDDRSDEHVASPKSAYVKAF--YLKDD-NGEQGTK-----IEFMRIIQNTGDSVYR 118

Query: 245 VNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDII 304
           ++GK  S+ +  E L  E I +  + FL+ QG+VE IA        +    L +  E + 
Sbjct: 119 IDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVS 171

Query: 305 GTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLE---SGXXXXXXXXXXXXXX 361
           G+ +Y+        + ++L +  Q+    Y    + K  ++                   
Sbjct: 172 GSVQYQR-------EYERLKEEYQKATEEYGDSLKSKRKMQIDLKSFKEGVHKEQHYKNL 224

Query: 362 XXXRSKL-LQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNV 420
              R+KL  Q+ LW           ++  LE++ S   +   + K ++ QL+S+      
Sbjct: 225 LSERTKLNRQYVLW-----------QLYHLEDRRSGLISSLKDSKSKLAQLKSK------ 267

Query: 421 TIRGIKDSESSLTSEKRTCDRDRVSL---EEKLKNISQKKVK-------AEKTHHATVNS 470
               + + E  L   K    +D + +   +EKL  + Q++ K          +  +    
Sbjct: 268 ----LTNEEHILHKSKSQAAKDEIVITRKKEKLSQLQQERSKLNSELLPVGSSRQSASKR 323

Query: 471 INATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLK----GKTGAISVQIGE 526
           IN  + +++ L +D  + E  + +    L V     D ++I +K    GK      Q+ E
Sbjct: 324 INHIEKRIDSLKRDITRQESYVQQFQNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKE 383

Query: 527 IEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEN--DISNNRKKVAEQH 584
            E   E +   L    S +   E K+++L+    ++ EEIS  E   +IS +R  V E +
Sbjct: 384 YESLKETY---LCSGGSAL---EEKMTLLQNKREELLEEISLYERRANISKSRISV-ELN 436

Query: 585 QAIEGLEKEHTDIQRQIIIG--------------QTECDNASNKMKE----MKAVLTTHR 626
              E LE E +++ R +                 Q+  ++A+NK  E    +K VL    
Sbjct: 437 VEREKLELELSEVTRVLNSKNALHSAKVKEWKEVQSAIESANNKEYELNYKLKEVLVKLD 496

Query: 627 QRSLDAKSSLSTFENKNKVL----SALQRLQRSGRISGFHGRLGDLGTI-DDKYDVAIST 681
             + D + S     NK + L    + L+RL       G  G + DL     DKY +A+S+
Sbjct: 497 DLTADQRES-----NKERKLRENVATLKRL-----FPGVKGLVHDLCRPKKDKYALAVSS 546

Query: 682 ACPR-LDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTP-NNVSRLFD 739
              +  D +VV++V   QQCI +L+K++ G A FI LD   + ++NT   P  N+     
Sbjct: 547 MLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLD---TIDINTPTLPVRNLKGCIL 603

Query: 740 LVHPI--DNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSGTMSG 796
            V+ I  D++   A   V  D+++   L  A  + + +  + ++VT+ G LI  +G M+G
Sbjct: 604 TVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTG 663

Query: 797 G-GNHRASGMMKSERLNTGASFTAEEVR-QIDEELTERERNFKIATDTLHEMEDALQSLK 854
           G G +  +   K+E          E+V  QI E +T   +N  ++       E+ L  L 
Sbjct: 664 GVGRNNTNRWDKAEY--QSLLLLKEKVSGQISELVTSIRQNSVLSRG----FENELSLLN 717

Query: 855 DREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKA 914
                + T +    ++I+ L+ E K                       +E N   D + +
Sbjct: 718 SELVTLRTQL----VQINRLIEEKK-----------------------VEINYHEDLINS 750

Query: 915 ECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLG 964
           E      ++ +  N +KEL EQ+  I   K  LQGS+      ++  T+ 
Sbjct: 751 E---YSPKISALNNSMKELDEQLSNISKNKETLQGSIYKDFANKVGFTIA 797

 Score =  130 bits (326), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 104/161 (64%), Gaps = 10/161 (6%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            +++KR+  F++ F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYH 1110

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVAL 1390
            K   +   QFIVISL++N+F  +Q + G+++N+    S+ +
Sbjct: 1171 KRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  137 bits (345), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 107/164 (65%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            ++KKR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1056 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1115

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1116 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1175

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
             + R  + QFIVISL+N MFE +  LVG+Y+ +  N +K + L+
Sbjct: 1176 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITLD 1219

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 112/172 (65%), Gaps = 14/172 (8%)

Query: 1239 NLRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLF 1289
            N++KKR + F   F  ++  +  +Y+ +T          GGNA L L D  +P++ GV +
Sbjct: 1051 NIKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKY 1110

Query: 1290 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1349
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A Y
Sbjct: 1111 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATY 1170

Query: 1350 IKERTKNA--QFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALENKDLIN 1397
            I +R  N   QFIVISL+N+MFE ++ LVGIY+++  N ++ + L   + +N
Sbjct: 1171 I-QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLTNYVN 1221

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/163 (35%), Positives = 87/163 (53%), Gaps = 27/163 (16%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 192 HKS------------EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNN 239
           ++             + +PN  S +V+ F+Q        +  V  +     + R    + 
Sbjct: 67  YRGFLSGDDEDNNNEDVNPN--SAYVKAFYQ--------KEDVTHE-----LMRSISNSG 111

Query: 240 TSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIA 282
            S Y +N K  SY Q T  L  E I +  K FL+ QG+VE IA
Sbjct: 112 DSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 106/357 (29%), Positives = 183/357 (51%), Gaps = 38/357 (10%)

Query: 1064 LEKLNDLLNHIGKDGHDLL-KQLE----SLKIRDVTATLQTLNKLLLSESRSGDELHGQS 1118
            L+ +N L + I KD  +L+ KQ+E    SL    +  T+  ++  +    R  +EL    
Sbjct: 875  LDDINKLEDCIAKDNEELVQKQIELDKKSLTTNSLEETIVEISNSMQMTKREYEEL---- 930

Query: 1119 SEARSQEPSNGDLMEVDTVEGCMGNE---PTASQ-----PEDQMDVDEPEEMETSPSDLP 1170
                 ++     L  V+T++ C       P  S      P D+MD    E   +   D  
Sbjct: 931  ----KEDIEKLTLERVNTLKNCKITNIDLPVRSSSLEDLPMDKMDSATIEIANSIDIDYT 986

Query: 1171 KLTEAQLKXXXXXXXXXXIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVE-- 1228
            KLT A+ K            +    +E+A  +++   +  +R  + Q R   +N   E  
Sbjct: 987  KLT-AKYKESNGDLVRQDFQESLKKIEHALLELQPNSKAVERYEETQMRYDVINGETESL 1045

Query: 1229 --QRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELV 1277
              +   +R+    +++ R + F   +N +S  + ++Y+ +T          GG+A L L 
Sbjct: 1046 KAKEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLE 1105

Query: 1278 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1337
            D  +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAA
Sbjct: 1106 DEDEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAA 1165

Query: 1338 LDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
            LD  NV  +A YIK   + N QFIVISL+N+MFE +Q LVG+++ +  N +K + L+
Sbjct: 1166 LDNTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVITLD 1222

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 98/195 (50%), Gaps = 34/195 (17%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L NFKSY GT  VG   ++F++++GPNGSGKSN++D++ FV G R++ +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 192 HKSE----------------AHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKA 235
           ++                     +  S +V+ F+    +E             +   R  
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEE-----------SPIEFMRTI 115

Query: 236 FKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDG 295
            ++  S Y VNGK   Y   T++L KE I +  + FL+ QG+VE IA     ++  G+  
Sbjct: 116 SRSGESAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA-----SQSAGE-- 168

Query: 296 LLEYLEDIIGTAKYK 310
           L +  E I G+ +YK
Sbjct: 169 LTKLFEQISGSVQYK 183

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/164 (40%), Positives = 107/164 (65%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            +++KR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1059 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1118

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1119 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1178

Query: 1351 -KERTKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
             + R  + QFIVISL+N MFE +  LVG+Y+ +  N +K + L+
Sbjct: 1179 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITLD 1222

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 37/215 (17%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 192 HKS-----------------EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRK 234
           ++                   A  N  S +V+ F+Q       G   V   R   +++R 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQ------KGNKMVELMR---IISR- 116

Query: 235 AFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDD 294
              N  + Y ++ K  SY   +  L  E I +  K FL+ QG+VE IA   P        
Sbjct: 117 ---NGDTSYKIDEKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE------ 167

Query: 295 GLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQE 329
            L    E++ G+ +YK   ++   +I++L+    E
Sbjct: 168 -LSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATE 201

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  134 bits (338), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 108/163 (66%), Gaps = 12/163 (7%)

Query: 1241 RKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSV 1291
            +KKR + F   F+ +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1058 KKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHA 1117

Query: 1292 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1351
             PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI+
Sbjct: 1118 TPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIR 1177

Query: 1352 ER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
            +    + QFIVISL+N+MFE +  LVG+Y+ +  N ++ V L+
Sbjct: 1178 KHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSRLVTLD 1220

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 108/213 (50%), Gaps = 37/213 (17%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R++ +R   ++DLI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 192 HKS---------------EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAF 236
           ++                +AH      +V  F+     E    +TV        + R   
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAH----RAYVSAFYSKGPQE----STVE-------LKRTIS 111

Query: 237 KNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGL 296
           KN  S Y ++ ++ +Y Q +E L  + I +  K FL+ QG+VE +A   P         L
Sbjct: 112 KNGDSTYQIDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------L 164

Query: 297 LEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQE 329
            +  E++ G+A+YK   +    Q++QL+    E
Sbjct: 165 TKLFEEVSGSAQYKKEYDLLKDQLEQLSHSATE 197

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/162 (40%), Positives = 107/162 (66%), Gaps = 10/162 (6%)

Query: 1239 NLRKKRLDEFMNGFNTISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLF 1289
            N++KKR + F + F+ ++  ++ +Y+ +T          GG A L L D  +PF+ GV +
Sbjct: 1062 NIKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKY 1121

Query: 1290 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1349
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1122 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAY 1181

Query: 1350 IKER-TKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVAL 1390
            I++   K+ QFI+ISL+N MFE +  LVG+++ +    S AL
Sbjct: 1182 IRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKAL 1223

 Score =  107 bits (267), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 116/208 (55%), Gaps = 27/208 (12%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L NFKSY GT  +G   S+F++++GPNGSGKSN++D++ FV G R+N +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 192 HKS-----EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
           H+S      ++ +  S +V+ F++ V D  +    +R      +V         + Y +N
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYK-VTDASEITELMR------IVNLSG----ETIYKIN 115

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
           GK +S+   ++ L KE I +  K FL+ QG+VE+IA        +    L +  E + G+
Sbjct: 116 GKTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGS 168

Query: 307 AKYKP---LIEQTLVQIDQL-NDVCQEK 330
            +YK    L+++ L +I++L ND  + +
Sbjct: 169 IQYKKEYDLLKEDLNKINRLTNDAIKNR 196

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 104/164 (63%), Gaps = 12/164 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1290
            +++KR + F N F  I+  L  +Y  +T          GG+A + + D  +PF+ G+ + 
Sbjct: 1054 VKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYH 1113

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI
Sbjct: 1114 ATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYI 1173

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALE 1391
            +     + QFIVISL+N MFE +  LVG+++ +  N +K V L+
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTLD 1217

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 109/209 (52%), Gaps = 35/209 (16%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY GT  V    S+F++++GPNGSGKSN++D++ FV G R++ +R   L DLI
Sbjct: 7   LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 192 HKS----EAHPNLD--------SCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNN 239
           ++     E  P           + +V+ F++Y     DG+         + + R   +  
Sbjct: 67  YRDIISRENTPTGADNDENGNRTAYVKAFYEY-----DGKV--------VELMRLISRLG 113

Query: 240 TSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEY 299
            + Y ++G   +Y + ++ L  + I +  K FL+ QG+VE IA   P        GL + 
Sbjct: 114 DTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKL 166

Query: 300 LEDIIGTAKYKPLIEQTLVQIDQLNDVCQ 328
           +E++ G+ +YK   E+     DQ + +CQ
Sbjct: 167 IEEVSGSMQYKKEYEELK---DQYDKICQ 192

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/170 (38%), Positives = 105/170 (61%), Gaps = 12/170 (7%)

Query: 1240 LRKKRLDEFMNGFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1290
            +++KR   F   F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1291 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1351 KER-TKNAQFIVISLRNNMFELAQQLVGIYKNR--NMTKSVALENKDLIN 1397
            +     + QFIVISL+N MFE +  LVG+Y+ +  N +K V L  ++  N
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTLNLRNYAN 1222

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  129 bits (324), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 123/212 (58%), Gaps = 18/212 (8%)

Query: 1192 LNDFVENAYADIEVLEEYTK-RLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMN 1250
            LND   NA A+    E   K   +D++  +L   K+ E+R  V      ++KKR   F  
Sbjct: 1004 LNDLQPNAKANERFSEAQNKFEAIDYETEEL---KSEEKR--VIAQFLKIKKKRKALFER 1058

Query: 1251 GFNTISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNI 1301
             F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++
Sbjct: 1059 AFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYHATPPFKRFKDM 1118

Query: 1302 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFI 1360
              LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI +   ++ QFI
Sbjct: 1119 EYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYISRHGNRDLQFI 1178

Query: 1361 VISLRNNMFELAQQLVGIYKNR--NMTKSVAL 1390
            VISL+N MFE +  LVG+Y+ +  N +K V L
Sbjct: 1179 VISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 105/204 (51%), Gaps = 26/204 (12%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L+NFKSY GT  VG   S+F +++GPNGSGKSN++D++ FV G +++ +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 192 HKS------EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYV 245
           ++       E      + +V+ F+      L   +TV        ++R   +N  ++Y +
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFY------LKSDSTVE-------LSRSISRNGDTQYKM 113

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NGK   Y Q  E L +E I +  + FL+ QG+V  IA        +    L +  E+I G
Sbjct: 114 NGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLFEEISG 166

Query: 306 TAKYKPLIEQTLVQIDQLNDVCQE 329
           + +YK   +    ++D LN    E
Sbjct: 167 SIQYKKEYDSLKGKVDSLNQSAAE 190

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  117 bits (294), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 178/721 (24%), Positives = 309/721 (42%), Gaps = 89/721 (12%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNG 247
            DLI+K      +    V + F    D+L+       + P + VTR+     TSKY +NG
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNNT-DKLNSPIGF-TNSPQISVTRQVVLGGTSKYLING 119

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 308 KYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSK 367
            ++   E+    + +     Q  E+R  + E  +  LE                   ++ 
Sbjct: 173 MFEDRREKAERTMSKKETKLQ--ESRTLLTEEIEPKLEK----LRNEKRMFLEFQSTQTD 226

Query: 368 LLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIK- 426
           L + +    S+   N + K  ++ E L    A   +    I++   E +SLN  IR IK 
Sbjct: 227 LEKTERIVASYDYYNIKHKHTSIRETLENGEAHMKKLNDFIRKTSEEIESLNEDIREIKH 286

Query: 427 DSESSLTSEKRT-------------CDRDRVSLEEKLKNI--SQKKVKAEKTHHATVNSI 471
             E  L  E R                R + SL  K++N+  +  K+KA ++  A+ ++ 
Sbjct: 287 QKEKELHKEGRIFKLEAQENGLLNEISRSKTSLSIKMENLNDTNGKLKAVESEIASASA- 345

Query: 472 NATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIK-----ISLKGKT-GAISVQIG 525
                K  E  K +  Y+    +L+K   + K K + +      IS  G   G  + Q+ 
Sbjct: 346 -KLNEKKTEYIKTEEDYKTAQGQLSKQRDLYKRKEELVSTLTTGISSTGAADGGYNAQLI 404

Query: 526 EIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQ 585
           + + EL   ++ L  K+S +K+E     +LK+ L  I  ++  +  D   N K V +  +
Sbjct: 405 KAKTELN--DISLAIKKSNMKME-----LLKKELLAIEPKLKNATMDNELNIKHVKDCQE 457

Query: 586 AIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFENKNKV 645
               L       Q Q+    TE     +++K++K       QR  + KS      N ++ 
Sbjct: 458 VCNRL-------QAQL----TEYGFDPSRIKDLK-------QRENELKSRYYQISNDSEY 499

Query: 646 LS---ALQRLQRSGRISGF-----HGRLGDLGTIDD---KYDVAIST-ACPRLDDVVVET 693
           L    A      +     F     HG +G L  +D    +Y  A+ T A  RL +VVV+ 
Sbjct: 500 LKRRVANLEFNYTTPYPDFKANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQD 559

Query: 694 VECGQQCIEHLRKNKLGYARFILLDKL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDN 746
            +   Q +E  R  K      I LDK+  R+ N   ++      P  V    +L+   D 
Sbjct: 560 SQTATQLLERGRLRK--RVTIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIK-FDK 616

Query: 747 KFRNAFYSVLRDTLVAKDLKEANRVAY-GKQRFRVVTLDGKLIDLSGTMSGGGNHRASGM 805
               A   +  ++L+ +D + A ++ +  K R R +TL G + D  GT+SGG  + +  +
Sbjct: 617 TVTKAMEFIFGNSLICEDPETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSL 676

Query: 806 M 806
           +
Sbjct: 677 L 677

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
           also required with Rec8p for cohesion and recombination
           during meiosis phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1229

 Score =  107 bits (268), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 183/805 (22%), Positives = 342/805 (42%), Gaps = 88/805 (10%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+++  FK+Y  T ++  F    + V+G NGSGKSN   ++ FV     N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGR---TTVRQDRPGLVVTRKAFKNNTSKY 243
              LIH+     ++ S +VE+ F    D  DGR          P  VV R+       +Y
Sbjct: 61  RQGLIHQGSG--SVMSAYVEIVF----DNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 244 YVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDI 303
            +N K  S  ++  LL   G    +  +++ QG + ++   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 304 IGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXX 363
            G   ++  +  +L ++D  N       NR +I    +   E                  
Sbjct: 168 TGANSFEKKLRDSLNKMDATN------RNRKKIDSELRELDEKLQELNEEREELEKYNAL 221

Query: 364 XRS-KLLQHKLWKNSFKS-TNTQEKIKTLEEKLSAERAKYTEH--KREIKQLESESKSL- 418
            R  K+ Q  L+       TN  EK+ +          +Y +   KRE+  + + +K+L 
Sbjct: 222 ERDRKVFQFTLYDRELNDVTNHIEKLDSEYNNTVDSSEQYVQEMDKREV-LISNVTKNLV 280

Query: 419 ----NVTIRGIKDSESS----LTSEKRTCDRDRVSLEEKLKNI--SQKKVKAEKTHHATV 468
                + I+   D E S    L  E++  D D V  EE  + I  + ++ K ++++ A+V
Sbjct: 281 NIDAELKIKKSTDLEQSKANQLDVEEKKADLD-VKCEELQRQIRSTSEQAKTDESNLASV 339

Query: 469 --------NSINATQAKLEELFKDQVQYEKELDEL---NKSLLVEKTKLDEIKISLKGKT 517
                     I     + EEL +++ Q++ +L+ L    + LL ++ +  + K   + + 
Sbjct: 340 LNDISRKETQIKRISPRFEELTREEHQFKTDLELLQQKQRDLLAKRGRYAQFKTQ-EERN 398

Query: 518 GAISVQIGEIEQE---LEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDIS 574
           G I  +I +++QE   LE    +L ++RS           L+E LA++ E+ +K  ND  
Sbjct: 399 GWIQSEIADLKQEAQILESTYQELSQERSD----------LQEQLAELDEQ-AKELNDSI 447

Query: 575 NNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTT------HRQR 628
                 AE    +E L  E + +++       E        ++++ +L T        +R
Sbjct: 448 QGPGITAE----LEDLNSEISQLKQLYTTKIDERKELWRSEQKLQTILETLMDDVKRSER 503

Query: 629 SLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPR-LD 687
           S++     S       V    +RL+     +  +G LG+L  +++KY     T     L 
Sbjct: 504 SVNETMDRSLANGLKAVREISERLKLPE--NAVYGPLGELIKVNEKYKTCAETVGGNSLF 561

Query: 688 DVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPI--D 745
            VVV+T +     ++ L   K G   F+ L++L + N N     N  S    L+  I  D
Sbjct: 562 HVVVDTEDTAGLLMQELYNVKGGRVTFMPLNRLHADN-NVTYPSNEQSNCTALIKKIKYD 620

Query: 746 NKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGG--GNHRAS 803
            KF  A   V   T+V +DL    ++A  + +   +TLDG   D  G ++GG   +H+ +
Sbjct: 621 EKFERAVKHVFGKTIVVRDLTLGTKLAR-QYKLNAITLDGDRADKRGVLTGGYHDHHKKT 679

Query: 804 GMMKSERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETD 863
            +   + L    +    E   + ++L   ++   +  D + ++ + ++    ++  I  D
Sbjct: 680 RLDSLKDLKHAKT----EYSTVSQKLNSLKKQLHVVDDEVDQLNNKIKQATTKKESIMVD 735

Query: 864 ISKRRMEIDSLLSEIKLCEDRAASL 888
           I   R  +++  +EI L ED   S+
Sbjct: 736 IEGLRSRLNNRKNEIYLREDSMNSI 760

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 59/98 (60%)

Query: 1300 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1359
            ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQF
Sbjct: 1119 HVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQF 1178

Query: 1360 IVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            I  + R++M  +A     +     ++    +  +D IN
Sbjct: 1179 ICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAIN 1216

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score =  105 bits (261), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 106/217 (48%), Gaps = 41/217 (18%)

Query: 132 LSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLI 191
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R+N +R   L DLI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 192 HKS-------------------EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVT 232
           ++                     ++PN  S +V+ F+Q       G   V        +T
Sbjct: 103 YRGVLDDGNDENIDSGADDNAITSNPN--SAYVKAFYQ------KGNKLVE-------LT 147

Query: 233 RKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEG 292
           R   +N  + Y ++GK  +Y   +  L  E I +  K FL+ QG+VE IA   P      
Sbjct: 148 RLISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT----- 202

Query: 293 DDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQE 329
              L    E++ G+ +YK   ++   +I++L+    E
Sbjct: 203 --DLSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATE 237

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 162/707 (22%), Positives = 296/707 (41%), Gaps = 85/707 (12%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNG 247
            DLI+K      +    V + F     +        +    + +TR+      SKY +NG
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFN--NSDTSNSPIGFESHAKISITRQIILGGVSKYLING 119

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
             +    V +L +   +++++  FLI+QG++  +  MKP+        +L  +E+  GT 
Sbjct: 120 HRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGTR 172

Query: 308 KY---KPLIEQTLVQID-QLNDV----CQEKENRYEIVEREKSSLESGXXXXXXXXXXXX 359
            +   +   E+T+ + + +L ++     +E E + E    EK +                
Sbjct: 173 MFEDRREKAERTMAKKETKLQEIRTLLTEEIEPKLERFRNEKRTY--------------L 218

Query: 360 XXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLN 419
                +S L       N+F+ +    K K +EE L + +++  E +  I +L++E ++L 
Sbjct: 219 EFQETQSDLENVMRVVNAFEFSQLSNKKKHIEESLHSGQSRLEELEDTISRLKNEVENLG 278

Query: 420 VTIRGIKDSESSLTSEKRTCDRDRVS-LEEKLKNISQKKVKAEKTHHATVNSINATQAKL 478
             +  +K+        K      R+S LE K   IS +  + + + +  +      + ++
Sbjct: 279 SDLDALKEQR-----HKEVQLGGRMSELETKESEISNELSRVQTSLNIALEDSGEEKVRI 333

Query: 479 EEL------FKDQVQYEKEL-DELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQ-- 529
             L      +K Q Q +K L D   K   ++  KL+E+K   K K   +S     I    
Sbjct: 334 SNLKKNIERWKQQHQEKKTLYDSKYKEYNIQNKKLEELKAIHKEKQELLSTLTTGISSTG 393

Query: 530 --------ELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVA 581
                   +L     KLQ  R +I+ +E ++ +LKE L     +IS ++ +     K++ 
Sbjct: 394 TTANGYNFQLSTIKEKLQNTRIEIREKEMEVEMLKEELNSNTPKISAAKAEKEKYDKEIQ 453

Query: 582 EQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDAKSSLSTFEN 641
                   LEK+        I+ +   DN        +++  TH Q S + +S      N
Sbjct: 454 NMQHHCNNLEKQLEQYGYDPILLKNLKDNE-------RSLKHTHYQLSQETESLHRKVSN 506

Query: 642 K--NKVLSALQRLQRSGRISGFHGRLGDLGTID----DKYDVAISTACPRLDDVVVETVE 695
              N V  +     ++  +S   G +G L T+D    D        A  RL +VVV+   
Sbjct: 507 LDFNYVPPS-----KNFDVSSVKGVVGQLFTLDEANIDSSAALQVCAGGRLFNVVVDNER 561

Query: 696 CGQQCIEHLRKNKLGYARFILLDKL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKF 748
              Q +EH R  K      I L+K+  R  N + +       P  V    +L+   + + 
Sbjct: 562 TASQLLEHGRLRK--RVTIIPLNKISSRRINESILHLAKELAPGKVELAINLI-GFEEEV 618

Query: 749 RNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSGTM 794
             A   +   + + +D + A ++ +  + R R +TL G + D  GT+
Sbjct: 619 TRAMEFIFGTSFICRDAETAKQITFNPRIRSRSITLQGDVYDPEGTL 665

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 85/146 (58%), Gaps = 2/146 (1%)

Query: 1225 KAVEQ-RDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPF 1283
            K +E+ +  +++  + L + + +  +  +  +S+    ++  +     A+LE  +  D  
Sbjct: 1005 KTIEKDKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-V 1063

Query: 1284 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            +EG+   V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEVKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHT 1123

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMF 1369
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/184 (30%), Positives = 91/184 (49%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   T     + P + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSNTPIGFSEYPKISVTRQIVLGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  I  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 39.3 bits (90), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 71/298 (23%), Positives = 127/298 (42%), Gaps = 43/298 (14%)

Query: 658 ISGFHGRLGDLGTIDDKYDVAIS-TACPRLDDVVVETVECGQQCIEHLRKNKLGYARFIL 716
           + G    L  +   + KY + +   A  RL +V+V+  + G   ++  R  K      I 
Sbjct: 523 VKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIP 580

Query: 717 LDKL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEAN 769
           LDK+  R  N N ++      P  V    +L+   D   + A   +  ++L+  D + A 
Sbjct: 581 LDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEVVK-AMEFIFGNSLICDDAETAK 639

Query: 770 RVAYGKQ-RFRVVTLDGKLIDLSGTMSGGG-NHRASGMMKSERLNTGASFTAEEVRQIDE 827
           ++ +    R R +TL+G + D  GT+SGG  N+  + ++  ++ NT      +E+  ++E
Sbjct: 640 KITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQYNT----LKKELLAMNE 695

Query: 828 ELTERERNFKIATDTLHEME-------------DALQSLKDREPEIETDISKRRMEIDSL 874
           E     +  KI     +E               D L+   + EP +   +  R  EI++ 
Sbjct: 696 EKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDILERTMNSEPSLM--MQNRNGEIEN- 752

Query: 875 LSEIKLCEDRA-------ASLKKE-QKLNESSDDTLIEANSRLDSLKAECKLLEGEMK 924
             E+K  ED         +SL+ E +KL +   D      ++L  LKAE   L  ++K
Sbjct: 753 --EVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKAEVHELNEQIK 808

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074c SMC3 required for structural maintenance of
           chromosomes
          Length = 1219

 Score = 95.5 bits (236), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 173/724 (23%), Positives = 318/724 (43%), Gaps = 102/724 (14%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++G F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD-RPGLVVTRKAFKNNTSKYYV 245
              LIH+  A  ++ S  VE+ F   +  +   T +  +     V  R+        Y V
Sbjct: 61  RQGLIHQG-AGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           N +  +   +  +L   G  + +   ++ QG + S+   K K         L+ LE+++G
Sbjct: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172

Query: 306 TAKYKPLIEQTLVQID-------QLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXX 358
              ++  ++ ++ Q+D       Q++   +E E++   +E+E+  LE             
Sbjct: 173 AKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEK------------ 220

Query: 359 XXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLE----EKLSAERAKYTE-HKRE--IKQL 411
                   K+L++ L     +   +Q  I++L+    + L + +    E  KRE  IK++
Sbjct: 221 YNSLERDRKVLRYTLHDRELQDIISQ--IESLDGDYNDTLGSSKKYILELEKRENMIKEV 278

Query: 412 ESESKSL--NVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHH---- 465
             E K+L  ++ ++   D E +    + + +R   +++ +LK+I + K+K  K  H    
Sbjct: 279 NEEIKNLQKSLKLKATVDLEQAKAILEESLERSE-AIKLQLKDIKE-KIKQNKEQHDNDR 336

Query: 466 -------ATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTG 518
                    ++S  + + K+   F DQ+Q E++L + +    +EK     +K   KG   
Sbjct: 337 KNLKLITEIIDSKKSKRRKISPRF-DQLQSEEKLIKHHLKECIEKQNNFLLK---KGSYA 392

Query: 519 AISVQIGEIEQELEPW-NVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDI---- 573
               +     +E + W N K++E    I   +   + LKE  + I  +I++SEN+I    
Sbjct: 393 RFKSK-----EERDEWINSKIKELSESINTMKASTTELKEQKSSIDVKINESENNIEELE 447

Query: 574 -SNNRKKVAEQHQAIEGLEKEHTDIQRQIIIG--------------QTECDNASNKMKEM 618
            S N   +  +   IE +EKE  +++R+                  Q   D+  N++KE 
Sbjct: 448 DSLNGPGIKAE---IEDIEKELINLRRKYTANIDARKEKWREEQKLQMISDSLVNEVKEN 504

Query: 619 KAVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVA 678
           +  L     RSL      + F+N  ++   L      G  S F G +G+L  +++KY V 
Sbjct: 505 ERSLNETMSRSL-----ANGFKNVKEICERLNL----GTESVF-GTVGELIQVNEKYKVC 554

Query: 679 IST-ACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVS-R 736
                   L  VVV+T E     +  L + K G   F+ L+KL++ N N I  P++ +  
Sbjct: 555 AEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNGNQN-IDYPSDPNIP 613

Query: 737 LFDLVHPI--DNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSGT 793
              L+  I  D +F      V    LV KDL   N ++  KQ +   +TLDG  +D  G 
Sbjct: 614 CTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYKLSCITLDGDRVDGKGV 671

Query: 794 MSGG 797
           ++GG
Sbjct: 672 LTGG 675

 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 98/202 (48%), Gaps = 28/202 (13%)

Query: 1205 VLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNL----RKKRLDEFMNGFNTISMTLK 1260
              E Y K    F  ++ EL +   + D  +Q+  +L    ++++L+     F+ +S    
Sbjct: 997  AFENYKK----FNEKQSELRERATELDDSKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFV 1052

Query: 1261 EMYQMITMGGNAELELV--------DSLDPFS---------EGVLFSVMPPKKS--WRNI 1301
             +++ I   G A L +         D+ + F+         EGV  SV    K      +
Sbjct: 1053 MIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNEHTTPYEGVSISVSFNSKQDEQLKV 1112

Query: 1302 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1361
              LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD +    VA  I + + NAQFI 
Sbjct: 1113 EQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFIC 1172

Query: 1362 ISLRNNMFELAQQLVGI-YKNR 1382
             + R++M + A +   + Y+N+
Sbjct: 1173 TTFRSDMVDAANKFYRVKYENK 1194

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 89/182 (48%), Gaps = 11/182 (6%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNG 247
            DLI+K      +    V + F    D+        +  P + VTR+     TSKY +NG
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF--TNDDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 308 KY 309
            +
Sbjct: 173 MF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 60/86 (69%), Gaps = 4/86 (4%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKNR 1382
            +QFIV+SL+  MF  A +   ++K R
Sbjct: 1137 SQFIVVSLKEGMFTNANR---VFKTR 1159

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 91/184 (49%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN-KMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D  ++    +  P + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TRMF 174

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 91/369 (24%), Positives = 156/369 (42%), Gaps = 50/369 (13%)

Query: 682  ACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL--RSFNMNTIQ-----TPNNV 734
            A  RL +VVV+      Q +E  R  K      I L+K+  R+ N N ++      P NV
Sbjct: 548  AGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNV 605

Query: 735  SRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSGT 793
                +L+   D   R A   +   +L+ KD + A RV +  Q R R +TLDG + D  GT
Sbjct: 606  ELALNLIGYEDEVSR-AMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGT 664

Query: 794  MSGGG-NHRASGMMKSERLNTGASFTAE---EVRQIDEELTERERNFKIATDTLHEMEDA 849
            +SGG  N + S ++  +  N  +    E   E++QI+ ++ E E+  +      +E+  A
Sbjct: 665  LSGGSRNTKNSLLIDIQTFNAASKRLNEMELELKQINSKIAEYEQTSQKTKSLQNELNLA 724

Query: 850  LQSL----KDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEA 905
               L    K       T I +R  EI     EI  C    A + ++  L+E  +  +I+ 
Sbjct: 725  THKLSLAKKSLAANSATQIIRRNNEIS---DEISSC---TAEINRQTLLSEEFEQEIIKI 778

Query: 906  NSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLV------------- 952
               ++             + K +K++EL+E+I  +   K++ Q + +             
Sbjct: 779  QKDMEEFN----------QDKGSKLRELKEEITNL-SKKIEEQDAFIEKKFDLYQNLQLE 827

Query: 953  -DSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSVDIDQCTNXXXXXXXXXXXX 1011
             D +   IS + G  +  + A+K+ EN     E        +++Q  N            
Sbjct: 828  KDQLTSDISASKGSIEDLEQAIKELENTRNSIEDDLSLRQTELNQIQNDLNEEKTRLLDI 887

Query: 1012 DNKILELEA 1020
            D++I ELE+
Sbjct: 888  DDEIRELES 896

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 93.6 bits (231), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 91/184 (49%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   +     + P + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   +     + P + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFANSPQISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   +     + P + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 120/266 (45%), Gaps = 34/266 (12%)

Query: 659 SGFHGRLGDLGTIDD---KYDVAIST-ACPRLDDVVVETVECGQQCIEHLRKNKLGYARF 714
           S  HG +G L  ID+   +Y  A+ T A  RL +VVV+  +   Q +E  R  K      
Sbjct: 521 SFVHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTI 578

Query: 715 ILLDKLRS-------FNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKE 767
           I LDK+ +        ++     P  V    +L+   D     A   +  ++L+ +D + 
Sbjct: 579 IPLDKIYTRPISSQVLDLAKKIAPGKVELAINLIR-FDESITKAMEFIFGNSLICEDPET 637

Query: 768 ANRVAY-GKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMM----KSERLNTGASFTAEEV 822
           A ++ +  K R R +TL G + D  GT+SGG  + +  ++    K  ++         ++
Sbjct: 638 AKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADL 697

Query: 823 RQIDEELTER----ERNFKIATD---TLHEMEDALQSLK--------DREPEIETDISKR 867
             + EEL  +    ++   I +D   +LH+++ A ++L          R  EI  DI + 
Sbjct: 698 NHVTEELQTQYATSQKTKTIQSDLNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGEC 757

Query: 868 RMEIDSLLSEIKLCEDRAASLKKEQK 893
             EI +    +K C++  ++++K+ K
Sbjct: 758 ENEIKTKQMSLKKCQEEVSTIEKDMK 783

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 91/184 (49%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   +     +   + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGITKASVTIVF----DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 12/122 (9%)

Query: 682 ACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL--RSFNMNTIQT------PNN 733
           A  RL +VVV+  +     +E  R  K      I L+K+  R+ N  +  T      P  
Sbjct: 548 AGGRLYNVVVDNEKTASSLLERGRLRK--RVTIIPLNKISARTLNERSCTTKRKKLAPGK 605

Query: 734 VSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLSG 792
           V    +L+   D++  NA   +   +L+ +D   A +V +  Q R R +TL+G + D  G
Sbjct: 606 VELALNLI-GYDDEVSNAMEFIFGGSLICQDADTAKKVTFHPQIRTRSITLEGDVYDPEG 664

Query: 793 TM 794
           T+
Sbjct: 665 TL 666

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 89/182 (48%), Gaps = 11/182 (6%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNG 247
            DLI+K      +    V + F     ++       +  P + VTR+     TSKY +NG
Sbjct: 63  QDLIYK-RGQAGVIKASVTIVFD--NSDIKSSPIGFERYPKISVTRQIALGGTSKYLING 119

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAGTR 172

Query: 308 KY 309
            +
Sbjct: 173 MF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 60/86 (69%), Gaps = 4/86 (4%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKNR 1382
            +QFIV+SL+  MF  A +   ++K R
Sbjct: 1137 SQFIVVSLKEGMFNNANR---VFKTR 1159

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 84/361 (23%), Positives = 159/361 (44%), Gaps = 72/361 (19%)

Query: 658 ISGFHGRLGDLGTIDDKYDVAIS---TACPRLDDVVVETVECGQQCIEH--LRKNKLGYA 712
           + G   ++  LG   D +D A +    A  RL +++V+  +   Q +E   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----V 576

Query: 713 RFILLDKL-------RSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDL 765
             I L+K+        S  +     P  V    +L+   +     A   +   +L+  D 
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLI-GYEEDVSKAMQYIFGGSLICADA 635

Query: 766 KEANRVAYGKQ-RFRVVTLDGKLIDLSGTMSGGGNHRASGMMKS-ERLNTGA----SFTA 819
           + A ++ +  Q R R +TLDG + D  GT+SGG ++  + ++K  ++ N  +    SF +
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLKDIQKYNEASRRSKSFES 695

Query: 820 EEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIK 879
            E+  I +++ E ER          ++  +LQ+        E D+++ + +    LS+  
Sbjct: 696 -ELSLIQQQIMECER--------ASQLTKSLQN--------ELDLAEHKFQ----LSQKA 734

Query: 880 LCEDRAASL--KKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQI 937
           L  + AA +  K ++ LNE            +++ K +  L       +K    ELQ ++
Sbjct: 735 LVSNPAAQIIKKNDEMLNE------------IETCKTDIDL-------QKISTAELQAEV 775

Query: 938 MKIGGTKLQL---QGSLVDSIGQRISITLGKQKRDKTAVKKAENDL-KRYEKQAGQLSVD 993
           ++I     +    +GS +  + + +S TL KQ +DK  V + + DL +  + +  QL  D
Sbjct: 776 VRIQKDMQEFNTDKGSKLKQLNKEVS-TLAKQIKDKEVVTEQKYDLYQNLQMETEQLQTD 834

Query: 994 I 994
           I
Sbjct: 835 I 835

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 88/182 (48%), Gaps = 11/182 (6%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNG 247
            DLI+K      +    V + F     +        +  P + VTR+     TSKY +NG
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFD--NSDKSNAPIGFESSPTISVTRQVALGGTSKYLING 119

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 308 KY 309
            +
Sbjct: 173 MF 174

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 91/182 (50%), Gaps = 11/182 (6%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNG 247
            DLI+K      +    V + F    D+ +       +   + VTR+     TSKY +NG
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDN-SDKTNSPIGF-NNSSKISVTRQIILGGTSKYLING 119

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
             +    V +L +   +++++  FLI+QG++  +  MKP       + +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAGTK 172

Query: 308 KY 309
            +
Sbjct: 173 MF 174

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 92/184 (50%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  + + F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   +     D   + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNSDKSNSPIGFNDSLKISVTRQIVLGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  +  M+P         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 133/291 (45%), Gaps = 50/291 (17%)

Query: 663 GRLGDLGTIDDK--YDVAISTACP--RLDDVVVETVECGQQCIEHLRKNKLGYARFILLD 718
           G    L ++D++  Y       C   RL +VVV+      Q +E  R  K   A  I L+
Sbjct: 525 GIAAQLFSLDEQNFYSATALQVCAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLN 582

Query: 719 KL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRV 771
           K+  R+ N N +       P  V    +L+   + + R A   +   +LV KD + A  V
Sbjct: 583 KIAARTLNDNIVNMAKSVAPGRVELALNLI-GYEEEVRRAMEFIFGSSLVCKDAEAAKMV 641

Query: 772 AYG-KQRFRVVTLDGKLIDLSGTMSGGG-NHRASGMMKSERLNTGASFTAEEVRQIDEEL 829
            +  K R R +TLDG + D  GT+SGG  N+ +S ++  +R N   +   E   ++++  
Sbjct: 642 TFNPKIRTRSITLDGDVYDPEGTLSGGSRNNTSSLLIDIQRYNNNCNLVKELETKLNDIA 701

Query: 830 TERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLK 889
            +    F+I+  T           K+ + E+E  +++ +++    LSE  L  + AA   
Sbjct: 702 KKIAIQFEISNKT-----------KNLQKELE--LAQHKLK----LSERNLQSNTAAQ-- 742

Query: 890 KEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKI 940
                       LI  N  L+S  A+CK    E+K K ++IK+L++QI KI
Sbjct: 743 ------------LIRKNEELESEIAQCK---EEIKDKTSQIKQLKKQIAKI 778

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 89/184 (48%), Gaps = 15/184 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRA-NKMRQGKL 187
           +  L +  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTV--RQDRPGLVVTRKAFKNNTSKYYV 245
            DLI+K      +    V + F    D  D   +       P + VTR+     TSKY +
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVF----DNTDKSNSPIGFNTSPRISVTRQIVIGGTSKYLI 117

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAG 170

Query: 306 TAKY 309
           T  +
Sbjct: 171 TKMF 174

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 141/302 (46%), Gaps = 40/302 (13%)

Query: 663 GRLGDLGTIDDKYDVAISTA-----CP--RLDDVVVETVECGQQCIEHLRKNKLGYARFI 715
           G    L TI+D    AI +A     C   RL +VVV+      Q +E  R  K      I
Sbjct: 529 GVAATLFTINDN---AIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTII 583

Query: 716 LLDKL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEA 768
            L+K+  R  N NT+       P  V    +L+   D   R A   +   +L+ KD + A
Sbjct: 584 PLNKIASRRLNENTVNFAKQLAPGKVDLALNLIGYSDELSR-AMEFIFGTSLICKDSETA 642

Query: 769 NRVAYGKQ-RFRVVTLDGKLIDLSGTMSGGG-NHRASGMMKSERLNTGAS---FTAEEVR 823
            +V + +  R R +TL+G + D  GT+SGG  N++ S ++  +  N   +      E +R
Sbjct: 643 KKVTFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLLLDIQHYNKTCNEIKILEENLR 702

Query: 824 QIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLS-EIKLCE 882
            I  +L E+E+ +  +    +++  A   L   +  ++++ S + ++ +  +S EIK CE
Sbjct: 703 DIKIKLNEQEKIYSASKVIQNDLNLAEHKLAMAQRSVDSNQSTQLIKRNEAISLEIKSCE 762

Query: 883 DRAASLKKEQKLNESSDDTLIEA-----------NSRLDSLKAECKLLEGEMKSKKNKIK 931
           +   S+ +EQ   ES  +++I+             S+L  L+ E K L  ++  K+N+++
Sbjct: 763 N---SITQEQNKLESIQNSIIQIEKDINEFNNDKGSKLKELQQEIKALSKKLSVKENEVE 819

Query: 932 EL 933
            +
Sbjct: 820 NI 821

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
           Ashbya gossypii AAL182W
          Length = 1232

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 174/722 (24%), Positives = 314/722 (43%), Gaps = 104/722 (14%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I ++ +  FK+Y     +  F +  + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVR-QDRPGLVVTRKAFKNNTSKYYV 245
              LI++  +  ++ S +VE+ F     + + RT +   D  G +  R+       +Y +
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFH----DAENRTLLGIPDSNGAIRIRRTVGLKKDEYMI 114

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIG 305
           N K SS + V  LL   G    +   ++ QG + S+   K       D   L+ LE+++G
Sbjct: 115 NNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVG 167

Query: 306 TAKYKPLIEQTLVQIDQLNDVCQEKENRYEI-VEREKSSLESGXXXXXXXXXXXXXXXXX 364
              ++  ++++L ++D       EK NR +I +E ++   +                   
Sbjct: 168 AKSFERKLKESLQRMD-----ATEK-NREKIRIELQEVEDKLNELNEEREELETYNELDR 221

Query: 365 RSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAE-------RAKYTEH--KREIKQLESES 415
             K+ Q  L+           +I  L EKL  E         +Y E   KREI  +ES +
Sbjct: 222 SRKMFQFTLYDRELN------EITNLIEKLDGEYNNTLVLSEQYIEELDKREI-LIESLN 274

Query: 416 KSLNVTIRGIKDSESSLTSEKRTCDRD---RVS--------LEEKLKNISQKKVKAEKTH 464
           K LN T   +K  ES+   + +  D +   R++        L+ + + I Q+ V    T 
Sbjct: 275 KKLNQTNSELKIKESTELQQAKDADAEVSKRLADLHVKNEDLKLQCQTIQQQSV----TD 330

Query: 465 HATVNSINA-TQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQ 523
              ++SINA  +AK  +L K    +E   DEL K+    ++++    ISL+ +   +  +
Sbjct: 331 SEMLSSINAQIEAKELQLKK----FEPRFDELTKA----ESEMKANFISLQQRQRDLLSK 382

Query: 524 IGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLA-------KIAEEISKSENDISNN 576
            G+          K + K  +      +I VL+E+LA        + EE +K   DI+  
Sbjct: 383 RGKY--------AKFKNKDERDSWLNQEILVLEEALASSKASRESLEEERAKIAADIAAL 434

Query: 577 RKKVAEQHQAIE--GLEKEHTDIQRQII-IGQTECDNASNKM------KEMKAVLTTHRQ 627
            +++ E    ++  G+  E  D+Q ++I + +T       +       +++++V  T  +
Sbjct: 435 DEQIVELMDYVQGPGITAELEDLQNEVISMKKTYLSKIDERKGLWRTEQKLQSVFETLVE 494

Query: 628 RSLDAKSSLSTFENKN------KVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDV-AIS 680
               ++ +L+   ++N       V   +QRL          G LG+L  + +KY   A  
Sbjct: 495 EVKRSEGNLNEIMDRNLAIGLRNVTEIVQRLNLPE--GSVFGPLGELIKVSEKYKTCAEV 552

Query: 681 TACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVS-RLFD 739
                L  VVV+T       ++ L  +K G   F+ L+++  +    IQ P+N       
Sbjct: 553 VGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRI--YVDPNIQYPSNEEYNCTP 610

Query: 740 LVHPI--DNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRV--VTLDGKLIDLSGTMS 795
           L+  I  D KF  A   V   T+V KDL + +++A   ++F +  VTLDG   D  G ++
Sbjct: 611 LIKKIKFDGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQFNLNSVTLDGDKADNKGVLT 667

Query: 796 GG 797
           GG
Sbjct: 668 GG 669

 Score = 73.9 bits (180), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 1278 DSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1335
            D+ D    GV   V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1336 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKNR 1382
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   + Y+N+
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRVKYENK 1200

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 193/809 (23%), Positives = 340/809 (42%), Gaps = 100/809 (12%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLS 188
           I  + +  FK+Y    VV  F    + VVG NGSGKSN   ++ FV     + +++    
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 189 DLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGK 248
             I++      + S  VE+ F   ++ +     +R D  G V  R+       +Y +N K
Sbjct: 64  GFIYQGAGQ--VMSAFVEIIFDDPENLM--LAPLRND-TGEVRIRRTVGLKKDEYMINDK 118

Query: 249 ESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAK 308
            S+   V  +L   G    +   ++ QG + S+   K       D   L  LED++G   
Sbjct: 119 NSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVVGAKS 171

Query: 309 YKPLIEQTLVQID------------------QLNDVCQEKE--NRYEIVEREKSSLESGX 348
           ++  ++++L +++                  +L+++  EKE   +Y  + R++  L+   
Sbjct: 172 FENKLKESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCL 231

Query: 349 XXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREI 408
                                 + + +NS +  N  EK + L  +L+ +R    E + +I
Sbjct: 232 YDRELNDITNQIEQLEGE---YNSIIENSSEYVNELEKREVLAVELN-KRMNSLESEIKI 287

Query: 409 KQLES--ESKSLNVTIRG-IKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHH 465
           KQ     + K+  + + G + D ++ L   +   D  +  LE  +K I + K + E    
Sbjct: 288 KQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIE---- 343

Query: 466 ATVNSINATQAKLEELFKDQVQYEKELDELNK---SLLVEKTKLDEIKISLKGKTGAISV 522
              +SI   Q K ++L  +    + E+++L K    LL +K K ++ + ++  +   I  
Sbjct: 344 INCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFR-TVNERNDWIQE 402

Query: 523 QIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAE 582
           QI  + Q L   N+   +  SQ       +S L+  L  +  EI    + + N    VA+
Sbjct: 403 QINLLNQSLNKSNILKDQLTSQ-------LSTLQHDLENLNAEIEDLADSV-NGMGSVAQ 454

Query: 583 Q---HQAIEGLEKEH-TDIQRQIIIGQTE------CDNASNKMKEMKAVLTTHRQRSLDA 632
           Q      +   +KE+ T I ++  + +TE        +  N +K  ++ +     RSL  
Sbjct: 455 QEDLQNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLAL 514

Query: 633 KSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDV-AISTACPRLDDVVV 691
                  +N N +++ L   +         G +G+L  + DKY + A       L +VVV
Sbjct: 515 -----GLQNVNDIVNRLNLHEH------VFGPVGELIKVSDKYKICAEVVGGNSLFNVVV 563

Query: 692 ETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNT-IQTPNNV--SRLFDLVHPI--DN 746
           +  E     I+ L   K G   FI L+KL   +++T    PNN+  ++   L+  I  D 
Sbjct: 564 DNEETASLLIKELFATKGGRVTFIPLNKL---HVDTNFTYPNNLEKNQCTPLIKKIKYDV 620

Query: 747 KFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMM 806
           KF      V   TLV K L +   +A  + +   +TLDG   D  G +SGG         
Sbjct: 621 KFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAITLDGDRADSKGVLSGG----YLDQY 675

Query: 807 KSERLNTGASF--TAEEVRQIDEELTERERNFKIATDTLHEMEDALQS-LKDREPE---I 860
           KS RL+T   F  +  E ++I  EL E     K A  ++ +  D L + +KD   E    
Sbjct: 676 KSNRLDTLRDFKQSKREYKKIQVELQE----IKQALQSIEQEIDGLNNVVKDAAAERDAY 731

Query: 861 ETDISKRRMEIDSLLSEIKLCEDRAASLK 889
           E  I K R ++ + LS+    +D   +LK
Sbjct: 732 EAGIEKARSQLKAKLSQKITIDDSIKALK 760

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (53%)

Query: 1301 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1360
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1361 VISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINRS 1399
              + R +M  +A     +     ++    +  +D +N S
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVNFS 1215

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 101/200 (50%), Gaps = 18/200 (9%)

Query: 1216 FQARKLELNKAVEQRD----SVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGN 1271
            F  +K+ELN+   + D    S++   + L+++++    + F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1272 AELEL------------VDSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALV 1317
            A+L +             +S +    G+  SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1318 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1377
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1378 IYKNRNMTKSVALENKDLIN 1397
            +     ++  V +E ++ IN
Sbjct: 1181 VKYENKISTVVEVERQEAIN 1200

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 91/196 (46%), Gaps = 9/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I+R+ +  FK+Y    V+  F  +++ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+     ++ S  VE+ F+     +   + V       +  R+        Y VN
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVN 118

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  + + V  +L   G  + +   ++ QG + ++   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLEDVVGA 171

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  +  +L ++D+
Sbjct: 172 KSFESKLRASLKKMDE 187

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 115/232 (49%), Gaps = 39/232 (16%)

Query: 1190 GQLNDFVENAYADIEVLEEYTKRLVD----FQARKLELNKAVEQRDSVRQNCDNL----R 1241
            G+L   + +   DI  L    KR  +    F  ++ EL +  E+ D  + +  NL    +
Sbjct: 971  GELLQRLNSVNEDISGLSNVNKRAFENFKKFGEKRTELEERAEELDESKSSIQNLITRLK 1030

Query: 1242 KKRLDEFMNGFNTISMTLKEMYQMITMGGNAEL---------------ELVD-------- 1278
            +++++   + FN +S    ++++ +   G A+L               E V+        
Sbjct: 1031 RQKVNAVDSTFNKVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDGDEND 1090

Query: 1279 -----SLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1331
                 S++    GV  SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ 
Sbjct: 1091 ESRSKSVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLF 1150

Query: 1332 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKNR 1382
            DEIDAALD +  + VA+ IKE ++NAQFI  + R++M E+A +   + Y+N+
Sbjct: 1151 DEIDAALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYENK 1202

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 85/196 (43%), Gaps = 9/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + V+G NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+     ++ S  VE+ F      +   + +       V  R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSGIPPRENDEVFVRRTVGLKKDDYQLN 118

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  + + V  +L   G  + +   ++ QG + ++   K       D   L  LE+++G 
Sbjct: 119 DRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEEVVGA 171

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  +  +L ++D+
Sbjct: 172 KSFEVKLRASLKKMDE 187

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 116/231 (50%), Gaps = 28/231 (12%)

Query: 1189 IGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEF 1248
            I +L +  + A+ +     E    LV+ ++R+LEL+K      S+++  + L++++++  
Sbjct: 992  ISKLVNVNKRAFENFRRFGEKQTELVE-RSRELELSKI-----SIQELIEKLKEQKINAV 1045

Query: 1249 MNGFNTISMTLKEMYQMITMGGNAELEL----------------VDSLD----PFSEGVL 1288
               F  +S    ++++ +   G  +L +                 + +D    P   GV 
Sbjct: 1046 DKTFRKVSENFVKVFETLVPRGTGKLVIHRTNQENSATPDLEDETNDMDIDAQPMYTGVS 1105

Query: 1289 FSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1346
             SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + V
Sbjct: 1106 ISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAV 1165

Query: 1347 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            AN +KE +KNAQFI  + R +M ++A +   +     ++  + +E  + IN
Sbjct: 1166 ANTLKELSKNAQFICTTFRTDMLQVADKFFRVKYENKISSVLEIERDEAIN 1216

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 93/201 (46%), Gaps = 18/201 (8%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHK-SEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD-----RP-GLVVTRKAFKNN 239
              LIH+ +    ++ SC VE+ F     + D R  +  +     RP   V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 240 TSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEY 299
              Y +N +  + + +  +L   G  + +   ++ QG++ ++   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 300 LEDIIGTAKYKPLIEQTLVQI 320
           LED++G   ++  +  +L +I
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKI 190

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 98/196 (50%), Gaps = 29/196 (14%)

Query: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262
            IE  +++  +  D ++R  EL ++   ++S+ +  ++L+K++++     F+ ++     +
Sbjct: 1019 IENFKKFNDKREDLESRAEELEQS---KESIEKLVESLKKQKVEAVEATFSKVATNFTTI 1075

Query: 1263 YQMITMGGNAELEL------------------------VDSLDPFSEGVLFSVMPPKKSW 1298
            ++ +   G   L +                         D+LD    GV  SV    K+ 
Sbjct: 1076 FEKLVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNN 1135

Query: 1299 RN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
                +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + +
Sbjct: 1136 EQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAH 1195

Query: 1357 AQFIVISLRNNMFELA 1372
            AQFI  + R +M ++A
Sbjct: 1196 AQFICTTFRTDMLQVA 1211

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 84/189 (44%), Gaps = 9/189 (4%)

Query: 121 AQPIERLCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRAN 180
           A+ I  + I  + +  FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     +
Sbjct: 19  AREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYS 78

Query: 181 KMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT 240
            +++ +   LIH+     ++ S +VE+ F    D++   + +      +V  R+      
Sbjct: 79  SLKREERQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKK 136

Query: 241 SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYL 300
            +Y VNGK    + ++ +    G    +   ++ QG + ++   K K         L  L
Sbjct: 137 DEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLL 189

Query: 301 EDIIGTAKY 309
           ED++G   +
Sbjct: 190 EDVVGARSF 198

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 109/221 (49%), Gaps = 30/221 (13%)

Query: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262
            IE   ++ ++  + + R  EL ++   ++S+ +  D+L+K++++     F+ ++     +
Sbjct: 995  IENFRKFNEKREELENRAEELARS---KESIEELVDSLKKQKIEAVEATFSKVANNFTHI 1051

Query: 1263 YQMITMGGNAELELV-------------------------DSLDPFSEGVLFSVMPPKKS 1297
            ++ +   G  +L +                          DS++    GV  SV    K+
Sbjct: 1052 FEKLVPAGVGKLVIHRNESTRNASGGRGPQQGSGASGNEDDSIETMYSGVSISVSFNSKN 1111

Query: 1298 WRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1355
                 +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IKE + 
Sbjct: 1112 NEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANVIKELSV 1171

Query: 1356 NAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLI 1396
            +AQFI  + R++M ++A     +  +  +++  A+  +D I
Sbjct: 1172 HAQFICTTFRSDMLQVADSFYRVRFDNKISEISAVSQQDAI 1212

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 88/198 (44%), Gaps = 9/198 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I  + +  FK+Y  T  V      F+ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+     ++ S +VE+ F     ++   + +      +V  R+       +Y VN
Sbjct: 61  RQGLIHQGTG--SVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDEYSVN 118

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
           GK    + ++ +    G    +   ++ QG + ++   K       D   L  LE+++G 
Sbjct: 119 GKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEEVVGA 171

Query: 307 AKYKPLIEQTLVQIDQLN 324
             ++  + ++  +++  N
Sbjct: 172 KSFEIKLRESAKKMEATN 189

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1284 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1343
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1344 SIVANYIKERTKNAQFIVISLRNNMF 1369
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 141/316 (44%), Gaps = 36/316 (11%)

Query: 658 ISGFHGRLGDLGTIDDKYDVAIS---TACPRLDDVVVETVECGQQCIEHLRKNKLGYARF 714
           + G   +L  L   +D YD A +    A  RL +VVV+      Q +E  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 715 ILLDKL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKE 767
           I L+++  R+ N  T+Q      P  V    +LV   + +   A   +  ++L+ KD + 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLV-GYEEEVSRAMEFIFGNSLICKDAET 637

Query: 768 ANRVAYGKQ-RFRVVTLDGKLIDLSGTMSGGG-NHRASGMMKSERLNTGASFTAE---EV 822
           A ++ +  Q R R +TL G + D  GT+SGG  N+ +S ++  ++ N  A    E   ++
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLLIDVQKYNKTAKRIEELELKL 697

Query: 823 RQIDEELTERE---------RN-FKIATDTLHEMEDALQS-----LKDREPEIETDISKR 867
           + I  +L E+E         RN   +AT  L   + +L+S     +  +  E+  +I + 
Sbjct: 698 KSITRDLEEQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQAAHIIRKNEELIKEIDES 757

Query: 868 RMEIDSLLSEIKLCEDRAASLKKE-QKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSK 926
           + EI S  S I  CE     ++ + Q+ +      L +    +  L  E  +LE +++SK
Sbjct: 758 QKEIASKRSSISDCEKEIQRIQTDIQEFSTDKGSKLKQLKDEVSKLFKEIGILETKVESK 817

Query: 927 KNKIKELQEQIMKIGG 942
            +  +  Q    ++ G
Sbjct: 818 YDSYQTFQLDTEQLAG 833

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 99/212 (46%), Gaps = 30/212 (14%)

Query: 1216 FQARKLELNKAVEQRDSVRQNCDNL----RKKRLDEFMNGFNTISMTLKEMYQMITMGGN 1271
            F  +KLEL    ++ D  + +  NL    +++++    + F  +S    E+++ +   G 
Sbjct: 1001 FHEKKLELEDRSKELDESKTSIQNLIVKLKQQKVAAVDSTFENVSRNFTEVFEQLVPRGK 1060

Query: 1272 AELELVDSLDP------------------------FSEGVLFSVMPPKKSWR--NISNLS 1305
            A+L +  S D                            GV  SV    K  R  ++  LS
Sbjct: 1061 AKLVIHRSSDARDDDVDAENDTAMTGDDDGTQTESMYTGVSISVSFNSKKTRQLHVEQLS 1120

Query: 1306 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1365
            GG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  IK  + NAQFI  + R
Sbjct: 1121 GGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAGIIKALSANAQFICTTFR 1180

Query: 1366 NNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
             +M ++A +   +     ++  V ++ ++ IN
Sbjct: 1181 TDMLQVADKFFRVKYENKISTVVEVDRQEAIN 1212

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 88/196 (44%), Gaps = 9/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+     ++ S  VE+ F      +   + V       V+ R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILPSGVAPRSNDEVLVRRTVGLKKDDYQLN 118

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  +   V  +L   G  +++   ++ QG + ++   K K         L+ LED++G 
Sbjct: 119 DRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLEDVVGA 171

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  +  +L +++Q
Sbjct: 172 KSFEVKLRASLKKMEQ 187

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 113/237 (47%), Gaps = 34/237 (14%)

Query: 1189 IGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEF 1248
            I  L +  + AY +    +E  K LV+   R  EL+   E + S++     LR++++   
Sbjct: 986  ISGLKNVNKRAYENFRKFDEKQKELVE---RATELD---ESKTSIQDLITRLRQQKVTAV 1039

Query: 1249 MNGFNTISMTLKEMYQMITMGGNAEL--------------------------ELVDSLDP 1282
             + F  ++   + +++ +   G A+L                          E++++ + 
Sbjct: 1040 DSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNSNDDDVDMDQEDEVINNNES 1099

Query: 1283 FSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340
               GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD 
Sbjct: 1100 IYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDK 1159

Query: 1341 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            +  + VAN IK+ + NAQFI  + R +M ++A +   +     ++  + ++ +D IN
Sbjct: 1160 QYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTVIEVDKQDAIN 1216

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 91/198 (45%), Gaps = 11/198 (5%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDE--LDGRTTVRQDRPGLVVTRKAFKNNTSKYY 244
              LIH+      + S  VE+ F   + +  L      R++   + + R+        Y 
Sbjct: 61  RQGLIHQGSGGSVM-SASVEIVFHDPEHKMILPSGVVPRENNDEICI-RRTVGLKKDDYQ 118

Query: 245 VNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDII 304
           +N +  +   V  +L   G  + +   ++ QG++ S+   K K         L+ LED++
Sbjct: 119 LNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDVV 171

Query: 305 GTAKYKPLIEQTLVQIDQ 322
           G   ++  ++ +L ++++
Sbjct: 172 GAKSFEVKLKASLKKMEE 189

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 96/219 (43%), Gaps = 21/219 (9%)

Query: 663 GRLGDLGTIDDKYDV-AISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLR 721
           G LG+L  +++KY + A       L  +VV+T E     ++ L K K G   FI L+++ 
Sbjct: 539 GTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRI- 597

Query: 722 SFNMNTIQTPNNVSRLFDLVHPI--DNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFR 779
             + N    PN+ +    L++ I  D +F  A   +   T+V KDL    R++  K +  
Sbjct: 598 YLDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRIS-KKFKLN 656

Query: 780 VVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIA 839
            +TLDG   D  G ++GG         K  RL++ ++           E T + R   + 
Sbjct: 657 SITLDGDRADKRGVLTGG----YYDQYKQSRLDSLSTLN---------ESTAKHRELSLE 703

Query: 840 TDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEI 878
              L  ++ A+Q +      +   I K     +SLLS I
Sbjct: 704 ---LTSIKQAIQEVDSNIDTLNNSIRKHNTNRESLLSNI 739

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1296 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1355 KNAQFIVISLRNNMFELAQQL 1375
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 141/305 (46%), Gaps = 60/305 (19%)

Query: 663 GRLGDLGTIDDK-YDVAIS---TACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLD 718
           G    L TID + YD A +    A  RL +VVV+      + +E  R  K      I L+
Sbjct: 525 GVAARLFTIDKQNYDSATALQVCAGGRLYNVVVDNETTASKLLEKGRLRK--RVTIIPLN 582

Query: 719 KL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRV 771
           K+  R+ + NT+       P  V    +L+   +++   A   +   +L+  D + A ++
Sbjct: 583 KISARTIDNNTLNYAKQLAPGKVELALNLI-GYEDEVAKALQFIFGSSLICNDAETAKKI 641

Query: 772 AYG-KQRFRVVTLDGKLIDLSGTMSGGGNHRASGMM--------KSERLNTGASFTAEEV 822
            +  K R R +TLDG + D  GT+SGG     S ++         +E++N   +    E+
Sbjct: 642 TFNPKIRTRSITLDGDVYDPEGTLSGGSRTNTSSILVDIQKYNESTEKINNYQN----EL 697

Query: 823 RQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIE---------TDISKRRMEIDS 873
           + I ++L+E+E  +K       E+++ L SL + + EI          + + KR  +I  
Sbjct: 698 KSIRKKLSEQEDIYK----QTKELQNQL-SLLNHKLEISKRNFGSNPASQVLKRNKDIQ- 751

Query: 874 LLSEIKLCE-------DRAASLKKE-----QKLNESSDDTLIEANSRLDSLKAECKLLEG 921
              EI +CE       + + +L+KE     + LNE ++D      S+L  LKAE + L  
Sbjct: 752 --EEILICEKENETSYENSNALEKEIQSITKDLNEFNND----KGSKLKELKAEVEKLSK 805

Query: 922 EMKSK 926
           E+++K
Sbjct: 806 EIETK 810

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
            {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQL 1375
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 147/326 (45%), Gaps = 65/326 (19%)

Query: 658 ISGFHGRLGDLGTIDDKYDVAIS---TACPRLDDVVVETVECGQQCIEH--LRKNKLGYA 712
           + G   +L  L   ++ YD A++    A  RL +V+V+      Q +E   LRK      
Sbjct: 523 VKGVAAQLFTLS--ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKR----V 576

Query: 713 RFILLDKL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDL 765
             I L+K+  R  N  +++      P  V    +LV   + +   A   +  ++LV  D 
Sbjct: 577 TIIPLNKIATRVINSESLKLAKQLAPGKVQLALNLV-GYEEEVSKAMEYIFGNSLVCNDA 635

Query: 766 KEANRVAYGKQ-RFRVVTLDGKLIDLSGTMSGGG-NHRASGMMKSERLNTGASFTAEEVR 823
           + A R+ +  Q R R +T  G + D  GT+SGG  N++++ ++  ++ N+     A+ ++
Sbjct: 636 ETAKRLTFHPQIRTRSITQQGDVYDPEGTLSGGSRNNKSTLLVDIQKYNSA----AKRMK 691

Query: 824 QIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCED 883
            +++EL        + ++ L E E A  S K +E + + ++   ++ I            
Sbjct: 692 VLEDELL-------VISNKLKEQESA--SAKTKEIQNKLNLVSHKLSIF----------- 731

Query: 884 RAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKI--- 940
                  ++ LNE+    +I+ N  L     EC   E E++ K++ + +LQ++I KI   
Sbjct: 732 -------QRTLNENPATQIIKRNDDLTRQIREC---EEEIEQKQSYMSQLQDEIRKIQDD 781

Query: 941 -------GGTKLQLQGSLVDSIGQRI 959
                   GTKL+     +DS+ + I
Sbjct: 782 MEEFNNDKGTKLEKLKKEIDSLTKEI 807

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 69/156 (44%), Gaps = 15/156 (9%)

Query: 663 GRLGDLGTIDDK-YDVAIS---TACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLD 718
           G    L T+D + +D AI+    A  RL +++V+      Q +E  R  K      I L 
Sbjct: 525 GVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLS 582

Query: 719 KL--RSFNMNTIQ-----TPNNVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRV 771
           K+  R+ N NT+       P  V    +L+   D++   A   +  + LV KD   A +V
Sbjct: 583 KIATRTLNKNTLALAKELAPGKVELALNLI-GYDDEVSKAMEFIFGNGLVCKDADTAKKV 641

Query: 772 AYGKQ-RFRVVTLDGKLIDLSGTMSGGGNHRASGMM 806
            +    R R +T  G + D  GT+SGG  +    ++
Sbjct: 642 TFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL 677

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 5/162 (3%)

Query: 1237 CDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKK 1296
             DNL++++++     FN +S    ++++ +   G  EL +      +S GV   V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1297 S--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1354
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1355 KNA-QFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDL 1395
            +N  QFI+ + R++M E+A  ++ + K  N   SV   NK +
Sbjct: 1071 QNGTQFILTTFRSDMIEIA-DMIYMVKYHNKVSSVYETNKTI 1111

 Score = 62.4 bits (150), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 132/284 (46%), Gaps = 47/284 (16%)

Query: 659 SGFHGRLGDLGTIDDKYDVAIST-ACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILL 717
           +  +G LG+L  + +KY   +   A   L +++V+T E   Q +  L + + G   FI L
Sbjct: 459 TSIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPL 518

Query: 718 DKLRSFNMNTIQTPNNV-SRLFDLVHPI--DNKFRNAFYSVLRDTLVAKDLKEANRVAYG 774
           +++   N   I  P+N  S    L+  I  D KF     +V   T+V KDL+  NR+   
Sbjct: 519 NRIE--NGVNINYPSNEESNCTALIKKIKYDKKFEKVIRNVFGKTIVVKDLQLGNRLC-K 575

Query: 775 KQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLNTGASFTAEEVRQIDEELTERER 834
           + + + +TLDG  ID  G +SGG       + +  RL+                L E +R
Sbjct: 576 EFKLQAITLDGDRIDSKGVVSGG----YFNINRRSRLDN---------------LKELQR 616

Query: 835 NFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKL 894
           +  +  +T+ E+            +I+ +IS+   EID + +EI     R  S K+E+ +
Sbjct: 617 SRNVYKNTMKEL-----------AQIKDEISQIDDEIDKINAEI-----REVSGKRERVM 660

Query: 895 NESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIM 938
            ++ D  L     +L+  K +   LE  M + KNK +++++ ++
Sbjct: 661 IKNEDGRL-----KLNQSKTQLYNLEETMVNVKNKREQMEKNVL 699

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 78.6 bits (192), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 43/106 (40%), Positives = 65/106 (61%), Gaps = 3/106 (2%)

Query: 1280 LDPFSEGVLFSV-MPPKKSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1337
            L+    GV  SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1338 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKNR 1382
            LD +  + VAN IK+ +KNAQFI  + R +M  +A +   + Y+N+
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRVKYENK 1200

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 84/195 (43%), Gaps = 17/195 (8%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD---RPG-LVVTRKAFKNNTSK 242
              LIH+     ++ S  VE+ F     + D R  +      RP   V  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 243 YYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLED 302
           Y +N +  + + +  +L   G  +     ++ QG + ++   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 303 IIGTAKYKPLIEQTL 317
           +IG   ++  +  +L
Sbjct: 168 VIGAKSFETKLRASL 182

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 2/120 (1%)

Query: 1280 LDPFSEGVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1337
            ++P   GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1338 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397
            LD +  + VA  I++ + NAQFI  + R +M E+A     +     ++  + ++ ++ IN
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYENKISTVIEIDRQEAIN 1218

 Score = 62.8 bits (151), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 88/196 (44%), Gaps = 8/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+      + S  VE+ F     ++   + V       V  R+        Y +N
Sbjct: 61  RQGLIHQGSGGAVM-SASVEIVFHDPNHKIILPSGVVPRENDEVYIRRTVGLKKDDYQLN 119

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  +   V  +L   G  +++   ++ QG++ ++   K K         L  LED++G 
Sbjct: 120 DRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLEDVVGA 172

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  ++ +L ++D+
Sbjct: 173 KSFELKLKASLKKMDE 188

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 32/197 (16%)

Query: 1215 DFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAEL 1274
            D   R  EL+   E +DS++     L++++++   + F  +S   + +++ +   G A+L
Sbjct: 1011 DLSERASELD---ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGIAKL 1067

Query: 1275 EL---------VDSLDP-----------------FSEGVLFSVMPPKKS--WRNISNLSG 1306
             +         +DS+D                     GV  SV    K     ++  LSG
Sbjct: 1068 VIHRRDDTKDQMDSIDDDMDVASSERTSSKDGDIMYTGVSISVSFNSKQNEQLHVEQLSG 1127

Query: 1307 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1366
            G+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQFI  + R 
Sbjct: 1128 GQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFICTTFRT 1187

Query: 1367 NMFELAQQLVGI-YKNR 1382
            +M ++A +   + Y+N+
Sbjct: 1188 DMLQVADKFFRVKYENK 1204

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 100/226 (44%), Gaps = 15/226 (6%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+      + S  VE+ F      +   + V       V  R+        Y +N
Sbjct: 61  RQGLIHQGSGGSVM-SASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  +   +  +L   G  +++   ++ QG++ ++   K K         L+ LED++G 
Sbjct: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLEDVVGA 172

Query: 307 AKYKPLIEQTLVQID-------QLNDVCQEKENRYEIVEREKSSLE 345
             ++  ++ +L +++       Q+N    E  ++   +E+E+  LE
Sbjct: 173 KSFEVKLKASLKKMEETEQKKFQINKEMDELNSKLTEMEQERKELE 218

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 102/210 (48%), Gaps = 33/210 (15%)

Query: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262
             E  +++ ++  D   R  EL+   E +DS++     L+++++    + F  +S   K +
Sbjct: 999  FENFKKFNEKRKDLSGRASELD---ESKDSIQDLIVKLKQQKVSAVDSTFQKVSENFKTV 1055

Query: 1263 YQMITMGGNAELEL----VDSLDPFSE-----------------------GVLFSVMPPK 1295
            ++ +   G A+L +     DS+D  ++                       GV  SV    
Sbjct: 1056 FERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVYTGVSISVSFNS 1115

Query: 1296 KS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1353
            K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE 
Sbjct: 1116 KQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKEL 1175

Query: 1354 TKNAQFIVISLRNNMFELAQQLVGI-YKNR 1382
            + NAQFI  + R +M ++A +   + Y+N+
Sbjct: 1176 STNAQFICTTFRTDMLQVADKFFRVKYENK 1205

 Score = 59.7 bits (143), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 88/196 (44%), Gaps = 8/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+      + S  VE+ F      +   + V       V  R+        Y +N
Sbjct: 61  RQGLIHQGSGGSVM-SASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  +   +  +L   G  +++   ++ QG++ ++   K K         L+ LED++G 
Sbjct: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLEDVVGA 172

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  ++ +L ++++
Sbjct: 173 KSFEVKLKASLKKMEE 188

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 55/84 (65%), Gaps = 1/84 (1%)

Query: 1300 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1359
            ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQF
Sbjct: 1108 HVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQF 1167

Query: 1360 IVISLRNNMFELAQQLVGI-YKNR 1382
            I  + R +M ++A +   + Y+N+
Sbjct: 1168 ICTTFRTDMLQVADKFFRVKYENK 1191

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/196 (19%), Positives = 90/196 (45%), Gaps = 9/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I ++ +  FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+     ++ S  VE+ F    + +   + V  +    V  R+        Y +N
Sbjct: 61  RQGLIHQGSG--SVMSASVEIQFYDPGNSMILPSGVAVNPDSTVSIRRTVGLKKDDYQIN 118

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  + + +  ++   G  + +   ++ QG + ++   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILEDVVGA 171

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  +  +L ++++
Sbjct: 172 KSFEAKLTASLKKMEE 187

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/210 (27%), Positives = 103/210 (49%), Gaps = 33/210 (15%)

Query: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262
             E  +++ +R  D   R  EL+   E +DS++     L++++++   + F  +S   + +
Sbjct: 999  FENFKKFNERRKDLAERASELD---ESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAV 1055

Query: 1263 YQMITMGGNAEL-------------ELVD-SLDPFSE-------------GVLFSVMPPK 1295
            ++ +   G A+L             E +D  +D  S              GV  SV    
Sbjct: 1056 FERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNS 1115

Query: 1296 KS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1353
            K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE 
Sbjct: 1116 KQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL 1175

Query: 1354 TKNAQFIVISLRNNMFELAQQLVGI-YKNR 1382
            +KNAQFI  + R +M ++A +   + Y+N+
Sbjct: 1176 SKNAQFICTTFRTDMLQVADKFFRVKYENK 1205

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 100/226 (44%), Gaps = 15/226 (6%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+      + S  VE+ F      +   + V       V  R+        Y +N
Sbjct: 61  RQGLIHQGSGGSVM-SASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  +   +  +L   G  +++   ++ QG++ ++   K K         L+ LED++G 
Sbjct: 120 DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLEDVVGA 172

Query: 307 AKYKPLIEQTLVQID-------QLNDVCQEKENRYEIVEREKSSLE 345
             ++  ++ +L +++       Q+N    E  ++   +E+E+  LE
Sbjct: 173 KSFEVKLKASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELE 218

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 72.0 bits (175), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 1300 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1359
            ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQF 1181

Query: 1360 IVISLRNNMFELAQQLVGI-YKNR 1382
            I  + R +M ++A +   + Y+N+
Sbjct: 1182 ICTTFRTDMLQVADKFFRVKYENK 1205

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 87/196 (44%), Gaps = 8/196 (4%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I R+ +  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LIH+      + S  VE+ F      +   + V       V  R+        Y +N
Sbjct: 61  RQGLIHQGSGGSVM-SASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLKKDDYQLN 119

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            +  +   +  +L   G  + +   ++ QG++ ++   K K         L+ LED++G 
Sbjct: 120 DRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLEDVVGA 172

Query: 307 AKYKPLIEQTLVQIDQ 322
             ++  ++ +L ++++
Sbjct: 173 KSFEVKLKASLKKMEE 188

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 103/230 (44%), Gaps = 45/230 (19%)

Query: 1203 IEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEM 1262
            +E  +++  +  D   R  EL+   E ++S+ +  D L+K++++   N F  +S    ++
Sbjct: 992  LENFKKFDDKQKDVMKRAKELD---ESKESIEKLIDKLKKQKVEAVENTFKKVSENFTQL 1048

Query: 1263 YQMITMGGNAELELV----------------------------------DSLDPFSEGVL 1288
            ++ +   G  +L +                                    S D    GV 
Sbjct: 1049 FEKMVPRGTGKLVIHRRENEPSKPSKRQQKKRKRQETEDVHFNDDQDENSSQDSIYSGVS 1108

Query: 1289 FSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1346
              V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + V
Sbjct: 1109 IEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAV 1168

Query: 1347 ANYIKERTKNAQFIVISLRNNMFELAQQLVGI-YKNR-----NMTKSVAL 1390
            A  +K+ +  AQFI  + R +M  +A +   + ++N+      +TK+ AL
Sbjct: 1169 AATVKQLSSQAQFICTTFRGDMIAVADRFYRVNFENKISTVVEVTKAEAL 1218

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 90/191 (47%), Gaps = 13/191 (6%)

Query: 127 LCINRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           + I ++ +  FK+Y     +  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVN 246
              LI++  +  ++ S +VE+ F   ++    RT +     G++  R+       +Y +N
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFHGAEN----RTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 247 GKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGT 306
            K +S + V  LL   G    +   ++ QG + S+   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 307 AKYKPLIEQTL 317
             ++  ++++L
Sbjct: 168 KSFERKLKESL 178

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 87/331 (26%), Positives = 139/331 (41%), Gaps = 59/331 (17%)

Query: 663 GRLGDLGTIDDKYDV-AISTACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLR 721
           G LG+L  I +KY   A       L  VVV+T       ++ L  +K G   FI L+++ 
Sbjct: 533 GPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVH 592

Query: 722 SFNMNTIQTPNNVSRLFDLVHPI--DNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RF 778
             + N +   N+      L+  I  D KF  A   V   T+V KDL +  ++A  KQ R 
Sbjct: 593 -VDSNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA--KQFRL 649

Query: 779 RVVTLDGKLIDLSGTMSGG-GNHRASGMMKSER-------LNTGASFTAEEVRQ----ID 826
             +TLDG   D  G ++GG  +H     + S R          G     EEV++    ID
Sbjct: 650 NAITLDGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSID 709

Query: 827 EELTE-----------RER--------NFKI--ATDTLHEMEDALQSLKDREP------- 858
           +E+ E           RE         N K+  A      +E+ +  L  +E        
Sbjct: 710 QEIDELNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQK 769

Query: 859 ------EIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSL 912
                 ++ T+   R  + +  L+E +  ++ A  L   + L  ++ D L     ++DSL
Sbjct: 770 LLQDKLDMYTEDLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSL 829

Query: 913 KAECKLLEGEMKSKKNKIKELQEQIMKIGGT 943
           KAE   L+ ++K +    KEL++Q  +I  T
Sbjct: 830 KAE---LDSKLKPQA---KELEDQPNEIMST 854

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 60/86 (69%), Gaps = 4/86 (4%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMFELAQQLVGIYKNR 1382
            +QFIV+SL+  MF  A +   ++K R
Sbjct: 1137 SQFIVVSLKEGMFTNANR---VFKTR 1159

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 118/262 (45%), Gaps = 34/262 (12%)

Query: 682 ACPRLDDVVVETVECGQQCIEH--LRK-------NKLGYARFILLDKLRSFNMNTIQTPN 732
           A  RL +V+V+  +   Q +E   LRK       NK+  AR I  D L   N      P 
Sbjct: 548 AGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDAL---NKAKSLAPG 603

Query: 733 NVSRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQ-RFRVVTLDGKLIDLS 791
            V    +L+   + +   A   +   +L+ +D   A +V +  Q R R +TLDG + D  
Sbjct: 604 AVELALNLIG-YEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPE 662

Query: 792 GTMSGGG-NHRASGMMKSERLNTGAS---FTAEEVRQIDEELTERERNFKIATDTLHEME 847
           GT+SGG  +H +S ++  ++ N  A       +E+ Q+   ++E E   ++     +E+ 
Sbjct: 663 GTLSGGSRSHTSSLLIDIQKYNEAAKQMMVLEKELYQVQANISEHENASRMTKSLQNELN 722

Query: 848 DALQSLKDREPEIETD----ISKRRMEIDSLLSEIKLCED-------RAASLKKE-QKLN 895
            A    +  E  ++++    I KR  EI     EI+  E+       R  +L+ E  ++ 
Sbjct: 723 LAKHKCQLAENALDSNPAAQIIKRNGEIH---REIEASENDRDQQTTRVNALQMEILRIQ 779

Query: 896 ESSDDTLIEANSRLDSLKAECK 917
              D+   +  S+LD LKAE +
Sbjct: 780 RDMDEFNTDKGSKLDQLKAEIR 801

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
            (SMC2) - SMC chromosomal ATPase family member [contig
            149] FULL
          Length = 1170

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1298 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1356
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1357 AQFIVISLRNNMF 1369
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 128/276 (46%), Gaps = 42/276 (15%)

Query: 682 ACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKL--RSFNMNTIQ-----TPNNV 734
           A  RL +VVV       Q +E  R  K      I L+K+  R  + +T+       P++V
Sbjct: 548 AGGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSV 605

Query: 735 SRLFDLVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYG-KQRFRVVTLDGKLIDLSGT 793
               +L+   +++   A   +   +L+ +D + A +V +  K R R +TL G + D  GT
Sbjct: 606 ELALNLI-GYEDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGT 664

Query: 794 MSGGGNHRASGMM--------KSERLNTGASFTAEEVRQIDE--ELTERERNFK----IA 839
           +SGG  +  S ++         S  L+   +  A+  ++I +  E+ ++ +N +    +A
Sbjct: 665 LSGGSRNNNSSILIDIQKYNAYSRNLSESEAKLADVTKRIKQYSEVLQKTKNLQNELNLA 724

Query: 840 TDTLHEMEDALQS-----LKDREPEIETDISKRRMEIDSLLS---EIKLCEDRAASLKKE 891
           T   H  E  L +     L  R  EI+ +I   +M ++S+ S   +IK  E   AS++K+
Sbjct: 725 THKFHLAERNLANNPSVQLMSRNKEIQDEI---QMCLESMRSGSEDIKKLEAEVASVEKD 781

Query: 892 QKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKK 927
             + E S D      S+LD LK E   +  +++ KK
Sbjct: 782 --MLEFSKD----KGSKLDELKREISHIRKDIEEKK 811

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 82/159 (51%), Gaps = 16/159 (10%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLS 188
           + RL LHNF +Y+  +    F  S + VVGPNGSGKS ++ +L      R   + + K S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 189 DLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGK 248
           D   K+ A    DS  ++V+        D  TT++  R   V+TR   K   S YYV+G 
Sbjct: 115 DSFIKNGA----DSARIDVWLA----GEDPGTTLKVSR---VLTRNHKK--ASLYYVDGV 161

Query: 249 ESSYTQVTELLR-KEGIDLDHKRFLILQGEVESIAQMKP 286
           E+S  +V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 162 ETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 48/169 (28%)

Query: 1201 ADIEVLEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKK---RLD--------EFM 1249
            + I +L+E  ++L D +AR   L   V + D+   +   ++ +   RLD         F 
Sbjct: 901  SSIAILQEVERKLADVKAR---LPAMVRKLDAATASMSTMQAELEPRLDTIVEKISERFT 957

Query: 1250 NGFN------TISMTLKEMYQ------MITMGGNAELELVDSLDPFSEGVLFSVMPPKKS 1297
            N F        I ++   +YQ      M+    NA L+ +DS                  
Sbjct: 958  NLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS------------------ 999

Query: 1298 WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1346
                   SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 ----HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 119/483 (24%), Positives = 223/483 (46%), Gaps = 80/483 (16%)

Query: 131 RLSLHNFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKL 187
           +L L NF +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R  K+
Sbjct: 62  KLKLTNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRK--AFKNNTSKYYV 245
            + I         D   +E+  +     L     +      +V  ++  + +   SKYY+
Sbjct: 118 EEYIKNGT-----DEGVIEITLKNSSALLHSDFNMINTDDDVVHVKRVLSMEKKKSKYYI 172

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKP-----KAEKEGDDGLLEYL 300
           N K  +   V  ++R   I LD+    + Q  VE  A++KP     +  +  + GLLE L
Sbjct: 173 NNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAGLLEKL 232

Query: 301 EDIIGTAKYKPL-IEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXX 359
            ++      K L  E   +QID        KEN+ + +   +++LES             
Sbjct: 233 SEL------KSLQAEGNELQID-----LGAKENKLKELTSSRAALES-QAHALELYEEKA 280

Query: 360 XXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLN 419
                  KLL +   K        +EKI+ L++K +A R        E+K +E+ESK  N
Sbjct: 281 RELDIHQKLLNYTYLKEH------KEKIRGLKDKRNALR-------NEVKTMENESKPFN 327

Query: 420 VTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLE 479
           +   G++     LT+++  C  D       + ++S+++  A+ + +++  +I  T   L 
Sbjct: 328 LL--GVR-----LTADENNCKSD-------IDDLSRRRYSAKTSFNSSTENIQKTSKYLS 373

Query: 480 ELFKDQVQYEKELDELNKSLLVEKTKLDEIKI-SLKGKTGAISV----QIGEIEQELEPW 534
           E  + +V +   L   NKS L E  K++E KI +L+ +   + +    +I E+++ L   
Sbjct: 374 EC-ESKVNF---LTTRNKS-LKEDIKVNEEKIKALEEERNKVVLPDPEKIHEVDENLSTA 428

Query: 535 N---VKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLE 591
           +   +KL +  + +K ++ KI  +++  AK A ++ K +ND+S+N     +    ++GL+
Sbjct: 429 SAKRLKLNDDIADLKEKKAKILFIRQ--AKEA-DMRKKQNDLSSN-----DNLNILDGLQ 480

Query: 592 KEH 594
           K++
Sbjct: 481 KKN 483

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 60/139 (43%), Gaps = 23/139 (16%)

Query: 1244 RLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1303
            RLD+ +     IS     ++  +   G  EL+  DS + +        +  K  +R+ S 
Sbjct: 955  RLDDIVK---QISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSE 1004

Query: 1304 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYI 1350
            L        SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N  
Sbjct: 1005 LQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENAC 1064

Query: 1351 KERTKNAQFIVISLRNNMF 1369
             E T     I   L  N+F
Sbjct: 1065 AENTSQYFLITPKLLTNLF 1083

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 76/161 (47%), Gaps = 14/161 (8%)

Query: 129 INRLSLHNFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQG 185
           I ++ L NF +YA T+    FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 186 KLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKN-NTSKYY 244
           ++ D I   E     D C +E+  +    ++ G   V      + +TR   ++   S Y+
Sbjct: 104 RVEDFIKNGE-----DECEIEITLKN-NSKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 245 VNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           +N + +S   V  ++ +  I LD+    + Q  VE  A++K
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK 198

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 74/165 (44%), Gaps = 28/165 (16%)

Query: 1230 RDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDP--FSEGV 1287
            RDSV++  D L + RLDE +     +S     ++  +   G   LE      P  FSE  
Sbjct: 922  RDSVKEKRDVL-EPRLDEVVQ---RVSQRFARLFVGVGSAGAVNLE-----KPTLFSEWK 972

Query: 1288 LFSVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1342
            L  +M   +    +  L     SGGE+ +S++  + AL ++   P  V+DEI+  +D RN
Sbjct: 973  L-EIMVKFRDNATLKRLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRN 1031

Query: 1343 VSIVANYIKERT---KNAQFIVISLRNNMFELAQQLVGIYKNRNM 1384
              IV   + E       +Q+ +I+         + L G+Y +  M
Sbjct: 1032 ERIVHKAMVENACAENTSQYFLIT--------PKLLTGLYYHEKM 1068

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 76/169 (44%), Gaps = 32/169 (18%)

Query: 129 INRLSLHNFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQG 185
           I  L L NF +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYALTE----FHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 186 KLSDLIHKSEAHPNLDSCHVEVFFQ--------YVQDELDGRTTVRQDRPGLVVTRKAFK 237
           K+ D I   E     D   +EV  +        YV    DG T V         TR   +
Sbjct: 103 KIEDYIKNGE-----DRSVIEVTLKRDPEAEDRYVAS--DGTTKV---------TRVLHR 146

Query: 238 N-NTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           N   S+Y++NG+  + + V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 147 NRKASEYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1362 IS 1363
            ++
Sbjct: 1049 VT 1050

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 99/215 (46%), Gaps = 30/215 (13%)

Query: 104 TKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGS 162
           TKK +L  +  +Q     QP     I ++ L NF +Y  T+  + P   S + ++GPNGS
Sbjct: 20  TKKLKLAPRTYDQF----QP---GSIVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGS 69

Query: 163 GKSNVIDSLLFVFGFRANKM-RQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQD--ELDGR 219
           GKS  + ++      +   + R  ++ D I   E     D+  +E+F +  +D  EL   
Sbjct: 70  GKSTFVCAVCLGLAGKPEFIGRAKRVDDFIKNGE-----DTSRIEIFLKNYEDPTELQSS 124

Query: 220 TTVRQDRPG---LVVTRKAFKNNT---SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLI 273
             ++ +  G   L VTR   ++     S Y++N K  +   +  L++   I LD+    +
Sbjct: 125 LNLKFNLAGKDLLKVTRLIQRDGNKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFL 184

Query: 274 LQGEVESIAQMKP-----KAEKEGDDGLLEYLEDI 303
            Q  VE  A++K      +  +  D  LL+ L+D+
Sbjct: 185 SQERVEEFARLKSDKLLVETVRSIDAQLLQILDDL 219

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1362 IS 1363
            I+
Sbjct: 1050 IT 1051

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 79/166 (47%), Gaps = 12/166 (7%)

Query: 123 PIERLCINRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANK 181
           P     I ++ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   
Sbjct: 30  PFHPGAIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEF 86

Query: 182 MRQGK-LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT 240
           +++ K + D I   E     D   +E+  +    +++G   V  +   + +TR+  K+ +
Sbjct: 87  IKRSKRVEDFIKNGE-----DRGSIEITLKN-SPKVEGMPGVDSEADTIKITRELIKSKS 140

Query: 241 -SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
            S+Y +N +  S   V  L+ K  I LD+    + Q  VE  A++K
Sbjct: 141 KSRYMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLK 186

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1359
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1360 IVIS 1363
             +I+
Sbjct: 1039 FLIT 1042

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 1282 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1341
            P  + +++++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1342 NVSIVANYIKERTKN---AQFIVIS 1363
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 13/78 (16%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I ++SL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 74  IKKVSLRNFMCHENFELALGP---RLNFIVGNNGSGKSAILTAITIGLGAKASDTNRGTS 130

Query: 187 LSDLIHKSEAHPNLDSCH 204
           L  LI         + CH
Sbjct: 131 LKSLIK--------EGCH 140

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 76/160 (47%), Gaps = 15/160 (9%)

Query: 129 INRLSLHNFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186
           I +L L NF +Y+ T+    FH   S + ++GPNGSGKS  + ++      +   + +GK
Sbjct: 69  IVKLRLENFVTYSLTE----FHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLV-VTRKAFKNNTSKYYV 245
             D   K+  +  L    +EV  +  +D   GRT       G   V+R  +    S+YY+
Sbjct: 125 RVDSFIKNGENRGL----IEVTLK--RD--PGRTGSFVAVDGTTKVSRVLWVGKKSEYYL 176

Query: 246 NGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           N +  S   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 177 NDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 75/162 (46%), Gaps = 14/162 (8%)

Query: 1206 LEEYTKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQM 1265
            LE   + +   QA   +L  A+E+  SV +         +D  + G   IS+    ++Q 
Sbjct: 922  LETLNRSIPQIQASLNDLTIAIEKERSVLE-------PNVDGIVEG---ISINFSRLFQN 971

Query: 1266 ITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL-SGGEKTLSSLALVFALHKYK 1324
            +  GG+  LE  +    +   ++          +  S + SGGE+ +S++  + AL ++ 
Sbjct: 972  VGSGGSVVLEKNELFSNWKINIMVRFRDSALMKKLDSQIQSGGERAVSTVLYMIALQEFT 1031

Query: 1325 PTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIVIS 1363
              P  ++DEI+  +D RN  IV   + E     K +Q+I+++
Sbjct: 1032 SAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYILVT 1073

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 77/173 (44%), Gaps = 18/173 (10%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGK 186
           I ++ L NF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 187 LSDLIHKSEA----------HPNLDSCHVEVFFQYVQDELDGR---TTVRQDRPGLVVTR 233
           + D I   +            PN+D   +   F  +++  + +   T  R       + R
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGR 154

Query: 234 KAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKP 286
              K  T +Y +NG  ++ + V  L+ K  I LD+    + Q  VE  A+++P
Sbjct: 155 NLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 68/147 (46%), Gaps = 28/147 (19%)

Query: 1237 CDNLRKK----------RLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1286
            C+ +RK+          RL+  ++G   I     E+++ +   G   L     L  FS+ 
Sbjct: 923  CNTIRKEMSDKQKVLEPRLESIVSG---IGRKFSELFKDVGTAGGVTLNRKSKL--FSDW 977

Query: 1287 VLFSVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-- 1339
             L  +M   +    +S L     SGGE+ +S++  + AL K+   P  V+DEI+  +D  
Sbjct: 978  KL-EIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTN 1036

Query: 1340 ---FRNVSIVANYIKERTKNAQFIVIS 1363
                 + ++V N  +E T  +Q+ +I+
Sbjct: 1037 FERLVHKAMVQNACEEGT--SQYFLIT 1061

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 19/191 (9%)

Query: 101 LSPTKKTRLESQKTEQVRGLAQPIERL-----CINRLSLHNFKSYAGTQVVGPFHSSFSA 155
           +SPTK  ++ + K  + R     I+        I ++ L NF +Y+  +       S + 
Sbjct: 11  VSPTKDRQISTSKPARKRLKITAIDTEQFQPGSIIKIKLWNFVTYSLAEFT--LSPSLNM 68

Query: 156 VVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLSDLIHKSEAHPNLDSCHVEVFFQYVQD 214
           ++GPNGSGKS  + ++      +   + R  KL D I   E     D   VEV  + V +
Sbjct: 69  IIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGE-----DQSVVEVTLKNVPE 123

Query: 215 ELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLIL 274
                 T+      L+ T         +Y +NG   + T +   ++K  I LD+    + 
Sbjct: 124 SDFNTDTI------LIKTTINRGKKKPEYAINGSTVTETYIRAFVKKLNIQLDNLCQFLS 177

Query: 275 QGEVESIAQMK 285
           Q  VE  A++K
Sbjct: 178 QERVEEFARLK 188

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1362 IS 1363
            I+
Sbjct: 1044 IT 1045

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 82/185 (44%), Gaps = 31/185 (16%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGK 186
           I +L L N  +Y+ T+  + P   S + +VGPNGSGKS  + ++      +   + R  K
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVV--TRKAFKNNT-SKY 243
           + + I   E    +D                  T +R   P  V+  TR   +N   S+Y
Sbjct: 94  IDNFIKNGENTAQID------------------TFLRGHMPNEVIKITRIMTRNKKKSEY 135

Query: 244 YVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKP-----KAEKEGDDGLLE 298
           Y++   S+ T V +L  +  I LD+    + Q  VE  A++K      +  +  +  LLE
Sbjct: 136 YIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLE 195

Query: 299 YLEDI 303
            LED+
Sbjct: 196 TLEDL 200

 Score = 40.4 bits (93), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1362 IS 1363
            I+
Sbjct: 1035 IT 1036

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa]
           {ON} Anc_7.101 YOL034W
          Length = 1117

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 84/185 (45%), Gaps = 12/185 (6%)

Query: 104 TKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGS 162
           T  TR  +++ + +R      +   I ++ LHNF +Y  T+  + P   S + ++GPNGS
Sbjct: 41  TVHTRAVNKRQKLIRDNLADFKPGSIIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGS 97

Query: 163 GKSNVIDSLLFVFGFRANKM-RQGKLSDLIHKSEAHPNLD-SCHVEVFFQYVQDELDGRT 220
           GKS  + ++      +   + R   + D I   E H  ++ +         V+  L+G  
Sbjct: 98  GKSTFVCAVCLGLAGKPEYIGRSRNVDDYIKNDEEHGEIEITLKNSEAIHDVEGVLEGSD 157

Query: 221 TVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVES 280
           T+   R   ++TR   K   S+Y +N    +   V EL+    I LD+    + Q  VE 
Sbjct: 158 TITITR---ILTRSKKK---SEYKINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEE 211

Query: 281 IAQMK 285
            A++K
Sbjct: 212 FARLK 216

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1362 IS 1363
            I+
Sbjct: 1072 IT 1073

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1288 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1347
            +F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 996  IFILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGT 1055

Query: 1348 NYIKERTKN---AQFIVIS 1363
              I  + K+    Q I+I+
Sbjct: 1056 KLILNKLKDIARTQTIIIT 1074

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 9/88 (10%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA    +G  
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 187 LSDLI----HKSEAHPNLDSCHVEVFFQ 210
           L DLI    H ++   +LD+ +   ++Q
Sbjct: 132 LKDLIREGCHSTKIRLHLDNLNHGAYYQ 159

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 84/165 (50%), Gaps = 24/165 (14%)

Query: 1213 LVDFQARKLELNKAVEQRDSVRQNCDNLRKK---RLDEFMNGFNTISMTLKEMYQMITMG 1269
            L D +  + +L   V++  S+R+   ++R +   RLDE +     IS   ++++  + +G
Sbjct: 899  LSDIKYLQEKLPGQVKRLSSIRRKMWSIRSELEPRLDEIVEN---ISTRFRKLF--LNVG 953

Query: 1270 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL--------SGGEKTLSSLALVFALH 1321
               E+ LV   D +SE  +      K  +R+++ L        SGGE+ +S++  + +L 
Sbjct: 954  SAGEVCLVKP-DLYSEWKI----EIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQ 1008

Query: 1322 KYKPTPLYVMDEIDAALDFRNVSIVANYIKER--TKN-AQFIVIS 1363
            ++   P  V+DEI+  +D RN  IV   + E    KN +Q+ +I+
Sbjct: 1009 EFTNAPFRVVDEINQGMDARNERIVHKAMVENACAKNTSQYFLIT 1053

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 97/224 (43%), Gaps = 33/224 (14%)

Query: 128 CINRLSLHNFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQ 184
            I +L L NF +Y+ T+    FH   S + ++GPNGSGKS+ + ++      +   + R 
Sbjct: 45  AIIKLRLVNFVTYSLTE----FHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRA 100

Query: 185 GKLSDLIHKS--EAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSK 242
            K+ D I     E+   L   + +    Y    + G   V   +  ++  +K        
Sbjct: 101 KKVEDFIKNGTEESVIELTVKNSKAVSGYSM--IGGSDEVINIKTVIMKAKKK-----CI 153

Query: 243 YYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLED 302
           YY+NG+     QV  L+    I LD+    + Q  VE  A++K        D LLE  E 
Sbjct: 154 YYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKS-------DKLLE--ET 204

Query: 303 IIGTAKYKPLIEQTLVQ-IDQLNDVCQEKENRYEIVEREKSSLE 345
           I         I+ TLV+ +D L D  QE+      VE  KS LE
Sbjct: 205 IRS-------IDSTLVEKLDMLKDKQQEEVTIGRDVELNKSKLE 241

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 99/449 (22%), Positives = 185/449 (41%), Gaps = 77/449 (17%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGK 186
           I ++ L NF +Y  T+  + P   S + ++GPNGSGKS  + +       +   + R  +
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQYVQ--DELD-------------GRTTVRQDRPGLV- 230
           + D I   E     D   +E+F + V+  D+L               +  ++  +  L+ 
Sbjct: 109 VDDYIKNGE-----DRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIK 163

Query: 231 VTRKAFKNNT-SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKP--- 286
            TR   ++   S YY+N K  S   V  L++   I LD+    + Q  VE  A++K    
Sbjct: 164 FTRIIHRDKKKSDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKSDKL 223

Query: 287 --KAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSL 344
             +  +  D  LL+ LE++    K     EQT+       D  + K+ RY  +  E++ L
Sbjct: 224 LVETVRSIDPNLLDILEEL----KVLQNEEQTV------EDELEIKQKRYTELCNERTKL 273

Query: 345 ESGXXXXXXXXXXXXXXXXXRSKLLQHKLWKNSFKSTNTQEKIKTLEEKLSAERAKYTEH 404
           E+                   +KLL + +             IK   EKL   +  Y   
Sbjct: 274 EASVQSLKEFENKKLEIEY-HNKLLPYVM-------------IKDHREKLQKFKGDYEIA 319

Query: 405 KREIKQLESESKSLNVTIRGIKDSESSLTSEKRT------CDRD------------RVSL 446
           KR ++ L  + K    T   I+++ + +  +KRT        +D            R S+
Sbjct: 320 KRNLRDLMKDKKPFVKTKLEIEENLNEIAEDKRTNETALESSKDALSKTVENLNAIRESI 379

Query: 447 EEKLKNISQKKVKAEKTHH---ATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEK 503
            +K   IS  + + +K      +T + +   Q+  + +   ++    E D+  + L+ E 
Sbjct: 380 VKKQSQISYYQSRTKKLQQQILSTKSELERQQSLFDSMTPPEISLFDEFDKKREELINED 439

Query: 504 TKLDEIKISLKGKTGAISVQIGEIEQELE 532
            K+++  I++K K    + +IG + +++E
Sbjct: 440 LKINDQLIAIKNKGSQNNHEIGMLTKKIE 468

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1362 IS 1363
            I+
Sbjct: 1074 IT 1075

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar
           to uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I +L+LHNF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 187 LSDLI 191
           L DLI
Sbjct: 137 LKDLI 141

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1288 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1347
            +  + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +
Sbjct: 1004 ILILTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGS 1063

Query: 1348 NYIKERTK---NAQFIVIS 1363
              I ++ K   N Q I+I+
Sbjct: 1064 KLIVKKLKDIPNTQTIIIT 1082

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1288 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1347
            +F +    +  RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 981  MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGT 1040

Query: 1348 NYIKERTKN---AQFIVIS 1363
              + ++ K+    Q I+I+
Sbjct: 1041 TLVVKKLKDLARTQTIIIT 1059

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++SL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A+   +G  
Sbjct: 64  IKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRGNS 120

Query: 187 LSDLI 191
           L +LI
Sbjct: 121 LKELI 125

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 71/163 (43%), Gaps = 16/163 (9%)

Query: 128 CINRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQG 185
           CI ++ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  CITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 186 KLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD---RPGLVVTRKAFKNNTSK 242
           K+ D I   +     D   +E+  +      D       D   +   ++TR   +   S 
Sbjct: 98  KVEDFIKNGQ-----DVSRIEITLKNSPKVHDIENINAHDETIKITRIITRSKRR---SD 149

Query: 243 YYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           Y +N  + S   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 150 YLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 ISLRNNMFELAQQLVGIYKNRNM 1384
            I+         + L G+Y +  M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 70/162 (43%), Gaps = 14/162 (8%)

Query: 128 CINRLSLHNFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQ 184
            I  + L NF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRA 100

Query: 185 GKLSDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFK-NNTSKY 243
            ++ D I    A        +E+  +  ++ + G   +  +   + V     K      Y
Sbjct: 101 KRVEDFIKNGTAEST-----IEIQLRNSRN-VSGLPMISAEDEAINVRTVLMKARRKCAY 154

Query: 244 YVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           Y+NG+  S  Q+  L+    I LD+    + Q  VE  A++K
Sbjct: 155 YINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 38.1 bits (87), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 62/131 (47%), Gaps = 21/131 (16%)

Query: 1244 RLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1303
            RLDE +     IS   ++++    +G   E+ L+   D +SE  +      +  +R+++ 
Sbjct: 933  RLDELVEN---ISQRFRKLFS--NVGSAGEICLLKP-DLYSEWKI----EIRVKFRDVAE 982

Query: 1304 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT- 1354
            L        SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E   
Sbjct: 983  LKKLDSHTQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENAC 1042

Query: 1355 --KNAQFIVIS 1363
                +Q+ +I+
Sbjct: 1043 AENTSQYFLIT 1053

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 15/85 (17%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1359
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1360 IVISLRNNMFELAQQLVGIYKNRNM 1384
             +I+         + L G+Y +  M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 90/412 (21%), Positives = 164/412 (39%), Gaps = 72/412 (17%)

Query: 131 RLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLS 188
           +L + NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  KL 
Sbjct: 48  KLRMENFVTYKVAEFDLSP---SLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 189 DLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNT-SKYYVNG 247
           D I   E     +   VEV  +    E++    V+     + +TR   ++   S Y +N 
Sbjct: 105 DFIKNGE-----EKGLVEVTLKKPA-EVEHSPIVKSHDQVIKITRHLSRSKRDSDYQIND 158

Query: 248 KESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTA 307
            E   + V  ++ +  I LD+    + Q  V S A   P+          + LE+   + 
Sbjct: 159 IEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSPE----------KLLEETARSI 208

Query: 308 KYKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXXXXXXXXXRSK 367
             K  + + L  + +L D  ++ +N+    ++   SL++                    +
Sbjct: 209 DIK--LCEVLSLLKELQDEERDHQNKVNSTQKRIDSLKNDCERLRITVSTF--------R 258

Query: 368 LLQHKLWK-NSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIK 426
             Q KL + + +K      ++K LEEKL   RA+Y + K  +K L               
Sbjct: 259 AYQKKLKEIDEYKKLLPYVQLKGLEEKLRQYRAEYEQAKTNLKTL--------------- 303

Query: 427 DSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQV 486
                              L+EK K    +K K E T     N +++ +AK E+L +D  
Sbjct: 304 -------------------LQEKRKLFETQK-KFESTLKEANNKVHSIKAKFEKLSRDST 343

Query: 487 QYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKL 538
           +  K+L  +   +  +K  +       + K G +   + E ++ELE   V+L
Sbjct: 344 RLTKDLKTMRTDIASKKQDIQR----YREKIGGLRNNVAEKKKELEDKRVQL 391

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 39.3 bits (90), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 88/424 (20%), Positives = 176/424 (41%), Gaps = 66/424 (15%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK-L 187
           I ++ L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   +G  L
Sbjct: 85  IKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNSL 142

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYV-- 245
            DLI         + C+       +++   G     +    +++ R   K+  S + +  
Sbjct: 143 KDLIR--------EGCNSTKITIVLENSKYGSYNQGEFGSEIIIERTIKKDGVSHFSLRA 194

Query: 246 -NGKESSYTQ--VTELLRKEGIDLDHKRFLILQGEVESIAQMKPKAEKEGD---DGLLEY 299
            +GKE S+ +  +  ++    + + +    + Q    S        EK G      LL+ 
Sbjct: 195 ESGKEISFKRKDMQTIIDYFSVPVSNPMCFLSQDAARSFLAASSPVEKYGHFMKGTLLQD 254

Query: 300 LEDIIGTAK--YKPLIEQTLVQIDQLNDVCQEKENRYEIVEREKSSLESGXXXXXXXXXX 357
           + D +  A+   K + E+    +D LN + +E E+   ++       E G          
Sbjct: 255 INDNLDRAREITKTVQEKMTTHLDSLNGLKEEYEDAKSLLN------ELG---------- 298

Query: 358 XXXXXXXRSKLLQHK-LWKNSFKSTNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESK 416
                  R KLLQ K LW               ++ K          +K+   +L+ ES 
Sbjct: 299 QTSNFTERKKLLQGKSLW---------------IDIKF---------NKKNCDKLKGESL 334

Query: 417 SLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKNISQKKVKAEK--THHATVNSINAT 474
           +    ++ I+D     T +    D D++++E++++N  Q K+ +EK   H    +S+   
Sbjct: 335 AYKKKMKAIEDKRKVKTDKMERYDNDKLAMEKEIEN--QTKLVSEKDSIHQQAKDSLRKV 392

Query: 475 QAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPW 534
           + K +E  ++Q + EK +++  + + V    +  ++  L+ + G    Q+G   ++ E  
Sbjct: 393 RLKYDEEKRNQSEAEKNIEQCKEKIKVLDKNILHLEQQLQKEMGGDKDQMGVDLKKYESE 452

Query: 535 NVKL 538
           N KL
Sbjct: 453 NEKL 456

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I ++ L NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 88  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 145

Query: 188 SDLI 191
            DLI
Sbjct: 146 KDLI 149

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I ++ L NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 188 SDLI 191
            DLI
Sbjct: 140 KDLI 143

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 33.9 bits (76), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 53/106 (50%), Gaps = 8/106 (7%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I ++ L NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 83  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 140

Query: 188 SDLI----HKSEAHPNLDSCHVEVFFQ-YVQDELDGRTTVRQDRPG 228
            DLI    + ++   +LD+     + Q    +E+    T+++D P 
Sbjct: 141 KDLIREGCYSAKITLHLDNSKYGAYQQGTFGNEIIVERTIKRDGPA 186

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I ++ L NF  +   ++     S  + +VG NGSGKS ++ ++    G +A++  +G  L
Sbjct: 82  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 139

Query: 188 SDLI 191
            DLI
Sbjct: 140 KDLI 143

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 1244 RLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1303
            ++D  + G   IS    +++  +   G  +LE  ++   +   +L       +S R +++
Sbjct: 936  KIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNFSNWQVKILVK-FRDNESVRELTS 991

Query: 1304 LS--GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQ 1358
             S  GGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q
Sbjct: 992  QSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQ 1051

Query: 1359 FIVIS 1363
            +I+++
Sbjct: 1052 YILVT 1056

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 23/173 (13%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKL- 187
           I ++ + NF +Y   +       SF+ ++GPNGSGKS V+ +L      + +   +G + 
Sbjct: 51  IIKIKMKNFMTYGLVEY--QLCPSFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDIV 108

Query: 188 SDLIHKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRK-AFKNNTSKYYVN 246
           +  I   +      S  +E+  +Y  D +     V  +R  + + R+ +     S Y +N
Sbjct: 109 TQYIQNGKT-----SGKIEITLKY-SDRIKNVKGVNPNRETVTIKREISIDAKKSNYKIN 162

Query: 247 GKESSYTQVTELLRKEGIDLDH----------KRFLILQGE---VESIAQMKP 286
               +   V +++ K  I LD+          K F  L+GE   +E+I  + P
Sbjct: 163 NTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLKGEKLLLETIRAVDP 215

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG 185
           I R++L NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRG 116

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1345
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTI 1047

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1353
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1354 TKNAQFIVISLRN--NMFELAQQLVGIYKNRN 1383
              + Q I+I+ ++   M  +  +   I+K +N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 1212 RLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGN 1271
            ++V  Q + LE+ KA  + D        + + +LDE ++    IS     ++  +   G 
Sbjct: 902  QIVPQQTKDLEITKAKLKEDHA------ILEPKLDEIVSK---ISTRFARLFNNVGSAGA 952

Query: 1272 AELELVDSLDPFSEGVL--FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1329
              LE       +   V+  F    P K   + +  SGGE+ +S++  + AL ++   P  
Sbjct: 953  VHLEKPKDYAEWKIEVMVKFRDNAPLKKLDSHTQ-SGGERAVSTVLYMIALQEFTSAPFR 1011

Query: 1330 VMDEIDAALDFRNVSIVANYIKERT---KNAQFIVIS 1363
            V+DEI+  +D RN  IV   + E       +Q+ +I+
Sbjct: 1012 VVDEINQGMDSRNERIVHKAMVENACAENTSQYFLIT 1048

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 75/170 (44%), Gaps = 32/170 (18%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGK 186
           I ++ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 187 LSDLIHKSEAHPNLDSCHVEVF-----------FQYVQDELDGRTTVRQDRPGLVVTRKA 235
           + D I   +     D+  +E+            F    DE     T++  R   ++TR  
Sbjct: 99  VEDFIKNGQ-----DTSRIEITLKNSPKIHDIEFINTHDE-----TIKVTR---IITRSK 145

Query: 236 FKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
            +   S Y +N ++ S   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 146 RR---SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 IS 1363
            I+
Sbjct: 1047 IT 1048

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 68/157 (43%), Gaps = 16/157 (10%)

Query: 134 LHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGKLSDLI 191
           L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  ++ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 192 HKSEAHPNLDSCHVEVFFQYVQDELDGRTTVRQD---RPGLVVTRKAFKNNTSKYYVNGK 248
              +     D   +E+  +      D       D   +   ++TR   +   S Y +N  
Sbjct: 104 KNGQ-----DVSRIEITLKNSPKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDC 155

Query: 249 ESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           E S + V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 156 EVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLK 192

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1305 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1361
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1362 IS 1363
            I+
Sbjct: 1047 IT 1048

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 22/165 (13%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKM-RQGK 186
           I ++ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  K
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 187 LSDLIHKSEAHPNLDSCHVEVFFQ---YVQD--ELDGRT-TVRQDRPGLVVTRKAFKNNT 240
           + D I   +     D   +E+  +    V D   +D R  T++  R   ++TR   +   
Sbjct: 99  VEDFIKNGQ-----DVSKIEITLKNSPNVTDIEYIDARDETIKITR---IITRSKRR--- 147

Query: 241 SKYYVNGKESSYTQVTELLRKEGIDLDHKRFLILQGEVESIAQMK 285
           S Y +N  + S + V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 148 SDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 39.7 bits (91), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1283 FSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340
            FS+G L  ++  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1341 RNVSI----VANYIKERTKNAQFIV 1361
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I ++ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 70  IKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 187 LSDLI 191
           L DLI
Sbjct: 127 LKDLI 131

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.3 bits (90), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1296 KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1355
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1356 N---AQFIVIS 1363
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK- 186
           I ++ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 187 LSDLI 191
           L DLI
Sbjct: 128 LKDLI 132

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG 185
           + R++L NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  MKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1350
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 75/151 (49%), Gaps = 28/151 (18%)

Query: 462 KTHHATVNS-INATQAKLEELFKD---------------QVQYEKE-----LDELNKSLL 500
           +TH+A++ S I     KLEE  +                +V+ EKE     LD    +L 
Sbjct: 704 QTHYASLGSEIKEEGRKLEEQMRSIRSRIVSLELRSKHLKVKIEKEVDTGALDAHKAALN 763

Query: 501 VEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLA 560
           VE +++ +     +G   AI+ Q+ +++ E+EP+  K +  R  +   + ++  LKE + 
Sbjct: 764 VETSQIAQ----HRGAIAAINDQLLQLKDEVEPYKRKHESARQLVAKVKEELEDLKEMIR 819

Query: 561 KIAEEISKSENDIS-NNRKKVA--EQHQAIE 588
             +  I K  +DI+  N+KKVA  E+ Q+I+
Sbjct: 820 VRSHRIDKMTDDITIYNKKKVAYQEEFQSIQ 850

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1302 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1361
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1362 ISL 1364
            IS+
Sbjct: 655  ISI 657

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1345
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I ++ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 75  IKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 131

Query: 187 LSDLI----HKSEAHPNLDSCHVEVFFQYVQ-DELDGRTTVRQDRPGLVVTR 233
           L DLI    + S+    LD+     + Q V  DE+    T+++D P     R
Sbjct: 132 LKDLIKEGRYSSKISIILDNRGYGGYEQGVYGDEIRIERTIKRDGPASFSIR 183

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
            (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1345
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 129 INRLSLHNFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-KL 187
           I ++ L NF  +    V      + + +VG NGSGKS ++ +++   G +A++  +G  L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 188 SDLIHK 193
            +LI K
Sbjct: 131 KELIRK 136

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 36.2 bits (82), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1327 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1377
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1378 IYKNRNMTKSV 1388
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1299 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1356
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1357 -AQFIVIS 1363
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           + ++ L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 187 LSDLI 191
           L DLI
Sbjct: 129 LKDLI 133

>TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON}
           Anc_6.251 YPL226W
          Length = 1198

 Score = 35.8 bits (81), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 12/50 (24%)

Query: 151 SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200
           SS  A++GPNG+GKS +I            K+  G+L  L  K E HPNL
Sbjct: 838 SSRVAILGPNGAGKSTLI------------KLLTGELVPLEGKVEKHPNL 875

>Suva_10.405 Chr10 complement(710020..712770) [2751 bp, 916 aa] {ON}
           YLR309C (REAL)
          Length = 916

 Score = 35.8 bits (81), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 57/98 (58%), Gaps = 3/98 (3%)

Query: 503 KTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKI 562
           K + DEIK  ++   G    Q+G++E+ELE  NV+L   +  +K + +++  +++ L  +
Sbjct: 348 KHQYDEIKTKIENANGLEDSQLGKLEKELEKLNVELSATKKSLKEKNSELEEVRDMLRTV 407

Query: 563 AEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQ 600
             E+  ++N I   ++  ++Q++ ++ ++ E  D++ +
Sbjct: 408 GNELVDAKNKI---KESTSQQNEEVKAVKLELDDLRHK 442

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 1293 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1345
            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I
Sbjct: 996  PNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQI 1048

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 129 INRLSLHNFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQG-K 186
           I R+ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 69  IKRVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKAADTNRGSS 125

Query: 187 LSDLI 191
           L DLI
Sbjct: 126 LKDLI 130

>SAKL0A02596g Chr1 complement(235391..237295) [1905 bp, 634 aa] {ON}
           weakly similar to uniprot|Q01649 Saccharomyces
           cerevisiae YMR198W CIK1 is important for proper
           organiziation of microtubule arrays and establishment of
           a spindle is essential for karyogamy and expression is
           regulated by KAR4 and mating spindle pole body
           associated protein and to uniprot|Q12045 YPL253C VIK1
           Protein that forms a complex with Kar3p at the spindle
           pole body, possible regulator of Kar3p function in
           microtubule- mediated processes; required for sister
           chromatid cohesion
          Length = 634

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 99/210 (47%), Gaps = 14/210 (6%)

Query: 430 SSLTSEKRTCDRDRVSLEEKLKNIS-QKKVKAEKTHH----ATVNSINATQAKLEEL--F 482
           + L S+   CD  R + E  + N+  +  V+A+K  +    A  N     + KL E+  +
Sbjct: 137 TELDSKSSECDLHRKNGELCIGNLQLRHSVEAQKVKNELDIAMTNKRAEWEKKLLEIEDY 196

Query: 483 KDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTG----AISVQIGEIEQELEPWNVKL 538
           K  V   +E+D L    L ++T+LD ++   + K       +S Q  E   E E   ++L
Sbjct: 197 KPSVHMIEEIDALKIQRLEKQTELDRLQAKNREKCKEYEETLSKQFAEFVSEKEKPLIEL 256

Query: 539 QEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQ 598
           + KR Q+    TK   L E++  + +++++  N     ++K+ E    IE L++E+  ++
Sbjct: 257 RSKRDQLA---TKRERLYETVRSLKDDVNECVNTKEITKRKIEEIRSKIELLKEENAPLE 313

Query: 599 RQIIIGQTECDNASNKMKEMKAVLTTHRQR 628
           + +    TE   A +K  E +A+  T   R
Sbjct: 314 QSLSQLTTEYQLAESKTDEFRALAHTAEAR 343

>Kpol_1018.59 s1018 complement(175990..176862) [873 bp, 290 aa] {ON}
           complement(175990..176862) [873 nt, 291 aa]
          Length = 290

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 892 QKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSL 951
           + +N +S + L++ +S L+  K   K LE ++ + +  I  LQE I    G K++ +G+ 
Sbjct: 58  EAINTTSINMLLDIDSLLNRSKNNNKHLE-KLDTLEESILSLQENINSFWGAKIKEEGN- 115

Query: 952 VDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQL 990
                Q I I L + + +K   K  EN+L +YE+  G L
Sbjct: 116 -----QEIDIVLKQLEHEKEMRKLYENELTKYEEGLGTL 149

>AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL226W (NEW1)
          Length = 1189

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 12/50 (24%)

Query: 151 SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200
           SS  A++GPNG+GKS +I            K+  G+L     K E HPNL
Sbjct: 832 SSRVAIIGPNGAGKSTLI------------KLLTGELVPTSGKVEKHPNL 869

>Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 10/112 (8%)

Query: 797 GGNHRA--SGMMKSERLNTGASFTAEEVRQIDEELTERERNFKIATDTLH--EMEDALQS 852
           G  +R+   G+ K+ R     + T EE+R+  E L   +    I    +   E+   ++ 
Sbjct: 177 GSGYRSETGGLTKNLR-----TLTNEEIRKFHESLYSSDNLCIIVCGNVPTDELLTVMEK 231

Query: 853 LKDREPEIETDISKRRMEIDSLLSEIKLCEDRAA-SLKKEQKLNESSDDTLI 903
             D  PEI +D+ K+R  +D+ LS I    D+   S  +  +L+ES  D   
Sbjct: 232 WDDTLPEIPSDVPKKRPFLDTKLSHIPQFRDKVTESTVEFPELDESQSDLFF 283

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
            Ashbya gossypii AFR683C
          Length = 683

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 58/98 (59%), Gaps = 7/98 (7%)

Query: 1302 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF-I 1360
            + LSGG+K   ++A  F L    P+ L ++DE  +ALD ++  I+A  ++ R+++ +  I
Sbjct: 567  TQLSGGQKQRIAIARAFIL---DPSIL-ILDEATSALDSQSEDIIAQALRARSESGKITI 622

Query: 1361 VISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLINR 1398
             I+ R +  E + +++ + +N  ++++ A    DLIN+
Sbjct: 623  SIAHRISTIEHSNRVIVLSRNGGVSETGAF--CDLINQ 658

>Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar to
           Ashbya gossypii AFL131W
          Length = 1171

 Score = 34.3 bits (77), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 12/50 (24%)

Query: 151 SSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200
           SS  A++GPNG+GKS +I            K+  G+L     K E HPNL
Sbjct: 814 SSRVAIIGPNGAGKSTLI------------KLLTGELVPSSGKVEKHPNL 851

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 33.5 bits (75), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 10/72 (13%)

Query: 1283 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1342
            F EGV  +++ P+ +      LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGV-NTLVGPRGT-----QLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1343 VSIVANYIKERT 1354
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>TBLA0A05720 Chr1 (1417989..1421912) [3924 bp, 1307 aa] {ON}
           Anc_1.110 YNL250W
          Length = 1307

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 56/108 (51%), Gaps = 11/108 (10%)

Query: 474 TQAKLEELFKDQVQYEKELDELNKSL-------LVEKTKLDEIKISLKGKTGAISVQIGE 526
           T AK E   K+ V+ EKE  E+ +SL        + KTK ++I ISL      +  +  E
Sbjct: 705 TDAKFEISLKETVENEKEYLEILRSLEKDILSLKISKTKYNDINISL----TKLETEENE 760

Query: 527 IEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDIS 574
            +++L+ +   L + +S+    E  I  + ES  ++  EI +SE+D+S
Sbjct: 761 AKKKLDDFEKSLTDLKSERDYAENTIRPIIESKLRLQNEIKRSEHDVS 808

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 113/237 (47%), Gaps = 21/237 (8%)

Query: 383  TQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRD 442
            T+EK  ++ + L    +KY   + E + LE+       TI+ +KD+ S LT++    +  
Sbjct: 1142 TKEKFNSVNDDLEELNSKYVTIEEEKRTLENSINENQFTIKELKDNISGLTNDYNALESS 1201

Query: 443  RVSLEEKLKN----ISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKS 498
            ++ LEE+L +    + QK     +     +  I++ + KL  L ++     K+L+++N+ 
Sbjct: 1202 KLDLEEELSSQTTELDQKDTSLAELSKK-LEEISSEKLKLNSLLQNTETNLKDLEKVNED 1260

Query: 499  LLVEKTKLDEIKI-SLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKE 557
                     EI+I SL+ +   +     E + +L+    +L +K  Q+  E   +   KE
Sbjct: 1261 --------KEIRIQSLEKELKVVKSNSKETDNKLQ----ELSDKHDQMSREYEILKADKE 1308

Query: 558  SLAKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNK 614
            SL    E++ K  ND   N +K+    ++++ L+KE T +Q  +   + E ++   K
Sbjct: 1309 SLLNSKEKLYKQYND---NVEKINNYEESLKQLKKEKTTLQANLKTTEAELNDLQEK 1362

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 150/308 (48%), Gaps = 53/308 (17%)

Query: 376  NSFKSTNTQE---KIKTLEEKLSAERAKYTEHKREIK-QLESESKSLNVTIRGIKDSESS 431
            N   ST TQE   KI  LEEKL             IK + E+ESKS     + I  S S 
Sbjct: 1373 NEGSSTITQEYSEKINMLEEKL-------------IKIENENESKS-----KMIDTSRSE 1414

Query: 432  LTSEKRTCD-------------RDRV-SLEEKLKNISQKKVKAEKTHHATVNSINATQAK 477
            L     TC+             +D++ S EEK+K  ++K +  E+ +   +NS+   + +
Sbjct: 1415 LEKATSTCNELLEANRNEMKSMKDKILSYEEKIKEANEKLLSTEQGNEQELNSL---RKQ 1471

Query: 478  LEELFKDQVQYEKELDELNKSLLVEKTKLDEIKISLKGKTGAISVQIGEIEQELE---PW 534
            LE + + +V+ E EL E+ +    +  +L+  K  ++     I  +  EI+  +E    +
Sbjct: 1472 LEVVQEAKVKIEGELKEMEEKTTSQTLELERSKEIMRKLESTIVSKEKEIDSSIEFRKEF 1531

Query: 535  NVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSENDISNNRKKV---AEQHQAIEGLE 591
            + K++E + + + E   I  L+E  A +  +I +S+  I + + K+   AE  + +E ++
Sbjct: 1532 DKKIEEHKKKAQEE---IRNLQEEKANLVAQIVESKKGIEDLQGKLKGEAESGRELEAIQ 1588

Query: 592  KEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQR---SLDAKSSLST--FENKNKVL 646
            KE T+  ++I I   E    ++K+K+ +  L  ++++   S + K S+S+   E K  + 
Sbjct: 1589 KELTNAHQKIKINVEESALLNSKLKDSERALRDNQEKLEGSKEEKESMSSQLTELKRMLN 1648

Query: 647  SALQRLQR 654
            SA QR ++
Sbjct: 1649 SAQQRTKK 1656

>Suva_16.511 Chr16 complement(876329..878284) [1956 bp, 651 aa] {ON}
           YPR179C (REAL)
          Length = 651

 Score = 32.7 bits (73), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 22/116 (18%)

Query: 888 LKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQL 947
           +++E+++N+S D               E + +E E+K   + I+E  E+  KIG  + +L
Sbjct: 533 IEREERINKSKD--------------TEREYMEQEIKRAADAIRENDEETSKIGDKRREL 578

Query: 948 QGSLVDSIGQRISITLGKQKRDKTAVK----KAENDLKRYEKQAGQLSVDIDQCTN 999
           +  L   +G   +I   ++ R+K A+     K ENDL R  +  GQLS  +D   N
Sbjct: 579 ENELNSKLGDTEAIK--EELREKVALLKREIKLENDLNR--ELVGQLSKTMDNLEN 630

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,054,892
Number of extensions: 5795593
Number of successful extensions: 35387
Number of sequences better than 10.0: 1534
Number of HSP's gapped: 33283
Number of HSP's successfully gapped: 3232
Length of query: 1399
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1277
Effective length of database: 39,492,147
Effective search space: 50431471719
Effective search space used: 50431471719
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)